BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033G15

Length=770
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003519090.1|  PREDICTED: eukaryotic translation initiation...    392   5e-132   Glycine max [soybeans]
emb|CDP14171.1|  unnamed protein product                                389   1e-131   Coffea canephora [robusta coffee]
ref|XP_002532670.1|  eukaryotic translation initiation factor 3 s...    387   1e-131   
ref|XP_007145575.1|  hypothetical protein PHAVU_007G250100g             391   1e-131   Phaseolus vulgaris [French bean]
gb|KHN41695.1|  Eukaryotic translation initiation factor 3 subunit E    391   2e-131   Glycine soja [wild soybean]
ref|XP_007202066.1|  hypothetical protein PRUPE_ppa005923mg             390   5e-131   Prunus persica
ref|XP_004516371.1|  PREDICTED: eukaryotic translation initiation...    389   8e-131   Cicer arietinum [garbanzo]
ref|XP_009782891.1|  PREDICTED: eukaryotic translation initiation...    389   1e-130   Nicotiana sylvestris
ref|XP_009363228.1|  PREDICTED: eukaryotic translation initiation...    388   2e-130   Pyrus x bretschneideri [bai li]
ref|XP_008351631.1|  PREDICTED: eukaryotic translation initiation...    388   2e-130   
gb|ACU17653.1|  unknown                                                 384   2e-130   Glycine max [soybeans]
ref|XP_009630704.1|  PREDICTED: eukaryotic translation initiation...    388   3e-130   Nicotiana tomentosiformis
ref|XP_006491490.1|  PREDICTED: eukaryotic translation initiation...    387   4e-130   
gb|KDP26094.1|  hypothetical protein JCGZ_21127                         386   1e-129   Jatropha curcas
ref|XP_004162816.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    382   1e-129   
gb|KEH41514.1|  eukaryotic translation initiation factor 3E             386   1e-129   Medicago truncatula
ref|XP_003535892.1|  PREDICTED: eukaryotic translation initiation...    386   1e-129   Glycine max [soybeans]
gb|EYU18691.1|  hypothetical protein MIMGU_mgv1a006587mg                385   2e-129   Erythranthe guttata [common monkey flower]
ref|XP_006421164.1|  hypothetical protein CICLE_v10004983mg             385   5e-129   Citrus clementina [clementine]
ref|XP_004303635.1|  PREDICTED: eukaryotic translation initiation...    385   5e-129   Fragaria vesca subsp. vesca
ref|XP_008244286.1|  PREDICTED: eukaryotic translation initiation...    384   1e-128   Prunus mume [ume]
ref|XP_011078923.1|  PREDICTED: eukaryotic translation initiation...    383   3e-128   Sesamum indicum [beniseed]
ref|XP_008464598.1|  PREDICTED: eukaryotic translation initiation...    382   4e-128   Cucumis melo [Oriental melon]
ref|XP_004142652.1|  PREDICTED: eukaryotic translation initiation...    382   5e-128   Cucumis sativus [cucumbers]
ref|XP_010504654.1|  PREDICTED: eukaryotic translation initiation...    382   1e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010427598.1|  PREDICTED: eukaryotic translation initiation...    381   1e-127   Camelina sativa [gold-of-pleasure]
ref|XP_011015724.1|  PREDICTED: eukaryotic translation initiation...    379   2e-127   Populus euphratica
ref|XP_007030845.1|  Eukaryotic translation initiation factor 3E        381   2e-127   
ref|XP_002878144.1|  hypothetical protein ARALYDRAFT_486171             381   2e-127   Arabidopsis lyrata subsp. lyrata
ref|NP_567047.1|  eukaryotic translation initiation factor 3E           380   2e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516342.1|  PREDICTED: eukaryotic translation initiation...    380   3e-127   Camelina sativa [gold-of-pleasure]
ref|XP_002308015.1|  eukaryotic translation initiation factor 3E ...    380   4e-127   Populus trichocarpa [western balsam poplar]
ref|XP_011048096.1|  PREDICTED: eukaryotic translation initiation...    380   4e-127   Populus euphratica
ref|XP_006291150.1|  hypothetical protein CARUB_v10017266mg             380   5e-127   Capsella rubella
ref|XP_006402894.1|  hypothetical protein EUTSA_v10005924mg             380   1e-126   
emb|CBI33382.3|  unnamed protein product                                377   1e-126   Vitis vinifera
ref|XP_002322658.1|  eukaryotic translation initiation factor 3E ...    378   2e-126   Populus trichocarpa [western balsam poplar]
ref|XP_009363227.1|  PREDICTED: eukaryotic translation initiation...    379   2e-126   
emb|CDY06117.1|  BnaA09g36630D                                          378   2e-126   
gb|ACJ84594.1|  unknown                                                 370   3e-126   Medicago truncatula
ref|XP_011075359.1|  PREDICTED: eukaryotic translation initiation...    377   3e-126   Sesamum indicum [beniseed]
ref|XP_011015723.1|  PREDICTED: eukaryotic translation initiation...    377   3e-126   Populus euphratica
ref|XP_009116433.1|  PREDICTED: eukaryotic translation initiation...    377   4e-126   Brassica rapa
ref|XP_010523678.1|  PREDICTED: eukaryotic translation initiation...    377   6e-126   Tarenaya hassleriana [spider flower]
ref|XP_010056741.1|  PREDICTED: eukaryotic translation initiation...    377   8e-126   Eucalyptus grandis [rose gum]
ref|XP_002284533.1|  PREDICTED: eukaryotic translation initiation...    376   1e-125   Vitis vinifera
gb|EYU20768.1|  hypothetical protein MIMGU_mgv1a006585mg                375   2e-125   Erythranthe guttata [common monkey flower]
emb|CDX72053.1|  BnaC08g28210D                                          375   4e-125   
emb|CDX88939.1|  BnaA04g02470D                                          375   4e-125   
gb|KJB46272.1|  hypothetical protein B456_007G355700                    374   6e-125   Gossypium raimondii
gb|AAF67757.1|AF255679_1  eIF3e                                         374   7e-125   Arabidopsis thaliana [mouse-ear cress]
gb|KJB46273.1|  hypothetical protein B456_007G355800                    374   8e-125   Gossypium raimondii
emb|CAB68135.1|  translation initiation factor 3-like protein           373   1e-124   Arabidopsis thaliana [mouse-ear cress]
gb|KHG29831.1|  Eukaryotic translation initiation factor 3 subunit E    374   1e-124   Gossypium arboreum [tree cotton]
ref|XP_009139041.1|  PREDICTED: eukaryotic translation initiation...    373   2e-124   Brassica rapa
gb|KEH38776.1|  eukaryotic translation initiation factor 3E             373   3e-124   Medicago truncatula
emb|CDP21587.1|  unnamed protein product                                370   4e-124   Coffea canephora [robusta coffee]
gb|KFK34965.1|  hypothetical protein AALP_AA5G216900                    372   8e-124   Arabis alpina [alpine rockcress]
gb|AFK46442.1|  unknown                                                 370   2e-123   Medicago truncatula
ref|XP_004249215.1|  PREDICTED: eukaryotic translation initiation...    370   4e-123   Solanum lycopersicum
emb|CDY30993.1|  BnaC04g24310D                                          368   2e-122   Brassica napus [oilseed rape]
ref|XP_006351291.1|  PREDICTED: eukaryotic translation initiation...    367   3e-122   Solanum tuberosum [potatoes]
ref|XP_011033185.1|  PREDICTED: eukaryotic translation initiation...    367   4e-122   Populus euphratica
ref|XP_010554805.1|  PREDICTED: eukaryotic translation initiation...    365   4e-121   Tarenaya hassleriana [spider flower]
ref|XP_010672915.1|  PREDICTED: eukaryotic translation initiation...    362   5e-120   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73624.1|  hypothetical protein M569_01130                         353   1e-116   Genlisea aurea
ref|XP_010090220.1|  Eukaryotic translation initiation factor 3 s...    349   4e-115   Morus notabilis
ref|XP_010279582.1|  PREDICTED: eukaryotic translation initiation...    344   4e-113   Nelumbo nucifera [Indian lotus]
ref|XP_010269659.1|  PREDICTED: eukaryotic translation initiation...    342   2e-112   Nelumbo nucifera [Indian lotus]
gb|AIZ68193.1|  eukaryotic translation initiation factor 3 subuni...    306   2e-98    Ornithogalum longebracteatum [sea-onion]
ref|XP_006657560.1|  PREDICTED: eukaryotic translation initiation...    306   3e-98    
ref|XP_004955814.1|  PREDICTED: eukaryotic translation initiation...    303   4e-97    Setaria italica
ref|XP_003557378.1|  PREDICTED: eukaryotic translation initiation...    302   1e-96    Brachypodium distachyon [annual false brome]
gb|ABK34467.1|  eukaryotic initiation factor 3e                         300   5e-96    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD30374.1|  putative eIF3e                                         298   9e-96    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058974.2|  Os07g0167000                                       298   1e-95    
dbj|BAD30375.1|  putative eIF3e                                         298   1e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008806586.1|  PREDICTED: eukaryotic translation initiation...    299   2e-95    Phoenix dactylifera
ref|XP_006837958.1|  hypothetical protein AMTR_s00102p00062980          299   2e-95    Amborella trichopoda
ref|NP_001131771.1|  uncharacterized protein LOC100193141               299   2e-95    Zea mays [maize]
ref|NP_001059202.1|  Os07g0222300                                       298   3e-95    
gb|ABK34475.1|  eukaryotic initiation factor 3e                         298   4e-95    Oryza sativa Indica Group [Indian rice]
gb|ACN40777.1|  unknown                                                 296   2e-94    Picea sitchensis
gb|ACN28978.1|  unknown                                                 296   2e-94    Zea mays [maize]
ref|NP_001150632.1|  eukaryotic translation initiation factor 3 s...    295   6e-94    Zea mays [maize]
ref|XP_010922234.1|  PREDICTED: eukaryotic translation initiation...    295   8e-94    Elaeis guineensis
ref|XP_010931576.1|  PREDICTED: eukaryotic translation initiation...    288   2e-91    Elaeis guineensis
ref|XP_008786889.1|  PREDICTED: eukaryotic translation initiation...    286   1e-90    Phoenix dactylifera
gb|EMS48036.1|  Eukaryotic translation initiation factor 3 subunit E    286   1e-90    Triticum urartu
ref|XP_009410425.1|  PREDICTED: eukaryotic translation initiation...    285   4e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001765099.1|  predicted protein                                  282   6e-89    
gb|EMT06719.1|  hypothetical protein F775_27177                         285   8e-89    
ref|XP_001753385.1|  predicted protein                                  282   9e-89    
gb|ABR16601.1|  unknown                                                 277   2e-87    Picea sitchensis
ref|XP_004955815.1|  PREDICTED: eukaryotic translation initiation...    277   5e-87    Setaria italica
ref|NP_001059730.1|  Os07g0503700                                       276   9e-87    
ref|XP_001783391.1|  predicted protein                                  276   2e-86    
gb|AFK36338.1|  unknown                                                 251   5e-81    Medicago truncatula
gb|ACJ84968.1|  unknown                                                 249   2e-80    Medicago truncatula
ref|XP_002992749.1|  hypothetical protein SELMODRAFT_269977             248   1e-75    
gb|KHG29832.1|  Eukaryotic translation initiation factor 3 subunit E    241   5e-74    Gossypium arboreum [tree cotton]
ref|XP_004340264.1|  eukaryotic translation initiation factor 3 s...    235   9e-71    Acanthamoeba castellanii str. Neff
ref|XP_005651050.1|  eukaryotic translation initiation factor 3, ...    234   2e-70    Coccomyxa subellipsoidea C-169
ref|XP_001636266.1|  predicted protein                                  234   2e-70    Nematostella vectensis
ref|XP_002503313.1|  predicted protein                                  230   7e-69    Micromonas commoda
ref|XP_002609740.1|  hypothetical protein BRAFLDRAFT_114473             223   5e-66    Branchiostoma floridae
ref|XP_002735030.1|  PREDICTED: eukaryotic translation initiation...    221   2e-65    Saccoglossus kowalevskii
gb|ELT88021.1|  hypothetical protein CAPTEDRAFT_159549                  221   3e-65    Capitella teleta
ref|XP_007103493.1|  PREDICTED: eukaryotic translation initiation...    214   4e-65    
ref|XP_002161128.2|  PREDICTED: eukaryotic translation initiation...    219   5e-65    
ref|XP_004349023.1|  eukaryotic translation initiation factor 3 s...    219   1e-64    Capsaspora owczarzaki ATCC 30864
gb|EFX82001.1|  hypothetical protein DAPPUDRAFT_302804                  219   1e-64    Daphnia pulex
ref|XP_003058422.1|  predicted protein                                  219   1e-64    Micromonas pusilla CCMP1545
gb|KFP26814.1|  Eukaryotic translation initiation factor 3 subunit E    213   1e-64    Colius striatus
ref|XP_010205044.1|  PREDICTED: eukaryotic translation initiation...    213   2e-64    Colius striatus
ref|XP_008329343.1|  PREDICTED: eukaryotic translation initiation...    211   2e-64    
gb|KJE91084.1|  eukaryotic translation initiation factor 3 subunit E    219   2e-64    Capsaspora owczarzaki ATCC 30864
ref|XP_009699963.1|  PREDICTED: eukaryotic translation initiation...    214   3e-64    Cariama cristata
gb|EGW09196.1|  Eukaryotic translation initiation factor 3 subunit E    213   3e-64    Cricetulus griseus [Chinese hamsters]
ref|XP_010738667.1|  PREDICTED: eukaryotic translation initiation...    217   8e-64    Larimichthys crocea [croceine croaker]
ref|XP_011454873.1|  PREDICTED: eukaryotic translation initiation...    217   9e-64    Crassostrea gigas
ref|NP_957133.1|  eukaryotic translation initiation factor 3 subu...    217   1e-63    Danio rerio [leopard danio]
ref|XP_005924387.1|  PREDICTED: eukaryotic translation initiation...    216   1e-63    
gb|AAQ97773.1|  eukaryotic translation initiation factor 3, subun...    217   1e-63    Danio rerio [leopard danio]
gb|AAT68096.1|  eukaryotic translation initiation factor 3 subunit 6    216   1e-63    Danio rerio [leopard danio]
gb|ACO13187.1|  Eukaryotic translation initiation factor 3 subunit E    216   2e-63    Lepeophtheirus salmonis
gb|AEB61133.1|  eukaryotic translation initiation factor 3 subuni...    213   2e-63    Equus caballus [domestic horse]
ref|XP_001702351.1|  eukaryotic initiation factor                       216   2e-63    Chlamydomonas reinhardtii
ref|XP_007254559.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    216   2e-63    
gb|KFQ03898.1|  Eukaryotic translation initiation factor 3 subunit E    213   3e-63    Haliaeetus albicilla
ref|XP_009917129.1|  PREDICTED: eukaryotic translation initiation...    213   3e-63    Haliaeetus albicilla
ref|XP_004566824.1|  PREDICTED: eukaryotic translation initiation...    216   3e-63    Maylandia zebra
ref|XP_004580869.1|  PREDICTED: eukaryotic translation initiation...    212   4e-63    Ochotona princeps [southern American pika]
ref|XP_005924386.1|  PREDICTED: eukaryotic translation initiation...    216   4e-63    Haplochromis burtoni
ref|XP_005924385.1|  PREDICTED: eukaryotic translation initiation...    216   4e-63    Haplochromis burtoni
ref|XP_009961792.1|  PREDICTED: eukaryotic translation initiation...    213   5e-63    Tyto alba [Schleiereule]
ref|XP_007932963.1|  PREDICTED: eukaryotic translation initiation...    212   5e-63    Orycteropus afer afer
ref|XP_005894306.1|  PREDICTED: eukaryotic translation initiation...    212   5e-63    Bos mutus
gb|ELR57436.1|  Eukaryotic translation initiation factor 3 subunit E    212   5e-63    Bos mutus
ref|XP_008430171.1|  PREDICTED: eukaryotic translation initiation...    215   5e-63    Poecilia reticulata
ref|XP_006794910.1|  PREDICTED: eukaryotic translation initiation...    215   5e-63    Neolamprologus brichardi [lyretail cichlid]
ref|XP_003453516.1|  PREDICTED: eukaryotic translation initiation...    215   5e-63    Oreochromis niloticus
gb|KFP44698.1|  Eukaryotic translation initiation factor 3 subunit E    213   5e-63    Chlamydotis macqueenii
ref|XP_005706874.1|  translation initiation factor eIF-3 subunit 6      215   6e-63    Galdieria sulphuraria
gb|ACQ58587.1|  Eukaryotic translation initiation factor 3 subunit E    215   7e-63    Anoplopoma fimbria
ref|XP_008283264.1|  PREDICTED: eukaryotic translation initiation...    214   8e-63    Stegastes partitus
ref|XP_007563282.1|  PREDICTED: eukaryotic translation initiation...    214   8e-63    Poecilia formosa
emb|CDQ64768.1|  unnamed protein product                                214   8e-63    Oncorhynchus mykiss
ref|XP_007563199.1|  PREDICTED: eukaryotic translation initiation...    215   9e-63    Poecilia formosa
ref|NP_001135167.1|  eukaryotic translation initiation factor 3 s...    214   9e-63    Salmo salar
ref|XP_007075897.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Panthera tigris altaica
ref|XP_007543240.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    
ref|NP_001006349.1|  eukaryotic translation initiation factor 3 s...    214   1e-62    Gallus gallus [bantam]
gb|KFP91969.1|  Eukaryotic translation initiation factor 3 subunit E    213   1e-62    Apaloderma vittatum
ref|XP_009636687.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Egretta garzetta
ref|XP_008640869.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    
ref|XP_004569303.1|  PREDICTED: eukaryotic translation initiation...    214   1e-62    Maylandia zebra
ref|XP_005431866.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    
ref|XP_009874141.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Apaloderma vittatum
ref|XP_008940950.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Merops nubicus
ref|XP_003447252.1|  PREDICTED: eukaryotic translation initiation...    214   1e-62    Oreochromis niloticus
ref|XP_010303998.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Balearica regulorum gibbericeps
ref|XP_009501057.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Phalacrocorax carbo [common cormorant]
ref|XP_009945610.1|  PREDICTED: eukaryotic translation initiation...    213   1e-62    Leptosomus discolor
ref|XP_009581136.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    Fulmarus glacialis
ref|XP_005799084.1|  PREDICTED: eukaryotic translation initiation...    214   2e-62    Xiphophorus maculatus
ref|XP_009942264.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    Opisthocomus hoazin [hoatzin]
ref|XP_009487117.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    Pelecanus crispus
ref|XP_005479481.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    
gb|KFV47267.1|  Eukaryotic translation initiation factor 3 subunit E    213   2e-62    Gavia stellata
gb|EMC86397.1|  Eukaryotic translation initiation factor 3 subunit E    213   2e-62    
ref|XP_010149413.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    Eurypyga helias
gb|KFV81170.1|  Eukaryotic translation initiation factor 3 subunit E    213   2e-62    Struthio camelus australis
ref|XP_007670472.1|  PREDICTED: eukaryotic translation initiation...    213   2e-62    
gb|EDL08754.1|  mCG16052, isoform CRA_b                                 213   2e-62    Mus musculus [mouse]
ref|XP_002199156.2|  PREDICTED: eukaryotic translation initiation...    213   2e-62    
ref|XP_005170108.1|  PREDICTED: eukaryotic translation initiation...    214   2e-62    
sp|Q1LUA8.2|EI3EB_DANRE  RecName: Full=Eukaryotic translation ini...    214   2e-62    Danio rerio [leopard danio]
ref|NP_001279788.1|  eukaryotic translation initiation factor 3, ...    214   2e-62    Callorhinchus milii [Australian ghost shark]
ref|XP_003821799.1|  PREDICTED: eukaryotic translation initiation...    212   2e-62    Pan paniscus [bonobo]
ref|XP_003256153.1|  PREDICTED: eukaryotic translation initiation...    212   2e-62    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005715226.1|  Translation initiation factor eIF3, subunit E      213   3e-62    Chondrus crispus [carageen]
ref|XP_004697736.1|  PREDICTED: eukaryotic translation initiation...    211   3e-62    
emb|CDQ75537.1|  unnamed protein product                                213   3e-62    Oncorhynchus mykiss
gb|ACO08955.1|  Eukaryotic translation initiation factor 3 subunit 6    213   3e-62    Osmerus mordax
ref|XP_007188837.1|  PREDICTED: eukaryotic translation initiation...    213   4e-62    Balaenoptera acutorostrata scammoni
emb|CAF92057.1|  unnamed protein product                                213   4e-62    Tetraodon nigroviridis
ref|XP_007543239.1|  PREDICTED: eukaryotic translation initiation...    213   4e-62    Poecilia formosa
ref|XP_006635626.1|  PREDICTED: eukaryotic translation initiation...    213   4e-62    Lepisosteus oculatus
ref|XP_005507309.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    
ref|XP_010903799.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    214   5e-62    
ref|XP_010575299.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    Haliaeetus leucocephalus
ref|XP_003965946.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    Takifugu rubripes [tiger puffer]
ref|XP_007075896.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    Panthera tigris altaica
ref|XP_005042453.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    Ficedula albicollis
ref|XP_005150980.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    Melopsittacus undulatus
ref|XP_008640866.1|  PREDICTED: eukaryotic translation initiation...    213   5e-62    
ref|XP_005613308.1|  PREDICTED: eukaryotic translation initiation...    213   6e-62    
ref|XP_001369627.1|  PREDICTED: eukaryotic translation initiation...    213   6e-62    Monodelphis domestica
ref|XP_004796181.1|  PREDICTED: eukaryotic translation initiation...    213   6e-62    
ref|XP_008291531.1|  PREDICTED: eukaryotic translation initiation...    212   6e-62    Stegastes partitus
ref|XP_006892391.1|  PREDICTED: eukaryotic translation initiation...    212   6e-62    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004086680.1|  PREDICTED: eukaryotic translation initiation...    212   6e-62    Oryzias latipes [Japanese rice fish]
gb|AAX29771.1|  eukaryotic translation initiation factor 3 subuni...    212   7e-62    synthetic construct
gb|AAH17887.1|  Eukaryotic translation initiation factor 3, subun...    212   7e-62    Homo sapiens [man]
dbj|BAB27621.1|  unnamed protein product                                211   7e-62    Mus musculus [mouse]
gb|EFB25663.1|  hypothetical protein PANDA_007264                       212   7e-62    Ailuropoda melanoleuca
gb|ADO28016.1|  eukaryotic translation initiation factor 3 subuni...    212   7e-62    Ictalurus furcatus
ref|XP_003760371.1|  PREDICTED: eukaryotic translation initiation...    212   7e-62    Sarcophilus harrisii
ref|XP_008322011.1|  PREDICTED: eukaryotic translation initiation...    212   7e-62    
ref|XP_004457646.1|  PREDICTED: eukaryotic translation initiation...    212   7e-62    Dasypus novemcinctus
ref|NP_001559.1|  eukaryotic translation initiation factor 3 subu...    212   7e-62    Homo sapiens [man]
ref|NP_001029775.1|  eukaryotic translation initiation factor 3 s...    212   8e-62    Bos taurus [bovine]
ref|XP_003903117.1|  PREDICTED: eukaryotic translation initiation...    213   8e-62    Papio anubis [baboon]
ref|XP_004679709.1|  PREDICTED: eukaryotic translation initiation...    213   8e-62    Condylura cristata
ref|XP_010369113.1|  PREDICTED: eukaryotic translation initiation...    213   8e-62    Rhinopithecus roxellana
ref|XP_004370748.1|  PREDICTED: eukaryotic translation initiation...    213   8e-62    Trichechus manatus latirostris
gb|EHH28709.1|  Eukaryotic translation initiation factor 3 subunit E    212   8e-62    Macaca mulatta [rhesus macaque]
ref|XP_010614025.1|  PREDICTED: eukaryotic translation initiation...    212   8e-62    Fukomys damarensis [Damara mole rat]
ref|XP_004661452.1|  PREDICTED: eukaryotic translation initiation...    212   8e-62    Jaculus jaculus
gb|AIC63065.1|  EIF3E                                                   212   8e-62    synthetic construct
ref|XP_003256152.1|  PREDICTED: eukaryotic translation initiation...    213   8e-62    Nomascus leucogenys [White-cheeked Gibbon]
gb|ABF57434.1|  eukaryotic translation initiation factor 3, subun...    212   8e-62    Bos taurus [bovine]
ref|XP_003408482.1|  PREDICTED: eukaryotic translation initiation...    212   9e-62    
ref|XP_002759346.1|  PREDICTED: eukaryotic translation initiation...    213   9e-62    Callithrix jacchus [common marmoset]
gb|AAH45079.1|  Eif3e-a protein                                         211   1e-61    Xenopus laevis [clawed frog]
emb|CAG33310.1|  EIF3S6                                                 212   1e-61    Homo sapiens [man]
ref|XP_006735492.1|  PREDICTED: eukaryotic translation initiation...    212   1e-61    Leptonychotes weddellii
ref|XP_004850341.1|  PREDICTED: eukaryotic translation initiation...    212   1e-61    Heterocephalus glaber [naked mole rat]
ref|XP_006005204.1|  PREDICTED: eukaryotic translation initiation...    212   1e-61    Latimeria chalumnae
ref|XP_004850340.1|  PREDICTED: eukaryotic translation initiation...    213   1e-61    
gb|AAX36482.1|  eukaryotic translation initiation factor 3 subunit 6    211   1e-61    synthetic construct
gb|ERE52457.1|  eukaryotic translation initiation factor 3 subuni...    211   1e-61    Cricetulus griseus [Chinese hamsters]
ref|XP_005662958.1|  PREDICTED: eukaryotic translation initiation...    212   1e-61    
ref|XP_003219492.1|  PREDICTED: eukaryotic translation initiation...    211   2e-61    Anolis carolinensis [Carolina anole]
gb|AAH92025.1|  Eif3e-b protein                                         209   2e-61    Xenopus laevis [clawed frog]
emb|CAJ82304.1|  eukaryotic translation initiation factor 3, subu...    211   2e-61    Xenopus tropicalis [western clawed frog]
ref|XP_006038115.1|  PREDICTED: eukaryotic translation initiation...    211   2e-61    Alligator sinensis
ref|XP_004899370.1|  PREDICTED: eukaryotic translation initiation...    212   2e-61    
gb|ERE52456.1|  eukaryotic translation initiation factor 3 subuni...    211   2e-61    Cricetulus griseus [Chinese hamsters]
ref|NP_001082486.1|  eukaryotic translation initiation factor 3 s...    211   2e-61    Xenopus laevis [clawed frog]
ref|XP_007999543.1|  PREDICTED: eukaryotic translation initiation...    212   2e-61    Chlorocebus sabaeus
ref|NP_989147.1|  eukaryotic translation initiation factor 3 subu...    211   2e-61    Xenopus tropicalis [western clawed frog]
ref|XP_009454078.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    212   2e-61    
gb|EOA98832.1|  Eukaryotic translation initiation factor 3 subunit E    209   3e-61    Anas platyrhynchos [duck]
ref|XP_007056150.1|  PREDICTED: eukaryotic translation initiation...    211   3e-61    Chelonia mydas [green seaturtle]
ref|XP_006113079.1|  PREDICTED: eukaryotic translation initiation...    211   3e-61    Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005869124.1|  PREDICTED: eukaryotic translation initiation...    210   4e-61    
gb|KFO18524.1|  Eukaryotic translation initiation factor 3 subunit E    211   4e-61    Fukomys damarensis [Damara mole rat]
gb|EMP39258.1|  Eukaryotic translation initiation factor 3 subunit E    211   5e-61    Chelonia mydas [green seaturtle]
ref|XP_005821626.1|  translation initiation factor 3, subunit E         210   5e-61    Guillardia theta CCMP2712
gb|ACO10725.1|  Eukaryotic translation initiation factor 3 subunit E    210   5e-61    Caligus rogercresseyi
gb|AEE61882.1|  unknown                                                 210   5e-61    Dendroctonus ponderosae
dbj|BAG36003.1|  unnamed protein product                                210   6e-61    Homo sapiens [man]
ref|XP_006830704.1|  PREDICTED: eukaryotic translation initiation...    210   6e-61    Chrysochloris asiatica
ref|NP_001233255.1|  Eukaryotic translation initiation factor 3 s...    211   7e-61    Oncorhynchus mykiss
ref|NP_001126100.1|  eukaryotic translation initiation factor 3 s...    209   7e-61    Pongo abelii [orang utan]
gb|ACO08499.1|  Eukaryotic translation initiation factor 3 subunit 6    209   8e-61    Oncorhynchus mykiss
gb|EHB12276.1|  Eukaryotic translation initiation factor 3 subunit E    211   8e-61    Heterocephalus glaber [naked mole rat]
tpg|DAA39490.1|  TPA: putative eukaryotic translation initiation ...    207   9e-61    
ref|XP_005022996.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    209   1e-60    
gb|ETE65778.1|  Eukaryotic translation initiation factor 3 subunit E    208   1e-60    Ophiophagus hannah
gb|AAF80474.1|AF162775_1  Int-6 protein                                 209   1e-60    Xenopus laevis [clawed frog]
ref|NP_001089321.1|  eukaryotic translation initiation factor 3 s...    209   1e-60    Xenopus laevis [clawed frog]
ref|XP_006113078.1|  PREDICTED: eukaryotic translation initiation...    209   1e-60    
gb|ENN70923.1|  hypothetical protein YQE_12325                          209   1e-60    Dendroctonus ponderosae
ref|XP_969967.1|  PREDICTED: eukaryotic translation initiation fa...    208   2e-60    Tribolium castaneum [rust-red flour beetle]
ref|XP_007427485.1|  PREDICTED: eukaryotic translation initiation...    208   3e-60    Python bivittatus
ref|XP_004226360.1|  PREDICTED: eukaryotic translation initiation...    208   4e-60    
ref|XP_009013291.1|  hypothetical protein HELRODRAFT_74899              208   5e-60    Helobdella robusta
ref|XP_003730262.1|  PREDICTED: eukaryotic translation initiation...    204   5e-60    
ref|XP_002130084.2|  PREDICTED: eukaryotic translation initiation...    207   5e-60    Ciona intestinalis [sea vase]
gb|AAC51917.1|  mammary tumor-associated protein INT6                   207   7e-60    Homo sapiens [man]
ref|XP_010790694.1|  PREDICTED: eukaryotic translation initiation...    207   7e-60    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011311912.1|  PREDICTED: eukaryotic translation initiation...    207   8e-60    Fopius arisanus
ref|XP_002423197.1|  eukaryotic translation initiation factor 3 s...    206   1e-59    Pediculus humanus corporis [human body lice]
ref|XP_011153275.1|  PREDICTED: eukaryotic translation initiation...    206   2e-59    Harpegnathos saltator
ref|XP_011153266.1|  PREDICTED: eukaryotic translation initiation...    206   2e-59    Harpegnathos saltator
ref|XP_011349823.1|  PREDICTED: eukaryotic translation initiation...    205   3e-59    Ooceraea biroi
gb|KDR09513.1|  Eukaryotic translation initiation factor 3 subunit E    205   3e-59    
gb|ABM55547.1|  putative eukaryotic translation initiation factor...    205   3e-59    
ref|XP_011349822.1|  PREDICTED: eukaryotic translation initiation...    205   3e-59    
ref|XP_006608307.1|  PREDICTED: eukaryotic translation initiation...    205   3e-59    
ref|XP_006571750.1|  PREDICTED: eukaryotic translation initiation...    205   4e-59    
ref|XP_003695661.1|  PREDICTED: eukaryotic translation initiation...    205   4e-59    
ref|XP_004642298.1|  PREDICTED: eukaryotic translation initiation...    204   4e-59    
ref|XP_003706056.1|  PREDICTED: eukaryotic translation initiation...    205   4e-59    
ref|XP_623637.3|  PREDICTED: eukaryotic translation initiation fa...    205   4e-59    
ref|XP_003393296.1|  PREDICTED: eukaryotic translation initiation...    205   4e-59    
ref|XP_008556331.1|  PREDICTED: eukaryotic translation initiation...    204   5e-59    
ref|XP_009061036.1|  hypothetical protein LOTGIDRAFT_126234             204   8e-59    
ref|XP_004642297.1|  PREDICTED: eukaryotic translation initiation...    204   1e-58    
gb|ACJ05177.1|  eIF3e                                                   203   1e-58    
ref|XP_001845759.1|  eukaryotic translation initiation factor 3 s...    203   2e-58    
ref|XP_002030822.1|  GM24367                                            199   2e-58    
ref|XP_011252698.1|  PREDICTED: eukaryotic translation initiation...    202   3e-58    
ref|XP_008187098.1|  PREDICTED: eukaryotic translation initiation...    202   3e-58    
ref|XP_011176003.1|  PREDICTED: eukaryotic translation initiation...    202   3e-58    
ref|XP_001952525.1|  PREDICTED: eukaryotic translation initiation...    202   3e-58    
gb|AAM52574.1|  AT01736p                                                201   3e-58    
ref|XP_011062618.1|  PREDICTED: eukaryotic translation initiation...    202   3e-58    
gb|EFZ21185.1|  hypothetical protein SINV_09055                         202   4e-58    
ref|XP_011252697.1|  PREDICTED: eukaryotic translation initiation...    202   4e-58    
ref|XP_011176002.1|  PREDICTED: eukaryotic translation initiation...    202   4e-58    
gb|ABQ22546.1|  eukaryotic translation initiation factor 3 subuni...    194   5e-58    
ref|XP_011062617.1|  PREDICTED: eukaryotic translation initiation...    202   5e-58    
gb|KFH64442.1|  translation initiation factor eIF-3 subunit 6           202   6e-58    
gb|EGI60377.1|  Eukaryotic translation initiation factor 3 subunit E    202   6e-58    
ref|XP_004533421.1|  PREDICTED: eukaryotic translation initiation...    201   1e-57    
ref|XP_011501666.1|  PREDICTED: eukaryotic translation initiation...    201   1e-57    
gb|ETN66627.1|  eukaryotic translation initiation factor 3 subunit      201   1e-57    
ref|XP_011182366.1|  PREDICTED: eukaryotic translation initiation...    201   1e-57    
ref|XP_011203631.1|  PREDICTED: eukaryotic translation initiation...    201   1e-57    
ref|XP_005844652.1|  hypothetical protein CHLNCDRAFT_138996             200   2e-57    
gb|EXX57551.1|  hypothetical protein RirG_206150                        197   2e-57    
ref|XP_001973011.1|  GG15850                                            199   4e-57    
sp|B4HK67.2|EIF3E_DROSE  RecName: Full=Eukaryotic translation ini...    199   4e-57    
gb|KFM67912.1|  Eukaryotic translation initiation factor 3 subuni...    199   4e-57    
ref|NP_477385.1|  Int6 homologue                                        199   5e-57    
ref|XP_008477936.1|  PREDICTED: eukaryotic translation initiation...    198   5e-57    
dbj|BAM18287.1|  eukaryotic translation initiation factor 3 subun...    198   6e-57    
emb|CDS13833.1|  hypothetical protein LRAMOSA06007                      199   6e-57    
gb|KFB43940.1|  hypothetical protein ZHAS_00011767                      199   6e-57    
gb|KIY98828.1|  putative Eukaryotic translation initiation factor...    198   8e-57    
ref|XP_005180844.1|  PREDICTED: eukaryotic translation initiation...    198   9e-57    
ref|XP_001984050.1|  GH15221                                            198   1e-56    
ref|XP_001957627.1|  GF10503                                            198   1e-56    
ref|XP_002067863.1|  GK12672                                            198   1e-56    
pdb|3J8B|E  Chain E, Model Of The Human Eif3 Pci-mpn Octamer Dock...    198   1e-56    
ref|XP_002047024.1|  GJ12157                                            198   1e-56    
ref|NP_001037404.1|  eukaryotic translation initiation factor 3 s...    198   1e-56    
emb|CEP11876.1|  hypothetical protein                                   198   1e-56    
dbj|BAM19236.1|  eukaryotic translation initiation factor 3 subun...    198   2e-56    
ref|XP_002066104.1|  GK22114                                            198   2e-56    
ref|XP_002026160.1|  GL16190                                            197   2e-56    
ref|XP_001352441.1|  GA21959                                            197   2e-56    
ref|XP_308812.2|  AGAP006944-PA                                         197   2e-56    
gb|EHJ71134.1|  eukaryotic translation initiation factor 3 subunit E    198   2e-56    
ref|XP_007229269.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    197   3e-56    
ref|XP_011399162.1|  Eukaryotic translation initiation factor 3 s...    197   3e-56    
gb|EPB84383.1|  translation initiation factor 3 subunit E               197   3e-56    
ref|XP_006250447.1|  PREDICTED: eukaryotic translation initiation...    196   3e-56    
dbj|GAN10003.1|  eukaryotic translation initiation factor 3 subun...    197   4e-56    
ref|XP_001661371.1|  AAEL002334-PA                                      197   5e-56    
ref|XP_006680298.1|  hypothetical protein BATDEDRAFT_20238              197   6e-56    
ref|XP_002113968.1|  hypothetical protein TRIADDRAFT_50473              196   6e-56    
ref|XP_009032531.1|  hypothetical protein AURANDRAFT_70037              196   7e-56    
gb|EXX57549.1|  hypothetical protein RirG_206150                        196   7e-56    
gb|EIE77320.1|  hypothetical protein RO3G_02024                         194   1e-55    
emb|CEJ01650.1|  Putative Eukaryotic translation initiation facto...    195   2e-55    
emb|CEG66948.1|  Putative Eukaryotic translation initiation facto...    195   2e-55    
gb|EIE75948.1|  hypothetical protein RO3G_00652                         194   4e-55    
ref|XP_006737590.1|  PREDICTED: eukaryotic translation initiation...    194   6e-55    
ref|XP_001600308.2|  PREDICTED: eukaryotic translation initiation...    194   8e-55    
ref|NP_001038416.1|  eukaryotic translation initiation factor 3 s...    192   8e-55    
ref|XP_009170971.1|  hypothetical protein T265_14236                    192   1e-54    
dbj|GAA53636.1|  translation initiation factor 3 subunit E              192   6e-54    
ref|XP_003741003.1|  PREDICTED: eukaryotic translation initiation...    190   2e-53    
emb|CCD60845.1|  eukaryotictranslation initiation factor 3 subuni...    187   8e-53    
emb|CAX69738.1|  putative eukaryotic translation initiation facto...    188   1e-52    
emb|CAX73743.1|  putative eukaryotic translation initiation facto...    188   1e-52    
sp|A8XFH3.2|EIF3E_CAEBR  RecName: Full=Eukaryotic translation ini...    184   1e-52    
emb|CBJ28055.1|  eukaryotic translation initiation factor eIF3 e ...    189   1e-52    
ref|XP_002639730.1|  C. briggsae CBR-EIF-3.E protein                    185   3e-52    
ref|XP_782397.3|  PREDICTED: eukaryotic translation initiation fa...    187   3e-52    
emb|CCD60844.1|  eukaryotictranslation initiation factor 3 subuni...    187   3e-52    
ref|NP_492785.1|  Protein EIF-3.E                                       186   3e-52    
gb|KHJ93076.1|  PCI domain protein                                      179   8e-52    
ref|XP_008604994.1|  hypothetical protein SDRG_01255                    185   1e-51    
gb|KDO34985.1|  hypothetical protein SPRG_01048                         185   1e-51    
gb|EGT54667.1|  hypothetical protein CAEBREN_32356                      184   2e-51    
ref|XP_003112127.1|  CRE-EIF-3.E protein                                184   2e-51    
emb|CDJ01468.1|  eukaryotic translation initiation factor 3             184   4e-51    
emb|CDS18411.1|  eukaryotic translation initiation factor 3             184   4e-51    
gb|EUB62274.1|  Eukaryotic translation initiation factor 3 subunit E    184   6e-51    
emb|CDQ03274.1|  Protein BM-EIF-3.E, isoform b                          183   7e-51    
gb|KIH51297.1|  PCI domain protein                                      180   1e-50    
gb|ESA16451.1|  hypothetical protein GLOINDRAFT_156542                  182   1e-50    
gb|EJW76883.1|  eukaryotic translation initiation factor 3 subunit E    174   3e-50    
ref|XP_003141302.1|  eukaryotic translation initiation factor 3 s...    181   3e-50    
ref|XP_008879529.1|  hypothetical protein H310_13691                    181   3e-50    
gb|ERG79965.1|  eukaryotic translation initiation factor 3 subunit e    181   6e-50    
emb|CBY39908.1|  unnamed protein product                                179   3e-49    
gb|EYC00931.1|  hypothetical protein Y032_0112g341                      180   4e-49    
gb|EYC00930.1|  hypothetical protein Y032_0112g341                      180   5e-49    
ref|XP_003370456.1|  eukaryotic translation initiation factor 3 s...    173   5e-49    
gb|KGB31972.1|  Eukaryotic translation initiation factor 3 subunit E    176   1e-48    
ref|XP_008913532.1|  hypothetical protein PPTG_17617                    177   2e-48    
gb|ETI34792.1|  hypothetical protein F443_18799                         177   2e-48    
ref|XP_009841759.1|  hypothetical protein H257_15365                    177   2e-48    
gb|KFD58694.1|  hypothetical protein M513_00387                         176   6e-48    
ref|XP_002901722.1|  eukaryotic translation initiation factor 3, ...    175   8e-48    
emb|CDJ89215.1|  Eukaryotic translation initiation factor 3 (eIF3...    179   1e-47    
ref|XP_007513712.1|  eukaryotic translation initiation factor 3 s...    176   1e-47    
ref|XP_009516737.1|  hypothetical protein PHYSODRAFT_552766             174   1e-47    
ref|XP_003370998.1|  eukaryotic translation initiation factor 3 s...    172   1e-47    
emb|CDW54243.1|  eukaryotic translation initiation factor 3             174   3e-47    
ref|XP_007318752.1|  hypothetical protein SERLADRAFT_415728             173   6e-47    
ref|XP_011125666.1|  hypothetical protein AOL_s00169g7                  173   6e-47    
gb|KIH52119.1|  eIF3 subunit 6 protein                                  172   6e-47    
ref|XP_001893867.1|  eukaryotic translation initiation factor 3 s...    172   6e-47    
ref|XP_002287841.1|  hypothetical protein THAPSDRAFT_27083              173   8e-47    
ref|XP_008045609.1|  eukaryotic translation initiation factor 3 s...    172   1e-46    
sp|B0XXL3.1|EIF3E_ASPFC  RecName: Full=Eukaryotic translation ini...    172   2e-46    
ref|XP_754483.1|  eukaryotic translation initiation factor 3 subu...    172   2e-46    
gb|EJT98808.1|  eukaryotic translation initiation factor 3 subunit 6    172   2e-46    
gb|EPS29810.1|  hypothetical protein PDE_04760                          171   2e-46    
gb|KHJ44086.1|  eIF3 subunit 6 protein                                  177   3e-46    
ref|XP_001271137.1|  eukaryotic translation initiation factor 3 s...    170   6e-46    
ref|XP_001213849.1|  conserved hypothetical protein                     170   6e-46    
gb|EJK47011.1|  hypothetical protein THAOC_34292                        173   6e-46    
gb|EWC43517.1|  eukaryotic translation initiation factor 3 subunit E    171   6e-46    
ref|XP_660511.1|  hypothetical protein AN2907.2                         170   6e-46    
sp|A8NY27.2|EIF3E_BRUMA  RecName: Full=Eukaryotic translation ini...    170   8e-46    
ref|XP_002623456.1|  eukaryotic translation initiation factor 3 s...    170   9e-46    
ref|XP_010755910.1|  eukaryotic translation initiation factor 3 s...    169   1e-45    
ref|XP_001263327.1|  eukaryotic translation initiation factor 3 s...    169   1e-45    
emb|CEG66949.1|  Putative Eukaryotic translation initiation facto...    169   1e-45    
ref|XP_002181668.1|  predicted protein                                  169   1e-45    
ref|XP_001399846.1|  eukaryotic translation initiation factor 3 s...    169   2e-45    
gb|KIJ14312.1|  hypothetical protein PAXINDRAFT_79632                   168   3e-45    
gb|KGO36581.1|  Eukaryotic translation initiation factor 3 (eIF3)...    168   4e-45    
ref|XP_002143536.1|  eukaryotic translation initiation factor 3 s...    168   4e-45    
ref|XP_004367291.1|  proteasome component region PCI domain-conta...    169   4e-45    
emb|CDM30578.1|  Eukaryotic translation initiation factor 3 subun...    168   4e-45    
dbj|GAM39725.1|  translation initiation factor                          168   4e-45    
ref|XP_001819838.1|  eukaryotic translation initiation factor 3 s...    168   5e-45    
gb|KIK96150.1|  hypothetical protein PAXRUDRAFT_25206                   168   5e-45    
gb|EYE94655.1|  eukaryotic translation initiation factor 3 subunit E    168   5e-45    
ref|XP_002559386.1|  Pc13g09630                                         168   5e-45    
ref|XP_007801897.1|  Eukaryotic translation initiation factor 3 s...    167   5e-45    
ref|XP_002850523.1|  eukaryotic translation initiation factor 3 s...    168   5e-45    
gb|EWM27525.1|  eukaryotic translation initiation factor 3 subunit e    169   5e-45    
ref|XP_003177254.1|  eukaryotic translation initiation factor 3 s...    168   6e-45    
gb|EZF30486.1|  eukaryotic translation initiation factor 3 subunit E    168   6e-45    
gb|EZF70061.1|  eukaryotic translation initiation factor 3 subunit E    167   6e-45    
gb|EGD98371.1|  eukaryotic translation initiation factor 3 subunit E    167   6e-45    
ref|XP_003238179.1|  eukaryotic translation initiation factor 3 s...    167   7e-45    
gb|KIW27866.1|  hypothetical protein PV07_07565                         167   7e-45    
gb|EPS98504.1|  eukaryotic translation initiation factor 3 subunit 6    167   7e-45    
gb|EMD97494.1|  hypothetical protein COCHEDRAFT_1125087                 167   8e-45    
ref|XP_007696375.1|  hypothetical protein COCSADRAFT_79107              167   8e-45    
gb|KIW68859.1|  eukaryotic translation initiation factor 3 subunit E    167   8e-45    
ref|XP_007687079.1|  hypothetical protein COCMIDRAFT_4532               167   8e-45    
gb|EPQ66193.1|  eIF3 subunit                                            167   9e-45    
emb|CCU75798.1|  Eukaryotic translation initiation factor 3 subun...    167   1e-44    
sp|Q0U0X1.3|EIF3E_PHANO  RecName: Full=Eukaryotic translation ini...    167   1e-44    
gb|EKV05936.1|  Eukaryotic translation initiation factor 3 subuni...    167   1e-44    
gb|KIX00711.1|  hypothetical protein Z518_09776                         166   1e-44    
gb|EKG10706.1|  hypothetical protein MPH_12190                          166   1e-44    
gb|KIV96196.1|  hypothetical protein PV10_00092                         166   1e-44    
gb|ETN84426.1|  eIF3 subunit 6 protein                                  166   1e-44    
ref|XP_007584419.1|  putative eukaryotic translation initiation f...    166   1e-44    
ref|XP_001933599.1|  eukaryotic translation initiation factor 3 s...    166   2e-44    
gb|KGO72996.1|  Eukaryotic translation initiation factor 3 (eIF3)...    166   2e-44    
ref|XP_007370584.1|  eukaryotic translation initiation factor 3 s...    166   2e-44    
ref|XP_003305565.1|  hypothetical protein PTT_18440                     166   2e-44    
gb|KIW61567.1|  eukaryotic translation initiation factor 3 subunit E    166   2e-44    
gb|KFX88616.1|  hypothetical protein V490_07514                         166   2e-44    
ref|XP_002582679.1|  conserved hypothetical protein                     166   2e-44    
ref|XP_003068564.1|  Eukaryotic translation initiation factor 3 s...    166   2e-44    
gb|KFY04754.1|  hypothetical protein O988_00547                         166   2e-44    
ref|XP_007730254.1|  eukaryotic translation initiation factor 3 s...    166   2e-44    
ref|XP_001244252.1|  conserved hypothetical protein                     166   2e-44    
ref|XP_007722267.1|  eukaryotic translation initiation factor 3 s...    166   3e-44    
emb|CDO70814.1|  hypothetical protein BN946_scf184801.g5                166   3e-44    
ref|XP_003011817.1|  hypothetical protein ARB_02046                     166   3e-44    
ref|XP_006735493.1|  PREDICTED: eukaryotic translation initiation...    164   3e-44    
gb|KIN00908.1|  hypothetical protein OIDMADRAFT_41596                   166   3e-44    
ref|XP_007346099.1|  eukaryotic translation initiation factor 3, ...    166   3e-44    
ref|XP_008166528.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    166   4e-44    
ref|XP_003020101.1|  hypothetical protein TRV_05874                     166   4e-44    
gb|KIW10956.1|  eukaryotic translation initiation factor 3 subunit E    165   5e-44    
ref|XP_007756702.1|  eukaryotic translation initiation factor 3 s...    165   5e-44    
emb|CCX09811.1|  Similar to eukaryotic translation initiation fac...    165   5e-44    
ref|XP_008022808.1|  hypothetical protein SETTUDRAFT_167639             165   5e-44    
ref|XP_002479861.1|  eukaryotic translation initiation factor 3 s...    165   5e-44    
gb|KFY24090.1|  hypothetical protein V493_05454                         165   6e-44    
gb|ELR03852.1|  eukaryotic translation initiation factor 3 subunit E    165   6e-44    
gb|KFY70141.1|  hypothetical protein V499_09427                         164   7e-44    
ref|XP_001547625.1|  hypothetical protein BC1G_13956                    165   7e-44    
gb|KFY14929.1|  hypothetical protein V492_02317                         164   7e-44    
emb|CCM05430.1|  predicted protein                                      164   7e-44    
ref|XP_008726753.1|  eukaryotic translation initiation factor 3 s...    164   7e-44    
gb|KFZ16774.1|  hypothetical protein V501_02073                         164   8e-44    
ref|XP_009159185.1|  eukaryotic translation initiation factor 3 s...    164   8e-44    
gb|KFY34703.1|  hypothetical protein V494_06544                         164   8e-44    
gb|KFY81930.1|  hypothetical protein V500_10960                         164   9e-44    
ref|XP_009497758.1|  hypothetical protein H696_05663                    165   9e-44    
ref|XP_011111893.1|  hypothetical protein H072_6091                     164   1e-43    
emb|CCI40491.1|  unnamed protein product                                163   1e-43    
gb|KIY03247.1|  eukaryotic translation initiation factor 3 subunit E    165   1e-43    
ref|XP_007742326.1|  translation initiation factor 3 subunit E          165   1e-43    
ref|XP_006463000.1|  hypothetical protein AGABI2DRAFT_194041            165   1e-43    
emb|CCI40490.1|  unnamed protein product                                163   1e-43    
gb|KFY90845.1|  hypothetical protein V498_05796                         165   1e-43    
gb|KIW43247.1|  hypothetical protein PV06_04368                         164   1e-43    
dbj|GAM23604.1|  hypothetical protein SAMD00019534_067790               164   1e-43    
ref|XP_003841873.1|  similar to eukaryotic translation initiation...    163   2e-43    
gb|KIM56914.1|  hypothetical protein SCLCIDRAFT_131622                  164   2e-43    



>ref|XP_003519090.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Glycine max]
Length=437

 Score =   392 bits (1008),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 193/200 (97%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYTDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSETGTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             L+GRTYKLVSQLLEHAQ+Q
Sbjct  415  ALNGRTYKLVSQLLEHAQAQ  434



>emb|CDP14171.1| unnamed protein product [Coffea canephora]
 emb|CDP14172.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   389 bits (1000),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAF+VNKRRRPQFKDFIKVIQ EQYSY DPITEFLACVY
Sbjct  181  NQDKYLNAIQTSAPHLLRYLATAFVVNKRRRPQFKDFIKVIQQEQYSYEDPITEFLACVY  240

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            V YDFDAAQQKM+ECEEVILNDPFLGKR EEGNF++VPLRDEFLENARLFIFETYCRIHQ
Sbjct  241  VKYDFDAAQQKMRECEEVILNDPFLGKRAEEGNFASVPLRDEFLENARLFIFETYCRIHQ  300

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDS+TGTV+MEP  PNVYEQLIDHTK
Sbjct  301  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSKTGTVLMEPNQPNVYEQLIDHTK  360

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQLLEHAQ+Q
Sbjct  361  ALSGRTYKLVSQLLEHAQTQ  380



>ref|XP_002532670.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF29717.1| eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=323

 Score =   387 bits (994),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFK+FIKVIQ EQ+SY DPITEFLACVY
Sbjct  121  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQEQHSYKDPITEFLACVY  180

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFL KRVE+GNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  181  VNYDFDGAQKKMKECEEVILNDPFLAKRVEDGNFSTVPLRDEFLENARLFIFETYCRIHQ  240

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMG+LAEKLNLNYE+AERWIVNLIR+SKLDAKIDS++GTVIMEP HPNVYEQLIDHTK
Sbjct  241  RIDMGILAEKLNLNYEEAERWIVNLIRSSKLDAKIDSKSGTVIMEPNHPNVYEQLIDHTK  300

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRT KLV+QLLEH+Q+QA
Sbjct  301  GLSGRTNKLVNQLLEHSQTQA  321



>ref|XP_007145575.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris]
 gb|ESW17569.1| hypothetical protein PHAVU_007G250100g [Phaseolus vulgaris]
Length=437

 Score =   391 bits (1005),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDS TGTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSHTGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+GRTYKLVSQLLEHAQ QA
Sbjct  415  ALNGRTYKLVSQLLEHAQGQA  435



>gb|KHN41695.1| Eukaryotic translation initiation factor 3 subunit E [Glycine 
soja]
Length=448

 Score =   391 bits (1005),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/201 (92%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  246  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYTDPITEFLACVY  305

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  306  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  365

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSETGTVIMEP HPNVYEQLIDHTK
Sbjct  366  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTK  425

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+GRTYKLVSQLLEHAQ+Q 
Sbjct  426  ALNGRTYKLVSQLLEHAQAQT  446



>ref|XP_007202066.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica]
 gb|EMJ03265.1| hypothetical protein PRUPE_ppa005923mg [Prunus persica]
Length=437

 Score =   390 bits (1001),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHL+RYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTNAPHLVRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYNDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDS++GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSQSGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV QLLEHAQSQ 
Sbjct  415  ALSGRTYKLVGQLLEHAQSQV  435



>ref|XP_004516371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Cicer arietinum]
Length=437

 Score =   389 bits (1000),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDSETGTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRGSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+GRTYKLV+QLLEH Q+QA
Sbjct  415  ALNGRTYKLVTQLLEHGQAQA  435



>ref|XP_009782891.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nicotiana sylvestris]
Length=438

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQYS  DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQYSCKDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKRVEEG+FS+VPLRDEFLENARLFI ETYCRIHQ
Sbjct  296  VNYDFDGAQKKMKECEEVILNDPFLGKRVEEGSFSSVPLRDEFLENARLFISETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            R+DMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNVYEQLIDHTK
Sbjct  356  RVDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLVSQLLEHAQ+QA
Sbjct  416  ALSGRTYKLVSQLLEHAQTQA  436



>ref|XP_009363228.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pyrus x bretschneideri]
 ref|XP_009363229.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X3 [Pyrus x bretschneideri]
Length=437

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHL+RYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTHAPHLVRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSE+GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSESGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLV Q+LEHAQ+Q
Sbjct  415  ALSGRTYKLVGQILEHAQAQ  434



>ref|XP_008351631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Malus domestica]
Length=437

 Score =   388 bits (997),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 182/200 (91%), Positives = 192/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHL+RYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTHAPHLVRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSE+GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSESGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLV Q+LEHAQ+Q
Sbjct  415  ALSGRTYKLVGQILEHAQAQ  434



>gb|ACU17653.1| unknown [Glycine max]
Length=323

 Score =   384 bits (986),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 193/205 (94%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY +PITEFLACVY
Sbjct  121  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKNPITEFLACVY  180

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  181  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  240

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSETG VIMEP H NVYEQLIDHTK
Sbjct  241  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSETGAVIMEPNHLNVYEQLIDHTK  300

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
             L+GRTYKLVSQLLEHA  QAQ TR
Sbjct  301  ALNGRTYKLVSQLLEHA--QAQTTR  323



>ref|XP_009630704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E {ECO:0000255|HAMAP-Rule:MF_03004} [Nicotiana tomentosiformis]
Length=438

 Score =   388 bits (996),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQYS  DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQYSCKDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKRVEEG+FS+VPLRDEFLENARLFI ETYCRIHQ
Sbjct  296  VNYDFDGAQKKMKECEEVILNDPFLGKRVEEGSFSSVPLRDEFLENARLFISETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            R+DMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDS++GTVIMEPT PNVYEQLIDHTK
Sbjct  356  RVDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSQSGTVIMEPTQPNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLVSQLLEHAQ+QA
Sbjct  416  ALSGRTYKLVSQLLEHAQTQA  436



>ref|XP_006491490.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Citrus sinensis]
 gb|KDO48230.1| hypothetical protein CISIN_1g013640mg [Citrus sinensis]
Length=439

 Score =   387 bits (995),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFLACVY
Sbjct  237  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVY  296

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKRVE+ NF+TVPLRDEFLENARLFIFETYCRIHQ
Sbjct  297  VNYDFDGAQKKMKECEEVILNDPFLGKRVEDSNFATVPLRDEFLENARLFIFETYCRIHQ  356

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+A+RWIVNLIR SKLDAKID+++GTVIMEPTHPNVYEQLIDHTK
Sbjct  357  RIDMAVLAEKLNLNYEEAQRWIVNLIRNSKLDAKIDAKSGTVIMEPTHPNVYEQLIDHTK  416

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV QLLEHAQ+QA
Sbjct  417  GLSGRTYKLVGQLLEHAQTQA  437



>gb|KDP26094.1| hypothetical protein JCGZ_21127 [Jatropha curcas]
Length=435

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 191/199 (96%), Gaps = 0/199 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVE+ NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEDSNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNY++AERWIVNLIR SKLDAKIDSE+GTV+MEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYDEAERWIVNLIRNSKLDAKIDSESGTVVMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQS  158
             LSGRTYKLV+QLLEHAQ+
Sbjct  415  ALSGRTYKLVNQLLEHAQA  433



>ref|XP_004162816.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E-like, partial [Cucumis sativus]
Length=318

 Score =   382 bits (981),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFL CVY
Sbjct  116  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLTCVY  175

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKR+EEGN STVPLRDEFLENARLFIFETYCRIHQ
Sbjct  176  VNYDFDGAQKKMRECEEVILNDPFLGKRLEEGNLSTVPLRDEFLENARLFIFETYCRIHQ  235

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNL+RTSKLDAKIDS+TGTV+MEP  PNVYE+LIDHTK
Sbjct  236  RIDMNVLAEKLNLNYEEAERWIVNLVRTSKLDAKIDSKTGTVLMEPVQPNVYEELIDHTK  295

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEHAQ+QA
Sbjct  296  SLSGRTYKLVTQLLEHAQAQA  316



>gb|KEH41514.1| eukaryotic translation initiation factor 3E [Medicago truncatula]
Length=437

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 184/201 (92%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDSETGTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRGSKLDAKIDSETGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+GRTYKLV+QLLE AQ+QA
Sbjct  415  ALNGRTYKLVTQLLEQAQAQA  435



>ref|XP_003535892.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Glycine max]
Length=437

 Score =   386 bits (992),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/200 (92%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSETG VIMEP H NVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSETGAVIMEPNHLNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             L+GRTYKLVSQLLEHAQ+Q
Sbjct  415  ALNGRTYKLVSQLLEHAQAQ  434



>gb|EYU18691.1| hypothetical protein MIMGU_mgv1a006587mg [Erythranthe guttata]
Length=438

 Score =   385 bits (990),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFK+F+KVIQ EQY + DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKEFLKVIQQEQYLFEDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKR+EEGNF++VPLRDEFLENARLFIFETYCRIHQ
Sbjct  296  VNYDFDGAQKKMKECEEVILNDPFLGKRIEEGNFASVPLRDEFLENARLFIFETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNY++AERWI+NLIRTSKL+AKIDSETGT+IMEP H NVYEQLIDHTK
Sbjct  356  RIDMGVLAEKLNLNYDEAERWILNLIRTSKLEAKIDSETGTIIMEPNHTNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLVSQLLEHAQ+QA
Sbjct  416  ALSGRTYKLVSQLLEHAQTQA  436



>ref|XP_006421164.1| hypothetical protein CICLE_v10004983mg [Citrus clementina]
 gb|AEI72270.1| eukaryotic translation initiation factor protein [Citrus trifoliata]
 gb|ESR34404.1| hypothetical protein CICLE_v10004983mg [Citrus clementina]
Length=439

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFLACVY
Sbjct  237  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVY  296

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKRVE+ NF+TVPLRDEFLENARLFIFETYCRIHQ
Sbjct  297  VNYDFDGAQKKMKECEEVILNDPFLGKRVEDSNFATVPLRDEFLENARLFIFETYCRIHQ  356

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+A+RWIVNLIR SKLDAKID+++GTVIMEPT PNVYEQLIDHTK
Sbjct  357  RIDMAVLAEKLNLNYEEAQRWIVNLIRNSKLDAKIDAKSGTVIMEPTQPNVYEQLIDHTK  416

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV QLLEHAQ+QA
Sbjct  417  GLSGRTYKLVGQLLEHAQTQA  437



>ref|XP_004303635.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Fragaria vesca subsp. vesca]
Length=437

 Score =   385 bits (988),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHL+RYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTNAPHLIRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM EC+EVILNDPFLGKRVEEGNF+TVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMWECQEVILNDPFLGKRVEEGNFTTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDS++GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSQSGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV Q+ EHAQ+QA
Sbjct  415  ALSGRTYKLVGQIREHAQTQA  435



>ref|XP_008244286.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Prunus mume]
Length=437

 Score =   384 bits (985),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/200 (91%), Positives = 188/200 (94%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHL+RYLATAFIVNKRRRPQFKDFIK    EQ SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTNAPHLVRYLATAFIVNKRRRPQFKDFIKXXXQEQNSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDS++GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSQSGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLV QLLEHAQSQ
Sbjct  415  ALSGRTYKLVGQLLEHAQSQ  434



>ref|XP_011078923.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Sesamum indicum]
Length=438

 Score =   383 bits (983),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/200 (90%), Positives = 191/200 (96%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFK+FIKVIQ EQYSY DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQEQYSYEDPITEFLACLY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD A +KMKECEEVILNDPFLGKRVEEGNF+++PLRDEFLENARLFIFETYCRIHQ
Sbjct  296  VNYDFDGAHKKMKECEEVILNDPFLGKRVEEGNFTSIPLRDEFLENARLFIFETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIRTSKL+AKIDS+TGT++MEP H NVYEQLIDHTK
Sbjct  356  RIDMSVLAEKLNLNYEEAERWIVNLIRTSKLEAKIDSKTGTILMEPNHANVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQLLEHAQ+Q
Sbjct  416  ALSGRTYKLVSQLLEHAQAQ  435



>ref|XP_008464598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cucumis melo]
Length=437

 Score =   382 bits (982),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKR+EEGN STVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRLEEGNLSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNL+RTSKLDAKIDS+TGTV+MEP  PNVYE+LIDHTK
Sbjct  355  RIDMNVLAEKLNLNYEEAERWIVNLVRTSKLDAKIDSKTGTVVMEPIQPNVYEELIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEHAQ+QA
Sbjct  415  SLSGRTYKLVTQLLEHAQAQA  435



>ref|XP_004142652.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Cucumis sativus]
 gb|KGN54509.1| hypothetical protein Csa_4G343070 [Cucumis sativus]
Length=437

 Score =   382 bits (981),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ SY DPITEFL CVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLTCVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKR+EEGN STVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRLEEGNLSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNL+RTSKLDAKIDS+TGTV+MEP  PNVYE+LIDHTK
Sbjct  355  RIDMNVLAEKLNLNYEEAERWIVNLVRTSKLDAKIDSKTGTVLMEPVQPNVYEELIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEHAQ+QA
Sbjct  415  SLSGRTYKLVTQLLEHAQAQA  435



>ref|XP_010504654.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   382 bits (980),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYC+IHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|XP_010427598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   381 bits (979),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYC+IHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|XP_011015724.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X2 [Populus euphratica]
Length=380

 Score =   379 bits (973),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  178  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  237

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGK +E+ NFSTVPLRDEFLENARLF+FETYCRIHQ
Sbjct  238  VNYDFDEAQKKMKECEEVILNDPFLGKHLEDSNFSTVPLRDEFLENARLFVFETYCRIHQ  297

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIR SKLDAKIDS++GTVIMEP H NVYEQLIDHTK
Sbjct  298  RIDMEVLAEKLNLNYEEAERWIVNLIRNSKLDAKIDSQSGTVIMEPNHSNVYEQLIDHTK  357

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRT KLVSQ+LEHAQ+Q+
Sbjct  358  ALSGRTSKLVSQILEHAQAQS  378



>ref|XP_007030845.1| Eukaryotic translation initiation factor 3E [Theobroma cacao]
 gb|EOY11347.1| Eukaryotic translation initiation factor 3E [Theobroma cacao]
Length=437

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 189/205 (92%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQYSY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKDFIKVIQLEQYSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLR+EFLENARLFIFETYCR HQ
Sbjct  295  VNYDFDGAQRKMRECEEVILNDPFLGKRVEEGNFSTVPLREEFLENARLFIFETYCRSHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDSETG V MEP  PNVYEQLIDHTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRNSKLDAKIDSETGAVTMEPNRPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
             L GRTYKLVSQ+LEH   QAQP R
Sbjct  415  ALQGRTYKLVSQILEHV--QAQPAR  437



>ref|XP_002878144.1| hypothetical protein ARALYDRAFT_486171 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54403.1| hypothetical protein ARALYDRAFT_486171 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   381 bits (978),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYC+IHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|NP_567047.1| eukaryotic translation initiation factor 3E [Arabidopsis thaliana]
 gb|AAG53613.1|AF285832_1 eukaryotic initiation factor 3E subunit [Arabidopsis thaliana]
 gb|AAK64017.1| putative translation initiation factor 3 [Arabidopsis thaliana]
 gb|AAL85088.1| putative translation initiation factor 3 [Arabidopsis thaliana]
 gb|AEE79636.1| eukaryotic translation initiation factor 3E [Arabidopsis thaliana]
Length=441

 Score =   380 bits (977),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLF+FETYC+IHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFVFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|XP_010516342.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelina sativa]
Length=441

 Score =   380 bits (977),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYC+IHQ
Sbjct  299  VNYDFDRAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|XP_002308015.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
 gb|ABK95989.1| unknown [Populus trichocarpa]
 gb|EEE91538.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
Length=437

 Score =   380 bits (976),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGK +E+ NFSTVPLRDEFLENARLF+FETYCRIHQ
Sbjct  295  VNYDFDEAQKKMKECEEVILNDPFLGKHLEDSNFSTVPLRDEFLENARLFVFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIR SKLDAKIDS++GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDMEVLAEKLNLNYEEAERWIVNLIRNSKLDAKIDSQSGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRT KLVSQ+LEHAQ Q+
Sbjct  415  ALSGRTSKLVSQILEHAQGQS  435



>ref|XP_011048096.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Populus euphratica]
Length=437

 Score =   380 bits (975),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGK +E+ NFSTVPLRDEFLENARLF+FETYCRIHQ
Sbjct  295  VNYDFDEAQKKMKECEEVILNDPFLGKHLEDSNFSTVPLRDEFLENARLFVFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIR SKLDAKIDS++GTV+MEP HPNVYEQLIDHTK
Sbjct  355  RIDMEVLAEKLNLNYEEAERWIVNLIRNSKLDAKIDSQSGTVVMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRT KLVSQ+LEHAQ+Q+
Sbjct  415  ALSGRTSKLVSQILEHAQAQS  435



>ref|XP_006291150.1| hypothetical protein CARUB_v10017266mg [Capsella rubella]
 gb|EOA24048.1| hypothetical protein CARUB_v10017266mg [Capsella rubella]
Length=441

 Score =   380 bits (975),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVI+NDPFLGKRVE+GNFSTVPLR+EFLENARLFIFETYC+IHQ
Sbjct  299  VNYDFDGAQRKMRECEEVIVNDPFLGKRVEDGNFSTVPLREEFLENARLFIFETYCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>ref|XP_006402894.1| hypothetical protein EUTSA_v10005924mg [Eutrema salsugineum]
 gb|ESQ44347.1| hypothetical protein EUTSA_v10005924mg [Eutrema salsugineum]
Length=484

 Score =   380 bits (977),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  282  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIVEFLACVF  341

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  342  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCRIHQ  401

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  402  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  461

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEH Q QA
Sbjct  462  ALSGRTYKLVTQLLEHTQGQA  482



>emb|CBI33382.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   377 bits (967),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATA IVNKRRR QFKDFIKVIQ EQY++ DPITEFLACVY
Sbjct  181  NQDKYLNAIQTNAPHLLRYLATALIVNKRRRTQFKDFIKVIQQEQYAFKDPITEFLACVY  240

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEG+FSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  241  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGSFSTVPLRDEFLENARLFIFETYCRIHQ  300

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL++KLNLNYE+AERWIVNLI TSKLDAKIDS++GTV+MEP HPNVY+Q+IDHTK
Sbjct  301  RIDMGVLSDKLNLNYEEAERWIVNLITTSKLDAKIDSKSGTVVMEPNHPNVYQQIIDHTK  360

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             +SGRTYKLV+QLLE AQ+QA
Sbjct  361  AVSGRTYKLVNQLLEKAQTQA  381



>ref|XP_002322658.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
 gb|EEF04419.1| eukaryotic translation initiation factor 3E family protein [Populus 
trichocarpa]
Length=437

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKR+E+GNFS V LRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDEAQKKMKECEEVILNDPFLGKRLEDGNFSNVLLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RID+GVLAEKLNLN+E+AERWIVNLIR SKLDAKIDSE+GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDIGVLAEKLNLNFEEAERWIVNLIRNSKLDAKIDSESGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRT K VSQ+LEHA +QA
Sbjct  415  ALSGRTSKSVSQILEHAHAQA  435



>ref|XP_009363227.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pyrus x bretschneideri]
Length=452

 Score =   379 bits (972),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 182/215 (85%), Positives = 192/215 (89%), Gaps = 15/215 (7%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQP---------------EQ  620
            NQDKYLNA QT+APHL+RYLATAFIVNKRRRPQFKDFIKVIQ                EQ
Sbjct  235  NQDKYLNAIQTHAPHLVRYLATAFIVNKRRRPQFKDFIKVIQQXXXXXXXXXXXXXXQEQ  294

Query  619  YSYADPITEFLACVYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLE  440
            +SY DPITEFL CVYVNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLE
Sbjct  295  HSYKDPITEFLTCVYVNYDFDGAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLE  354

Query  439  NARLFIFETYCRIHQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIME  260
            NARLFIFETYCRIHQRIDMGVLAEKLNLNYE+AERWIVNLIR+SKLDAKIDSE+GTVIME
Sbjct  355  NARLFIFETYCRIHQRIDMGVLAEKLNLNYEEAERWIVNLIRSSKLDAKIDSESGTVIME  414

Query  259  PTHPNVYEQLIDHTKGLSGRTYKLVSQLLEHAQSQ  155
            P HPNVYEQLIDHTK LSGRTYKLV Q+LEHAQ+Q
Sbjct  415  PNHPNVYEQLIDHTKALSGRTYKLVGQILEHAQAQ  449



>emb|CDY06117.1| BnaA09g36630D [Brassica napus]
Length=441

 Score =   378 bits (971),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKR+RPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRKRPQLKEFIKVIQQEHYSYKDPIVEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE GNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVENGNFSTVPLRDEFLENARLFIFETYCRIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEH Q QA
Sbjct  419  ALSGRTYKLVTQLLEHTQGQA  439



>gb|ACJ84594.1| unknown [Medicago truncatula]
Length=225

 Score =   370 bits (949),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT APHLLRYLATAFIVNKR+RPQFKDF+KVIQ EQ+S+ DPITEFLACVY
Sbjct  23   NQDKYLNAIQTGAPHLLRYLATAFIVNKRKRPQFKDFLKVIQQEQHSFKDPITEFLACVY  82

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPF+GKRVEE NFSTVPLRDEF+ENARLFIFETYCRIH+
Sbjct  83   VNYDFDGAQKKMRECEEVILNDPFIGKRVEESNFSTVPLRDEFIENARLFIFETYCRIHE  142

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDS+TGTVIME  HPNVYEQLI+HTK
Sbjct  143  RIDMGVLAEKLNLNYEEAERWIVNLIRGSKLDAKIDSQTGTVIMEHNHPNVYEQLIEHTK  202

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+ RTYKLV+Q+LEHAQ+ A
Sbjct  203  ALNSRTYKLVTQILEHAQAPA  223



>ref|XP_011075359.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Sesamum indicum]
Length=438

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 190/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFK+FIKVIQ E+YS  DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQERYSNEDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  296  VNYDFDMAQKKMRECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIV LIRTSKL+AKIDS+ GT++MEP   NVYEQLIDHTK
Sbjct  356  RIDMGVLAEKLNLNYEEAERWIVTLIRTSKLEAKIDSKMGTIVMEPNQTNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEHAQ+QA
Sbjct  416  SLSGRTYKLVNQLLEHAQAQA  436



>ref|XP_011015723.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X1 [Populus euphratica]
Length=437

 Score =   377 bits (969),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGK +E+ NFSTVPLRDEFLENARLF+FETYCRIHQ
Sbjct  295  VNYDFDEAQKKMKECEEVILNDPFLGKHLEDSNFSTVPLRDEFLENARLFVFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIR SKLDAKIDS++GTVIMEP H NVYEQLIDHTK
Sbjct  355  RIDMEVLAEKLNLNYEEAERWIVNLIRNSKLDAKIDSQSGTVIMEPNHSNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRT KLVSQ+LEHAQ+Q+
Sbjct  415  ALSGRTSKLVSQILEHAQAQS  435



>ref|XP_009116433.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Brassica rapa]
Length=441

 Score =   377 bits (969),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/201 (89%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKR+RPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRKRPQLKEFIKVIQQEHYSYKDPIVEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE GNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVENGNFSTVPLRDEFLENARLFIFETYCRIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSEAGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QLLEH Q QA
Sbjct  419  ALSGRTYKLVTQLLEHTQGQA  439



>ref|XP_010523678.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tarenaya hassleriana]
Length=444

 Score =   377 bits (968),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFK+F+KVIQ EQYSY DPI EFLAC++
Sbjct  242  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKEFVKVIQQEQYSYKDPIIEFLACIF  301

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECE+VI+NDPFLGKRVE+GNFST+PLRDEFLENARLFIFETYCRIHQ
Sbjct  302  VNYDFDGAQKKMKECEDVIVNDPFLGKRVEDGNFSTIPLRDEFLENARLFIFETYCRIHQ  361

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSE+GTV+MEP  PN++EQL+ HTK
Sbjct  362  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSESGTVVMEPNQPNIHEQLVAHTK  421

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQLLEHA +Q
Sbjct  422  ALSGRTYKLVSQLLEHAPAQ  441



>ref|XP_010056741.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Eucalyptus grandis]
 gb|KCW90113.1| hypothetical protein EUGRSUZ_A02306 [Eucalyptus grandis]
Length=437

 Score =   377 bits (967),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 195/205 (95%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFI+V+Q EQ+++ DPI EFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIRVVQQEQHAFKDPIIEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEE+ILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIH+
Sbjct  295  VNYDFDGAQKKMRECEELILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHR  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RID+GVLAEK+NLNYE+AERWIVNLIRTSKL+AKIDS+ GT+++EP +PNVYEQLIDHTK
Sbjct  355  RIDLGVLAEKVNLNYEEAERWIVNLIRTSKLEAKIDSKLGTIVIEPNNPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
            GLSGRTYKLV+Q+LEHA  QAQP R
Sbjct  415  GLSGRTYKLVTQVLEHA--QAQPAR  437



>ref|XP_002284533.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Vitis vinifera]
Length=437

 Score =   376 bits (965),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 191/201 (95%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATA IVNKRRR QFKDFIKVIQ EQY++ DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATALIVNKRRRTQFKDFIKVIQQEQYAFKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEEG+FSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEEGSFSTVPLRDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL++KLNLNYE+AERWIVNLI TSKLDAKIDS++GTV+MEP HPNVY+Q+IDHTK
Sbjct  355  RIDMGVLSDKLNLNYEEAERWIVNLITTSKLDAKIDSKSGTVVMEPNHPNVYQQIIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             +SGRTYKLV+QLLE AQ+QA
Sbjct  415  AVSGRTYKLVNQLLEKAQTQA  435



>gb|EYU20768.1| hypothetical protein MIMGU_mgv1a006585mg [Erythranthe guttata]
Length=438

 Score =   375 bits (964),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQ+KYLNA QTNAPHLLRYLATAFIVNKRRRPQFK+F+KVIQ EQYS  DPITEFLACVY
Sbjct  236  NQEKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKEFMKVIQQEQYSCKDPITEFLACVY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD A +KMKECEEVILNDPFLGKRVEEGNFS VPLRDEFLENARLFIFETYCRIHQ
Sbjct  296  VNYDFDGAHEKMKECEEVILNDPFLGKRVEEGNFSGVPLRDEFLENARLFIFETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNL YE+AERWIVNLIRTSKL+AK+D++TGT++MEP H NVYEQLIDHTK
Sbjct  356  RIDMSVLAEKLNLEYEEAERWIVNLIRTSKLEAKLDTKTGTIMMEPNHTNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLVSQL+EHAQ QA
Sbjct  416  ALSGRTYKLVSQLMEHAQVQA  436



>emb|CDX72053.1| BnaC08g28210D [Brassica napus]
Length=441

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 176/201 (88%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKR+RPQ K+FIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRKRPQLKEFIKVIQQEHYSYKDPIVEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE GNFSTVPLRDEFLENARLFIFETYCRIHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVENGNFSTVPLRDEFLENARLFIFETYCRIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTK
Sbjct  359  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTY+LV+QLL+H Q QA
Sbjct  419  ALSGRTYELVTQLLKHTQGQA  439



>emb|CDX88939.1| BnaA04g02470D [Brassica napus]
Length=441

 Score =   375 bits (962),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/200 (87%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKY+NA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+V
Sbjct  240  QDKYMNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIVEFLACVFV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQ+KMKECEEVI+NDPFLGKRV++GNFSTVPL+DEFLENARLFIFETYCRIHQR
Sbjct  300  NYDFDGAQKKMKECEEVIVNDPFLGKRVDDGNFSTVPLKDEFLENARLFIFETYCRIHQR  359

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            IDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQL++HTK 
Sbjct  360  IDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLVNHTKA  419

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            LSGRTYKLV+QLLEH+Q QA
Sbjct  420  LSGRTYKLVTQLLEHSQGQA  439



>gb|KJB46272.1| hypothetical protein B456_007G355700 [Gossypium raimondii]
Length=437

 Score =   374 bits (961),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 189/205 (92%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFK+FIKVIQ +Q SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQDQCSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNY+FD AQ+KMKECEEVILNDPFLGKRVEEGNF+TVPL+DEFLENARLFIFETYCRIHQ
Sbjct  295  VNYEFDGAQKKMKECEEVILNDPFLGKRVEEGNFNTVPLKDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL EKLNLNYE+ ERW+VNLIR SKLDAKIDS+TGTVIMEP  PNVYEQLIDHTK
Sbjct  355  RIDMGVLFEKLNLNYEEGERWVVNLIRNSKLDAKIDSKTGTVIMEPNRPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
             L GRTYKLV QLLEHA  QAQP R
Sbjct  415  ALQGRTYKLVGQLLEHA--QAQPAR  437



>gb|AAF67757.1|AF255679_1 eIF3e [Arabidopsis thaliana]
Length=441

 Score =   374 bits (961),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ KDFIKVIQ E YSY DPI EFLACV+
Sbjct  239  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKDFIKVIQQEHYSYKDPIIEFLACVF  298

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEF ENARLF+FET+C+IHQ
Sbjct  299  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFFENARLFVFETFCKIHQ  358

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL EKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIM PT PNV+EQLI+HTK
Sbjct  359  RIDMGVLREKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMVPTQPNVHEQLINHTK  418

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV+QLLEH Q+QA
Sbjct  419  GLSGRTYKLVNQLLEHTQAQA  439



>gb|KJB46273.1| hypothetical protein B456_007G355800 [Gossypium raimondii]
Length=437

 Score =   374 bits (960),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 188/205 (92%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFK+FIKVIQ +Q SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQDQCSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNY+FD AQ+KMKECEEVILNDPFLGKRVEEGNFSTVPL+DEFLENARLFIFETYCRIHQ
Sbjct  295  VNYEFDGAQKKMKECEEVILNDPFLGKRVEEGNFSTVPLKDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL EKLNLNYE+ ERWIVNLIR SKLDAKIDSETGTVIMEP  PNVYEQLIDHTK
Sbjct  355  RIDMGVLFEKLNLNYEEGERWIVNLIRNSKLDAKIDSETGTVIMEPNQPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
             L GRTYKLV QLLE A  QAQP R
Sbjct  415  ALQGRTYKLVGQLLEPA--QAQPAR  437



>emb|CAB68135.1| translation initiation factor 3-like protein [Arabidopsis thaliana]
Length=418

 Score =   373 bits (957),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 174/197 (88%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -2

Query  742  YLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVNYD  563
            YLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+VNYD
Sbjct  220  YLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIEFLACVFVNYD  279

Query  562  FDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRIDM  383
            FD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLF+FETYC+IHQRIDM
Sbjct  280  FDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFVFETYCKIHQRIDM  339

Query  382  GVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGLSG  203
            GVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQLI+HTKGLSG
Sbjct  340  GVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLINHTKGLSG  399

Query  202  RTYKLVSQLLEHAQSQA  152
            RTYKLV+QLLEH Q+QA
Sbjct  400  RTYKLVNQLLEHTQAQA  416



>gb|KHG29831.1| Eukaryotic translation initiation factor 3 subunit E [Gossypium 
arboreum]
Length=437

 Score =   374 bits (959),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 189/205 (92%), Gaps = 2/205 (1%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFK+FIKVIQ +Q SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQDQCSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNY+FD AQ+KMKECEEVILNDPFLGKRVEEG+FSTVPL+DEFLENARLFIFETYCRIHQ
Sbjct  295  VNYEFDGAQKKMKECEEVILNDPFLGKRVEEGSFSTVPLKDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVL EKLNLNYE+ ERWIVNLIR SKLDAKIDSETGTVIMEP  PNVYEQLIDHTK
Sbjct  355  RIDMGVLFEKLNLNYEEGERWIVNLIRNSKLDAKIDSETGTVIMEPNQPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQAQPTR  140
             L GRTYKLV QLLE+A  QAQP R
Sbjct  415  ALQGRTYKLVGQLLENA--QAQPAR  437



>ref|XP_009139041.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Brassica rapa]
Length=441

 Score =   373 bits (958),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 173/200 (87%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKY+NA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+V
Sbjct  240  QDKYMNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIVEFLACVFV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQ+KMKECEEVI+NDPFLGKRV++GNFSTVPL+DEFLENARLFIFETYCRIHQR
Sbjct  300  NYDFDGAQKKMKECEEVIVNDPFLGKRVDDGNFSTVPLKDEFLENARLFIFETYCRIHQR  359

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            IDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSE+G VIMEPT PNV+EQL++HTK 
Sbjct  360  IDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSESGAVIMEPTQPNVHEQLVNHTKA  419

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            LSGRTYKLV+QLLEH+Q QA
Sbjct  420  LSGRTYKLVTQLLEHSQGQA  439



>gb|KEH38776.1| eukaryotic translation initiation factor 3E [Medicago truncatula]
Length=437

 Score =   373 bits (957),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 175/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT APHLLRYLATAFIVNKR+RPQFKDF+KVIQ EQ+S+ DPITEFLACVY
Sbjct  235  NQDKYLNAIQTGAPHLLRYLATAFIVNKRKRPQFKDFLKVIQQEQHSFKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIH+
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHE  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDS+TGTVIME  HPNVYEQLI+HTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRGSKLDAKIDSQTGTVIMEHNHPNVYEQLIEHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+ RTYKLV+Q+LEHAQ+ A
Sbjct  415  ALNSRTYKLVTQILEHAQAPA  435



>emb|CDP21587.1| unnamed protein product, partial [Coffea canephora]
Length=370

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 174/190 (92%), Positives = 182/190 (96%), Gaps = 0/190 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAF+VNKRRRPQFKDFIKVIQ EQYSY DPITEFLACVY
Sbjct  181  NQDKYLNAIQTSAPHLLRYLATAFVVNKRRRPQFKDFIKVIQQEQYSYEDPITEFLACVY  240

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            V YDFDAAQQKM+ECEEVILNDPFLGKR EEGNF++VPLRDEFLENARLFIFETYCRIHQ
Sbjct  241  VKYDFDAAQQKMRECEEVILNDPFLGKRAEEGNFASVPLRDEFLENARLFIFETYCRIHQ  300

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIRTSKLDAKIDS+TGTV+MEP  PNVYEQLIDHTK
Sbjct  301  RIDMGVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSKTGTVLMEPNQPNVYEQLIDHTK  360

Query  214  GLSGRTYKLV  185
             LSGRTYKLV
Sbjct  361  ALSGRTYKLV  370



>gb|KFK34965.1| hypothetical protein AALP_AA5G216900 [Arabis alpina]
Length=443

 Score =   372 bits (954),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/201 (87%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI +FLACV+
Sbjct  241  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIIDFLACVF  300

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVI+NDPFLGKRVE+GNFSTVPLRDEFLENARLFIFETYC+IHQ
Sbjct  301  VNYDFDGAQKKMKECEEVIVNDPFLGKRVEDGNFSTVPLRDEFLENARLFIFETYCKIHQ  360

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWI NLIRTSKLDAKIDS++GTVIMEPT PNV+EQLI+HTK
Sbjct  361  RIDMGVLAEKLNLNYEEAERWIENLIRTSKLDAKIDSKSGTVIMEPTQPNVHEQLINHTK  420

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LSGRTYKLV+QL+EH Q QA
Sbjct  421  ALSGRTYKLVTQLVEHTQGQA  441



>gb|AFK46442.1| unknown [Medicago truncatula]
Length=437

 Score =   370 bits (951),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 173/201 (86%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT APHLLRYLATAFIVNKR+RPQFKDF+KVIQ EQ+S+ DPITEFLACVY
Sbjct  235  NQDKYLNAIQTGAPHLLRYLATAFIVNKRKRPQFKDFLKVIQQEQHSFKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KM+ECEEVILNDPF+GKRVEE NFSTVPLRDEF+ENARLFIFETYCRIH+
Sbjct  295  VNYDFDGAQKKMRECEEVILNDPFIGKRVEESNFSTVPLRDEFIENARLFIFETYCRIHE  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLNYE+AERWIVNLIR SKLDAKIDS+TGTVIME  HPNVYEQLI+HTK
Sbjct  355  RIDMGVLAEKLNLNYEEAERWIVNLIRGSKLDAKIDSQTGTVIMEHNHPNVYEQLIEHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             L+ RTYKLV+Q+LEHAQ+ A
Sbjct  415  ALNSRTYKLVTQILEHAQAPA  435



>ref|XP_004249215.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Solanum lycopersicum]
Length=438

 Score =   370 bits (949),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 187/200 (94%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLA AFIVNKRRRPQFKDFIKVIQ EQ+S  DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTSAPHLLRYLAIAFIVNKRRRPQFKDFIKVIQQEQHSCKDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            V+YDFD AQ+KMKECEE+ILNDPFLGKR EEG+FS+VPLRDEFLENARLFI ETYCRIHQ
Sbjct  296  VDYDFDGAQEKMKECEELILNDPFLGKRAEEGSFSSVPLRDEFLENARLFISETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLN E+AERW+VNLIRTSKLDAKID+ETGTV MEP  PNVYEQLIDHTK
Sbjct  356  RIDMGVLAEKLNLNLEEAERWMVNLIRTSKLDAKIDTETGTVTMEPNQPNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQLLEHAQ+Q
Sbjct  416  PLSGRTYKLVSQLLEHAQTQ  435



>emb|CDY30993.1| BnaC04g24310D [Brassica napus]
Length=441

 Score =   368 bits (944),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/200 (86%), Positives = 189/200 (95%), Gaps = 0/200 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKY+NA QT+APHLLRYLATAFIVNKRRRPQ K+FIKVIQ E YSY DPI EFLACV+V
Sbjct  240  QDKYMNAIQTSAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEHYSYKDPIVEFLACVFV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQ+KMKECEEVI+NDPFLGKRV++GNFSTVPL+DEFLENARLFIFETYCRIHQR
Sbjct  300  NYDFDGAQKKMKECEEVIVNDPFLGKRVDDGNFSTVPLKDEFLENARLFIFETYCRIHQR  359

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            IDMGVLAEKL+L YE+AERWIVNLIRTSKLDAKIDSE+GTVIMEPT PNV+EQL++HTK 
Sbjct  360  IDMGVLAEKLDLKYEEAERWIVNLIRTSKLDAKIDSESGTVIMEPTQPNVHEQLVNHTKA  419

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            LSGRTYKLV+QLLE++Q QA
Sbjct  420  LSGRTYKLVTQLLEYSQGQA  439



>ref|XP_006351291.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Solanum tuberosum]
Length=438

 Score =   367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 175/200 (88%), Positives = 186/200 (93%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLA AFIVNKRRRPQFKDFIKVIQ EQ+S  DPITEFLAC+Y
Sbjct  236  NQDKYLNAIQTSAPHLLRYLAIAFIVNKRRRPQFKDFIKVIQQEQHSCKDPITEFLACIY  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEE+ILNDPFLGKR E+G+FS+V LRDEFLENARLFI ETYCRIHQ
Sbjct  296  VNYDFDGAQEKMKECEELILNDPFLGKRAEDGSFSSVLLRDEFLENARLFISETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDMGVLAEKLNLN E+AERWIVNLIRTSKLDAKID+ETGTV MEP  PNVYEQLIDHTK
Sbjct  356  RIDMGVLAEKLNLNLEEAERWIVNLIRTSKLDAKIDTETGTVTMEPNQPNVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQLLEHAQ+Q
Sbjct  416  PLSGRTYKLVSQLLEHAQTQ  435



>ref|XP_011033185.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Populus euphratica]
 ref|XP_011033187.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Populus euphratica]
Length=439

 Score =   367 bits (942),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 174/195 (89%), Positives = 184/195 (94%), Gaps = 0/195 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQ EQ+SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQHSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEEVILNDPFLGKR+E+GNFS V LR+EFLENARLFIFETYCRIHQ
Sbjct  295  VNYDFDEAQKKMKECEEVILNDPFLGKRLEDGNFSIVLLREEFLENARLFIFETYCRIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RID+GVLAEKLNLN+E+AERWIVNLIR SKLDAKIDSE+GTVIMEP HPNVYEQLIDHTK
Sbjct  355  RIDIGVLAEKLNLNFEEAERWIVNLIRNSKLDAKIDSESGTVIMEPNHPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLE  170
             LSGRT K VSQ+LE
Sbjct  415  ALSGRTSKSVSQILE  429



>ref|XP_010554805.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Tarenaya hassleriana]
Length=445

 Score =   365 bits (936),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATA IVNKRR+PQ K+FI+VIQ EQY+Y DPI EFLAC++
Sbjct  242  NQDKYLNAIQTSAPHLLRYLATALIVNKRRKPQLKEFIRVIQQEQYTYKDPIIEFLACIF  301

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD AQ+KMKECEE I+NDPFLGK VE+GNFSTVPLRDEFLENARLFIFETYCRIH 
Sbjct  302  VNYDFDGAQKKMKECEEAIVNDPFLGKHVEDGNFSTVPLRDEFLENARLFIFETYCRIHS  361

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RIDM VLAEKLNLNYE+AERWIVNLIRTSKLDAKIDSETGTVIMEP  PN++EQLI HTK
Sbjct  362  RIDMKVLAEKLNLNYEEAERWIVNLIRTSKLDAKIDSETGTVIMEPNEPNIHEQLISHTK  421

Query  214  GLSGRTYKLVSQLLEHAQSQ  155
             LSGRTYKLVSQ LEHAQ+Q
Sbjct  422  ALSGRTYKLVSQFLEHAQTQ  441



>ref|XP_010672915.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Beta vulgaris subsp. vulgaris]
Length=437

 Score =   362 bits (928),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLATAFIVNKRRRPQFKDF+KVIQ EQ SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFVKVIQQEQNSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDF+ AQ+K++ECEEVILNDPFLGKRVEEG+++TVPLRDEFLENARLFI ETYC+IHQ
Sbjct  295  VNYDFEGAQKKLRECEEVILNDPFLGKRVEEGSYTTVPLRDEFLENARLFICETYCKIHQ  354

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RID+GVLAEKLNL+YE+AERWI+ LIRTSKLDAKIDS+ GT++ME  +PNVYEQLIDHTK
Sbjct  355  RIDLGVLAEKLNLSYEEAERWIMTLIRTSKLDAKIDSKLGTIVMESNYPNVYEQLIDHTK  414

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
            GLSGRTYKLV QLLE  Q Q 
Sbjct  415  GLSGRTYKLVGQLLEQGQPQV  435



>gb|EPS73624.1| hypothetical protein M569_01130, partial [Genlisea aurea]
Length=438

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QTNAPHLLRYLA AF+VNKR+RPQFK+FIKVIQ E YS  DPITEFLACV+
Sbjct  236  NQDKYLNAIQTNAPHLLRYLAAAFVVNKRKRPQFKEFIKVIQQEAYSSKDPITEFLACVF  295

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNYDFD A +KM+ECEEVILNDPFLG RV EG+F+TVPLRDEFLENARLFIFETYCRIHQ
Sbjct  296  VNYDFDGAHKKMRECEEVILNDPFLGMRVGEGSFTTVPLRDEFLENARLFIFETYCRIHQ  355

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
            RI+M VLAEKLNL +E+AE WIVNLIRTSKLDAKIDS+TGTV MEP H +VYEQLIDHTK
Sbjct  356  RIEMRVLAEKLNLKFEEAEAWIVNLIRTSKLDAKIDSKTGTVTMEPHHVDVYEQLIDHTK  415

Query  214  GLSGRTYKLVSQLLEHAQSQA  152
             LS RTYKLVSQLLEH Q QA
Sbjct  416  TLSNRTYKLVSQLLEHGQPQA  436



>ref|XP_010090220.1| Eukaryotic translation initiation factor 3 subunit E [Morus notabilis]
 gb|EXB39089.1| Eukaryotic translation initiation factor 3 subunit E [Morus notabilis]
Length=435

 Score =   349 bits (896),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/197 (83%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            DKYLNA QTNAPHLLRYLATAFIVNKR+R QFKDFIKVI  EQ+SY DPITEFLACV+VN
Sbjct  237  DKYLNAIQTNAPHLLRYLATAFIVNKRKRNQFKDFIKVIHKEQHSYQDPITEFLACVFVN  296

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YDFD AQ+KMKE EEVILNDPFLGKRVEEGNFSTVP+RDEFLENARLFIFETYCRIHQRI
Sbjct  297  YDFDGAQKKMKEWEEVILNDPFLGKRVEEGNFSTVPMRDEFLENARLFIFETYCRIHQRI  356

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
             +GVLA KLNLNYE+AERWI+NLIR SKLDA+ID++ GTV+MEP  PNVYEQLIDHTK L
Sbjct  357  SLGVLAVKLNLNYEEAERWILNLIRNSKLDARIDTKEGTVVMEPNQPNVYEQLIDHTKVL  416

Query  208  SGRTYKLVSQLLEHAQS  158
              RT+KL +Q+LEHAQ+
Sbjct  417  QVRTHKLATQILEHAQA  433



>ref|XP_010279582.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nelumbo nucifera]
Length=442

 Score =   344 bits (883),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 185/203 (91%), Gaps = 0/203 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            D+Y+NA QTNAPHLLRYLATAFIVNKRRRPQ K+FIKVIQ EQYSY DPITEFL C+YV+
Sbjct  235  DRYINAIQTNAPHLLRYLATAFIVNKRRRPQLKEFIKVIQQEQYSYKDPITEFLECLYVH  294

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YDFD AQ+K++ECE+VILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ I
Sbjct  295  YDFDGAQKKLRECEDVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQCI  354

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            DMG+LAEKLNLNY++AERWIVNL+R +KLDAKIDS++GTV+MEP H NVYEQ+I++TK L
Sbjct  355  DMGMLAEKLNLNYDEAERWIVNLVRNAKLDAKIDSKSGTVVMEPNHLNVYEQIIENTKSL  414

Query  208  SGRTYKLVSQLLEHAQSQAQPTR  140
            S RTYKL +Q+LE A S +  +R
Sbjct  415  SMRTYKLANQVLEAADSGSIRSR  437



>ref|XP_010269659.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Nelumbo nucifera]
Length=439

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/199 (79%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            D+Y+NA QTNAPHLLRYLATAF+VNKRRRPQ K+FIKVIQ EQYSY DPITEFL C+YV+
Sbjct  237  DRYINAIQTNAPHLLRYLATAFVVNKRRRPQLKEFIKVIQQEQYSYKDPITEFLECLYVH  296

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YD D AQ+K++ECE+VILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ +
Sbjct  297  YDLDGAQKKLRECEDVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQCL  356

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            DMG+LAEKLNLNY++AERWIVNLIR +KLDAKI+S++GTV+MEP H NVYEQ+I++TK L
Sbjct  357  DMGMLAEKLNLNYDEAERWIVNLIRNAKLDAKINSKSGTVVMEPNHLNVYEQIIENTKAL  416

Query  208  SGRTYKLVSQLLEHAQSQA  152
            S RTYKL +Q+LE A +QA
Sbjct  417  SMRTYKLANQVLEAAHTQA  435



>gb|AIZ68193.1| eukaryotic translation initiation factor 3 subunit E-like protein 
[Ornithogalum saundersiae]
Length=438

 Score =   306 bits (784),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 173/204 (85%), Gaps = 1/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA +VNKRRR   K+ IKVIQ EQ+SY DPITEF+ C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFVECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQ K++ECE+VILNDPFLGKRVE+GNF+TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFEGAQNKLRECEDVILNDPFLGKRVEDGNFTTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA+KLN+NYE+AERWI+NL+RTSKL+AKIDS  GTVIM   +PNV+EQ+I+  K 
Sbjct  356  IDISMLADKLNMNYEEAERWIMNLVRTSKLEAKIDSVAGTVIMASNYPNVHEQIIESMKN  415

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RTY L   +LE AQ+ AQ  R
Sbjct  416  LNMRTYVLAKGVLEPAQA-AQAAR  438



>ref|XP_006657560.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Oryza brachyantha]
Length=439

 Score =   306 bits (784),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFITVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN++Y++AE WI+NL+R SKLDAKIDS +GT+IM   H N++EQ I+  K 
Sbjct  356  IDIGMLSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQFIESLKN  415

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RT+ L   ++E AQ+  Q TR
Sbjct  416  LNMRTFMLAKNIVEPAQAAQQATR  439



>ref|XP_004955814.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Setaria italica]
Length=439

 Score =   303 bits (776),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 171/204 (84%), Gaps = 0/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQ K+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQLKLMECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +L++KLN++Y++AE WI+NL+R+SKLDA+IDS +GT+IM   H NV+EQ+I+  KG
Sbjct  356  IDISMLSQKLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHVNVHEQIIESLKG  415

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RTY L   ++E AQ+  Q TR
Sbjct  416  LNMRTYMLAKNIVEPAQATQQATR  439



>ref|XP_003557378.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Brachypodium distachyon]
Length=440

 Score =   302 bits (773),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLA A +VNKRRR   K+ IKVIQ EQ  Y DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAPHLLRYLAAAVVVNKRRRNMLKELIKVIQQEQQCYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFITVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+LAEK+N+ Y++AE WI+NL+++SKLDAKIDS TGT+IM   H NV+EQ+I++ K 
Sbjct  356  IDIGMLAEKMNMTYDEAELWIMNLVKSSKLDAKIDSVTGTLIMTTNHVNVHEQIIENMKN  415

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            L+ RTY L   L++   + AQ
Sbjct  416  LNARTYMLAKSLVDPGHAAAQ  436



>gb|ABK34467.1| eukaryotic initiation factor 3e [Oryza sativa Japonica Group]
Length=439

 Score =   300 bits (769),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN++Y++AE WI+NL+R SKLDAKIDS +GT+IM   H N++EQ+I+  K 
Sbjct  356  IDIGMLSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQVIESLKN  415

Query  211  LSGRTYKLVSQLLE  170
            L+ RT+ L   ++E
Sbjct  416  LNMRTFLLAKNIVE  429



>dbj|BAD30374.1| putative eIF3e [Oryza sativa Japonica Group]
Length=397

 Score =   298 bits (764),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C++V
Sbjct  194  QERYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLFV  253

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECEEVILNDPFLGKR+EEGN  TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  254  NYDFDGAQQKLIECEEVILNDPFLGKRIEEGNSITVPLRDEFLENARLFIFETYCRIHRS  313

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN+ Y++ E WI+NL+R SKLDAKIDS +GT+IM   H N++EQ I+  K 
Sbjct  314  IDIGMLSQKLNMRYDEGELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQFIESLKN  373

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RT  L   ++E AQ+  Q TR
Sbjct  374  LNMRTSMLAKNIVEPAQAMQQATR  397



>ref|NP_001058974.2| Os07g0167000 [Oryza sativa Japonica Group]
 dbj|BAF20888.2| Os07g0167000, partial [Oryza sativa Japonica Group]
Length=404

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C++V
Sbjct  201  QERYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLFV  260

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECEEVILNDPFLGKR+EEGN  TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  261  NYDFDGAQQKLIECEEVILNDPFLGKRIEEGNSITVPLRDEFLENARLFIFETYCRIHRS  320

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN+ Y++ E WI+NL+R SKLDAKIDS +GT+IM   H N++EQ I+  K 
Sbjct  321  IDIGMLSQKLNMRYDEGELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQFIESLKN  380

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RT  L   ++E AQ+  Q TR
Sbjct  381  LNMRTSMLAKNIVEPAQAMQQATR  404



>dbj|BAD30375.1| putative eIF3e [Oryza sativa Japonica Group]
 gb|EAZ02898.1| hypothetical protein OsI_25031 [Oryza sativa Indica Group]
 gb|EAZ38814.1| hypothetical protein OsJ_23219 [Oryza sativa Japonica Group]
Length=415

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C++V
Sbjct  212  QERYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLFV  271

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECEEVILNDPFLGKR+EEGN  TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  272  NYDFDGAQQKLIECEEVILNDPFLGKRIEEGNSITVPLRDEFLENARLFIFETYCRIHRS  331

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN+ Y++ E WI+NL+R SKLDAKIDS +GT+IM   H N++EQ I+  K 
Sbjct  332  IDIGMLSQKLNMRYDEGELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQFIESLKN  391

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RT  L   ++E AQ+  Q TR
Sbjct  392  LNMRTSMLAKNIVEPAQAMQQATR  415



>ref|XP_008806586.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Phoenix dactylifera]
Length=435

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/198 (71%), Positives = 169/198 (85%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA I+NKRRR   K+ IKVIQ EQ+ Y DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVIINKRRRNMLKELIKVIQQEQHYYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF++AQ+K++ECE+VILNDPFLGK VE+GNF TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFESAQKKLRECEQVILNDPFLGKHVEDGNFITVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN++Y++AE WI+NL+R SKL+AKIDS +GTVIME  H NVYEQ+I++ K 
Sbjct  356  IDISMLAEKLNMSYDEAEMWIMNLVRNSKLEAKIDSVSGTVIMETNHLNVYEQIIENMKN  415

Query  211  LSGRTYKLVSQLLEHAQS  158
            L+ RTY L   +LE AQ+
Sbjct  416  LNMRTYVLAKNILEPAQA  433



>ref|XP_006837958.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda]
 gb|ERN00527.1| hypothetical protein AMTR_s00102p00062980 [Amborella trichopoda]
Length=438

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA IVNKR+R   K+ IKVIQ EQY+Y DPITEFL C+Y+
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVIVNKRKRHMLKELIKVIQQEQYTYKDPITEFLECLYI  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQQK++ECE+VILNDPFLGK+V+E NF TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFEGAQQKLRECEDVILNDPFLGKQVQEANFVTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN++ ++AERWIVNL+R +KLDAKIDS++GTV+M   H NVYEQ+I++TK 
Sbjct  356  IDIRMLAEKLNMSDDEAERWIVNLVRNAKLDAKIDSKSGTVVMSTNHVNVYEQIIENTKQ  415

Query  211  LSGRTYKLVSQLLEHA  164
            LS RTY L   +LE A
Sbjct  416  LSMRTYMLAKNVLEAA  431



>ref|NP_001131771.1| uncharacterized protein LOC100193141 [Zea mays]
 gb|ACF80330.1| unknown [Zea mays]
 tpg|DAA60023.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=436

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 169/201 (84%), Gaps = 0/201 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLQCLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKRVEEGNF TVPLR EFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLVECEQVILNDPFLGKRVEEGNFVTVPLRAEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA++LN++Y++AE WI+NL+R+SKLDA+IDS +GT+IM   H NV+EQ+I+  KG
Sbjct  356  IDISMLAQRLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHINVHEQIIESMKG  415

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            L+ RTY L   ++E AQ  A+
Sbjct  416  LNMRTYMLAKNIVEPAQQAAR  436



>ref|NP_001059202.1| Os07g0222300 [Oryza sativa Japonica Group]
 dbj|BAC45186.1| putative eIF3e (subunits of eukaryotic translation initiation 
factor 3) [Oryza sativa Japonica Group]
 dbj|BAF21116.1| Os07g0222300 [Oryza sativa Japonica Group]
 gb|EEE66816.1| hypothetical protein OsJ_23573 [Oryza sativa Japonica Group]
Length=439

 Score =   298 bits (764),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN++Y++AE WI+NL+R SKLDAKIDS +GT+IM   H N++EQ+I+  K 
Sbjct  356  IDIGMLSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQVIESLKN  415

Query  211  LSGRTYKLVSQLLE  170
            L+ RT+ L   ++E
Sbjct  416  LNMRTFLLAKNIVE  429



>gb|ABK34475.1| eukaryotic initiation factor 3e [Oryza sativa Indica Group]
 gb|EEC81741.1| hypothetical protein OsI_25391 [Oryza sativa Indica Group]
Length=439

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 166/194 (86%), Gaps = 0/194 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLATA +VNKRRR   K+ IKVIQ EQ+SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAPHLLRYLATAVVVNKRRRNMLKELIKVIQQEQHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF TVPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVTVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KLN++Y++AE WI+NL+R SKLDAKIDS +GT+IM   H N++EQ+I+  K 
Sbjct  356  IDIGMLSQKLNMSYDEAELWIMNLVRNSKLDAKIDSVSGTLIMTTNHVNIHEQVIESLKN  415

Query  211  LSGRTYKLVSQLLE  170
            L+ RT+ L   ++E
Sbjct  416  LNMRTFLLAKNIVE  429



>gb|ACN40777.1| unknown [Picea sitchensis]
Length=441

 Score =   296 bits (759),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++YLNA QTNA HLLRYLATA +VNKRRR   K+ IKVIQ EQY+Y DPITEFL C+YV
Sbjct  236  QERYLNAIQTNAHHLLRYLATAVVVNKRRRNMLKELIKVIQQEQYTYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQQK+ ECE+VILNDPFLGK+V+EGNF TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFEGAQQKLVECEKVILNDPFLGKQVQEGNFVTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKL+++Y++AERWIVNL++ +KLDAKIDS +GTV+M   H NVYEQ+I++TK 
Sbjct  356  IDIRMLAEKLSMSYDEAERWIVNLVKNAKLDAKIDSTSGTVVMGTNHTNVYEQIIENTKQ  415

Query  211  LSGRTYKLVSQLLEHA  164
            LS RTY L + +   A
Sbjct  416  LSMRTYVLANNVASMA  431



>gb|ACN28978.1| unknown [Zea mays]
 tpg|DAA39489.1| TPA: putative eukaryotic translation initiation factor 3E subunit 
family protein [Zea mays]
Length=436

 Score =   296 bits (758),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 138/204 (68%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HL+RYLATA +VNKRRR   K+ IKVIQ E +SY DP+TEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLIRYLATAVVVNKRRRNMLKELIKVIQQEHHSYKDPVTEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF +VPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVSVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA+KLN++Y++AE WI+NL+R+SKLDA+IDS +GT+IM   H NV+EQ+++  KG
Sbjct  356  IDISMLAQKLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHVNVHEQIVESLKG  415

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RTY L   ++E AQ   Q TR
Sbjct  416  LNMRTYMLAKNIVEPAQ---QATR  436



>ref|NP_001150632.1| eukaryotic translation initiation factor 3 subunit 6 [Zea mays]
 gb|ACG39836.1| eukaryotic translation initiation factor 3 subunit 6 [Zea mays]
Length=436

 Score =   295 bits (755),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 170/204 (83%), Gaps = 3/204 (1%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HL+RYLATA +VNKRRR   K+ IKVIQ E +SY DP+TEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLIRYLATAVVVNKRRRNMLKELIKVIQQEHHSYKDPVTEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKR+EEGNF +VPLRDEFLENARLFIFETYCRIH+ 
Sbjct  296  NYDFDGAQQKLIECEQVILNDPFLGKRIEEGNFVSVPLRDEFLENARLFIFETYCRIHRC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +L++KLN++Y++AE WI+NL+R+SKLDA+IDS +GT+IM   H NV+EQ+++  KG
Sbjct  356  IDISMLSQKLNMSYDEAELWIMNLVRSSKLDARIDSVSGTLIMTTNHVNVHEQIVESLKG  415

Query  211  LSGRTYKLVSQLLEHAQSQAQPTR  140
            L+ RTY L   ++E AQ   Q TR
Sbjct  416  LNMRTYMLAKNIVEPAQ---QATR  436



>ref|XP_010922234.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Elaeis guineensis]
Length=435

 Score =   295 bits (754),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 136/198 (69%), Positives = 171/198 (86%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA I+NKRRR   K+ IKVIQ EQ+ Y DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYIATAVIINKRRRNMLKELIKVIQQEQHYYRDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF++AQ+K++ECE+VILNDPFLGKR+E+G+F+TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFESAQKKLRECEQVILNDPFLGKRIEDGDFTTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN++Y++AE WI+NL+R SKL+AKI+S +GTVIM  ++ NVYEQ+I++ K 
Sbjct  356  IDISMLAEKLNMSYDEAELWIMNLVRNSKLEAKINSASGTVIMGTSYLNVYEQIIENMKN  415

Query  211  LSGRTYKLVSQLLEHAQS  158
            L+ RTY L   +LE AQ+
Sbjct  416  LNMRTYVLAKNILEPAQA  433



>ref|XP_010931576.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Elaeis guineensis]
Length=436

 Score =   288 bits (738),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/198 (68%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA I+NKRRR   K+ IKVIQ EQ+ Y DPITEFL  +YV
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVIINKRRRNMLKELIKVIQQEQHCYKDPITEFLEYLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQ+K++ECE+VILNDPFLGK VE+GN +TVPLRDEFLENARLFIFE+YCRIHQ 
Sbjct  296  NYDFEGAQRKLRECEQVILNDPFLGKHVEDGNLTTVPLRDEFLENARLFIFESYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN++Y++AE WI+NL+R SKL+AKIDS +GTVIM   H NVYEQ+I++ K 
Sbjct  356  IDISMLAEKLNMSYDEAEMWIMNLVRNSKLEAKIDSVSGTVIMRTNHLNVYEQIIENMKN  415

Query  211  LSGRTYKLVSQLLEHAQS  158
            L+ RT+ L   +LE AQ+
Sbjct  416  LNMRTHVLAKNILEPAQA  433



>ref|XP_008786889.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Phoenix dactylifera]
Length=436

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA I+NKRRR   K+ IKVIQ +Q+ Y DPITEFL  +YV
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVIINKRRRNMLKELIKVIQQKQHCYRDPITEFLEYLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQ+K+ ECE+VILNDPFLGK VE+GN +TV LRDEFLENARLFIFE+YCRIHQ 
Sbjct  296  NYDFEGAQKKLTECEQVILNDPFLGKHVEDGNLTTVHLRDEFLENARLFIFESYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN++Y++AE WI+NL+R SKL+AKIDS +GTVIM   H NVYEQ+I++ K 
Sbjct  356  IDISMLAEKLNMSYDEAEMWIMNLVRNSKLEAKIDSASGTVIMRTNHLNVYEQIIENMKN  415

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            L+ RTY L   +LE AQ+ A+
Sbjct  416  LNVRTYVLAKNILEPAQAAAR  436



>gb|EMS48036.1| Eukaryotic translation initiation factor 3 subunit E [Triticum 
urartu]
Length=428

 Score =   286 bits (732),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 161/201 (80%), Gaps = 0/201 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLA A +VNKRRR   K+ IKVIQ EQ SY DPI EFL C+YV
Sbjct  224  QDRYLNAIQTNAPHLLRYLAAAVVVNKRRRNMLKELIKVIQQEQNSYKDPIIEFLECLYV  283

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
             YDFD AQQK+ ECE+VILNDPFLGKRVEE N   VPLRDEFLENARLFIFETYCRIH+ 
Sbjct  284  KYDFDGAQQKLVECEQVILNDPFLGKRVEERNGIAVPLRDEFLENARLFIFETYCRIHRC  343

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+GVLAEKLN+ Y++AE WI+N++++SKLDAKIDS TGT+IM     +V+EQ+I+  K 
Sbjct  344  IDIGVLAEKLNMTYDEAELWIMNMVKSSKLDAKIDSVTGTLIMTTNRVDVHEQIIESMKN  403

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            L+ RTY L   +++   + AQ
Sbjct  404  LNARTYMLAKSVVDPGHAAAQ  424



>ref|XP_009410425.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E {ECO:0000255|HAMAP-Rule:MF_03004} [Musa acuminata subsp. 
malaccensis]
Length=440

 Score =   285 bits (730),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 166/206 (81%), Gaps = 3/206 (1%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRY+ATA IVNKRRR   K+ +KVIQ E +SY DPITEFL C+YV
Sbjct  236  QDRYLNAIQTNAHHLLRYVATAVIVNKRRRNMLKELVKVIQQELHSYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQ K+KECE+VILNDPFLGKR+E+ NF+TVPLR+EFLENARLF+FETYCRIH+ 
Sbjct  296  NYDFDGAQTKLKECEQVILNDPFLGKRIEDSNFTTVPLREEFLENARLFVFETYCRIHRC  355

Query  391  IDMGVLAEKLNLN--YEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHT  218
            ID+ VLAEKLNLN  Y++A  WI NLIR SKL+AKID+  GTV M   H NV+EQ+I+  
Sbjct  356  IDISVLAEKLNLNMSYDEALVWITNLIRNSKLEAKIDAVLGTVTMPIVHQNVHEQIIEAM  415

Query  217  KGLSGRTYKLVSQLLEHAQSQAQPTR  140
            K L+ RTY L   ++E AQ+ AQ TR
Sbjct  416  KNLNMRTYLLAKNIVEPAQA-AQATR  440



>ref|XP_001765099.1| predicted protein [Physcomitrella patens]
 gb|EDQ70094.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   282 bits (722),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            ++YLNA QTNA HLLRYL TA IVNKRRR   K+ IKVIQ E+Y+Y+DP+TEFL C+YVN
Sbjct  237  ERYLNAIQTNAHHLLRYLVTAVIVNKRRRNVIKELIKVIQQERYTYSDPVTEFLECLYVN  296

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YDF+ AQQK++ECEEVI++D FLGK++ E  F T+PLRDEF+ENARLFIFETYCRIHQ I
Sbjct  297  YDFEGAQQKLRECEEVIVSDFFLGKQLSENGFVTIPLRDEFMENARLFIFETYCRIHQCI  356

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            D+G+L++KLN+NY+DA RWI NLIR ++LDAKIDS+ GTV+M    PN+YEQ+I+ TK L
Sbjct  357  DIGMLSQKLNMNYDDAARWIANLIRNARLDAKIDSKMGTVVMGTQSPNIYEQIIEKTKVL  416

Query  208  SGRTYKLVSQLL  173
              R+Y L S L+
Sbjct  417  GQRSYALTSNLI  428



>gb|EMT06719.1| hypothetical protein F775_27177 [Aegilops tauschii]
Length=557

 Score =   285 bits (730),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 161/201 (80%), Gaps = 0/201 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNAPHLLRYLA A +VNKRRR   K+ IKVIQ EQ SY DPI EFL C+YV
Sbjct  237  QDRYLNAIQTNAPHLLRYLAAAVVVNKRRRNMLKELIKVIQQEQNSYKDPIIEFLECLYV  296

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
             YDFD AQQK+ ECE+VILNDPFLGKRVEE N   VPLRDEFLENARLFIFETYCRIH+ 
Sbjct  297  KYDFDGAQQKLVECEQVILNDPFLGKRVEERNGIAVPLRDEFLENARLFIFETYCRIHRC  356

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+GVLAEKLN+ Y++AE WI+N++++SKLDAKIDS TGT+IM     +V+EQ+I+  K 
Sbjct  357  IDIGVLAEKLNMTYDEAELWIMNMVKSSKLDAKIDSVTGTLIMTTNRVDVHEQIIESMKN  416

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            L+ RTY L   +++   + AQ
Sbjct  417  LNARTYMLAKSVVDPGHAAAQ  437



>ref|XP_001753385.1| predicted protein [Physcomitrella patens]
 gb|EDQ81608.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   282 bits (721),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            ++YLNA QT+A HLLRYLA A IVNKRRR   K+ IKVIQ E+Y+Y+DPITEFL C+YVN
Sbjct  237  ERYLNAIQTSAHHLLRYLAAAAIVNKRRRNMLKELIKVIQQERYTYSDPITEFLECLYVN  296

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YDF+ AQ+K++ECEE+I++D FLGK+  E  F T+PLRDEF+ENARLFIFETYCRIHQ I
Sbjct  297  YDFEGAQKKLRECEELIVSDFFLGKQTSENGFVTIPLRDEFMENARLFIFETYCRIHQCI  356

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            D+G+L++KLN+NY+DAERWIVNLIR ++LDAKIDS+ GTV+M   HPN+YEQ+I+ TK L
Sbjct  357  DIGMLSQKLNMNYDDAERWIVNLIRNARLDAKIDSKMGTVVMGTQHPNIYEQIIEKTKVL  416

Query  208  SGRTYKLVSQLL  173
              R+Y L + ++
Sbjct  417  GQRSYALTTNVV  428



>gb|ABR16601.1| unknown [Picea sitchensis]
Length=409

 Score =   277 bits (708),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 153/174 (88%), Gaps = 0/174 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++YLNA QTNA HLLRYLATA +VNKRRR   K+ IKVIQ EQY+Y DPITEFL C+YV
Sbjct  236  QERYLNAIQTNAHHLLRYLATAVVVNKRRRNMLKELIKVIQQEQYTYKDPITEFLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQQK+ ECE+VILNDPFLGK+V+EGNF TVPLRDEFLENARLFIFETYCRIHQ 
Sbjct  296  NYDFEGAQQKLVECEKVILNDPFLGKQVQEGNFVTVPLRDEFLENARLFIFETYCRIHQC  355

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQL  230
            ID+ +LAEKL+++Y++AERWIVNL++ +KLDAKIDS +GTV+M   H NVY++L
Sbjct  356  IDIRMLAEKLSMSYDEAERWIVNLVKNAKLDAKIDSTSGTVVMGTNHTNVYDKL  409



>ref|XP_004955815.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Setaria italica]
Length=437

 Score =   277 bits (709),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 159/198 (80%), Gaps = 0/198 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QTNA HLLRYLA A +VNKRR+    + IKVIQ E+ SY DPITEFL C+YV
Sbjct  239  QDRYLNAIQTNAHHLLRYLAIAVVVNKRRKNMLNELIKVIQQEKRSYKDPITEFLECLYV  298

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFD AQQK+ ECE+VILNDPFLGKRVE GN +TVP+RDEF ENARLFIFETYCRIH+ 
Sbjct  299  NYDFDGAQQKLMECEQVILNDPFLGKRVEIGNPNTVPMRDEFFENARLFIFETYCRIHRC  358

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LAEKLN+ Y +AE WI+NL+++ KLDAKIDS +GT+IM   H +V+EQ+I+  K 
Sbjct  359  IDISILAEKLNMRYNEAELWIMNLVKSLKLDAKIDSASGTLIMTVNHADVHEQIIERLKN  418

Query  211  LSGRTYKLVSQLLEHAQS  158
            L+ RTY L    +E AQ+
Sbjct  419  LNTRTYMLAQSTVEPAQA  436



>ref|NP_001059730.1| Os07g0503700 [Oryza sativa Japonica Group]
 dbj|BAC83992.1| putative eukaryotic initiation factor 3E [Oryza sativa Japonica 
Group]
 dbj|BAF21644.1| Os07g0503700 [Oryza sativa Japonica Group]
 gb|EEE67231.1| hypothetical protein OsJ_24367 [Oryza sativa Japonica Group]
Length=436

 Score =   276 bits (707),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKYLNA QT+APHLLRYLA A +VN+RRR   K+ +KVIQ EQ+SY DPITEFL C+YV
Sbjct  241  QDKYLNAIQTDAPHLLRYLAAAIVVNRRRRNMLKELVKVIQQEQHSYKDPITEFLECLYV  300

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD AQQK+ ECE+VILNDPFLGKR+EEGN  TVPLRDEFLENARL IFE+YCRIH+ 
Sbjct  301  NHDFDGAQQKLIECEQVILNDPFLGKRIEEGNSITVPLRDEFLENARLLIFESYCRIHRC  360

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I +G+L+EKL ++Y +AE WI+NL+  SKLDAKID+ +GT+IM   H N+++Q I+  K 
Sbjct  361  IHIGMLSEKLKMSYNEAELWIMNLVSNSKLDAKIDTASGTLIMTANHANIHQQFIESLKN  420

Query  211  LSGRTYKLVSQLLEHA  164
            L  RT+ L    +E A
Sbjct  421  LDMRTFMLAKSTMEPA  436



>ref|XP_001783391.1| predicted protein [Physcomitrella patens]
 gb|EDQ51785.1| predicted protein [Physcomitrella patens]
Length=440

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            ++YLNA QTNA HLLRYLATA IVNKRRR   K+ IKVIQ E+YSY+DP+TEFL C+YVN
Sbjct  237  ERYLNAIQTNAHHLLRYLATAVIVNKRRRNMIKELIKVIQQERYSYSDPVTEFLECLYVN  296

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            YDF+ AQ+K++ECEE+I++D FLGK+  E  F  +PL DEF+ENARLFIFETYCRIHQ I
Sbjct  297  YDFEGAQRKLRECEELIVSDFFLGKQTSENGFVPIPLLDEFMENARLFIFETYCRIHQCI  356

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            D+ +L++KLN+NY+DAERWIVNLIR ++LDAKIDS+ GTV+M   +PN+YEQ+I+ TK L
Sbjct  357  DICMLSQKLNMNYDDAERWIVNLIRNARLDAKIDSKMGTVVMGTQYPNIYEQIIEKTKVL  416

Query  208  SGRTYKLVSQLL  173
            S R+Y L + ++
Sbjct  417  SQRSYALTTNVV  428



>gb|AFK36338.1| unknown [Medicago truncatula]
Length=132

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 119/130 (92%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  541  MKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL  362
            M+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL
Sbjct  1    MRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL  60

Query  361  NLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVS  182
            NLNYE+AERWIVNLIR SKLDAKIDSETGTVIMEP  PNVYEQLIDHTK L+GRTYKLV+
Sbjct  61   NLNYEEAERWIVNLIRGSKLDAKIDSETGTVIMEPNRPNVYEQLIDHTKALNGRTYKLVT  120

Query  181  QLLEHAQSQA  152
            QLLE AQ+QA
Sbjct  121  QLLEQAQAQA  130



>gb|ACJ84968.1| unknown [Medicago truncatula]
Length=132

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/130 (91%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = -2

Query  541  MKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL  362
            M+ECEEVILNDPFLGKRVEE NFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL
Sbjct  1    MRECEEVILNDPFLGKRVEESNFSTVPLRDEFLENARLFIFETYCRIHQRIDMGVLAEKL  60

Query  361  NLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVS  182
            NLNYE+AERWIVN IR SKLDAKIDSETGTVIMEP  PNVYEQLIDHTK L+GRTYKLV+
Sbjct  61   NLNYEEAERWIVNFIRGSKLDAKIDSETGTVIMEPNRPNVYEQLIDHTKALNGRTYKLVT  120

Query  181  QLLEHAQSQA  152
            QLLE AQ+QA
Sbjct  121  QLLEQAQAQA  130



>ref|XP_002992749.1| hypothetical protein SELMODRAFT_269977 [Selaginella moellendorffii]
 ref|XP_002993572.1| hypothetical protein SELMODRAFT_272327 [Selaginella moellendorffii]
 gb|EFJ05347.1| hypothetical protein SELMODRAFT_272327 [Selaginella moellendorffii]
 gb|EFJ06230.1| hypothetical protein SELMODRAFT_269977 [Selaginella moellendorffii]
Length=434

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 154/200 (77%), Gaps = 1/200 (1%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRR-RPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            D+YL+  QT+A HLLRYLA AF+V KR+ R   KDFIKVIQ E ++Y DPITEFL C+YV
Sbjct  235  DRYLHVIQTHAHHLLRYLAAAFVVCKRKHRGNIKDFIKVIQQEHHTYRDPITEFLECLYV  294

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQ+K++ECE++ILND FLG+   +  +     RDEFLENARL +FETYC+IHQR
Sbjct  295  NYDFEGAQRKLQECEDLILNDFFLGRPETDNGYIVYKFRDEFLENARLAMFETYCKIHQR  354

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+G+L++KL++NY+DAERWI NLI  S+LDAKIDS+ GTV+M   H +VYEQ I+ TK 
Sbjct  355  IDIGMLSDKLHMNYDDAERWIANLINFSRLDAKIDSKNGTVVMGVQHTDVYEQAIERTKP  414

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            L+ RTY L   + E+   +A
Sbjct  415  LATRTYVLARNIAENLPVRA  434



>gb|KHG29832.1| Eukaryotic translation initiation factor 3 subunit E [Gossypium 
arboreum]
Length=359

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            NQDKYLNA QT+APHLLRYLATAFIVNKRRRPQFK+FIKVIQ +Q SY DPITEFLACVY
Sbjct  235  NQDKYLNAIQTSAPHLLRYLATAFIVNKRRRPQFKEFIKVIQQDQCSYKDPITEFLACVY  294

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VNY+FD AQ+KMKECEEVILNDPFLGKRVEEG+FSTVPL+DEFLENARLFIFETYCRIHQ
Sbjct  295  VNYEFDGAQKKMKECEEVILNDPFLGKRVEEGSFSTVPLKDEFLENARLFIFETYCRIHQ  354

Query  394  RIDMG  380
            RIDMG
Sbjct  355  RIDMG  359



>ref|XP_004340264.1| eukaryotic translation initiation factor 3 subunit E, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR18244.1| eukaryotic translation initiation factor 3 subunit E, putative 
[Acanthamoeba castellanii str. Neff]
Length=431

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 145/200 (73%), Gaps = 11/200 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKYLN  QT  PH+LRYL TA I NKRRR Q  D ++V+Q E +SY+DPITEFL  +Y 
Sbjct  237  QDKYLNTIQTTCPHILRYLTTAVITNKRRRNQLNDLVRVLQQESHSYSDPITEFLEDLYA  296

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFDAAQ+K++ECE V++ND FL           V  R+EF+ENARL IFETYCRIHQ 
Sbjct  297  NFDFDAAQKKLRECENVLMNDFFL-----------VSCRNEFMENARLLIFETYCRIHQT  345

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+  LA+KL+++ + AERWIVNLIR + LDAKIDS    VIM   +P++Y+Q+ID TK 
Sbjct  346  IDISTLAQKLDMDQDAAERWIVNLIRNAHLDAKIDSAANHVIMGTQNPSIYQQVIDKTKS  405

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            LS RT+ L + L ++ QS+ 
Sbjct  406  LSFRTHVLANNLDKYVQSEG  425



>ref|XP_005651050.1| eukaryotic translation initiation factor 3, subunit 6 [Coccomyxa 
subellipsoidea C-169]
 gb|EIE26506.1| eukaryotic translation initiation factor 3, subunit 6 [Coccomyxa 
subellipsoidea C-169]
Length=422

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 146/198 (74%), Gaps = 11/198 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QD+YLNA QT + HLLRYLA A +VNKRRR   KD I+VI+ E Y Y+DPIT+FL C++V
Sbjct  236  QDRYLNALQTTSQHLLRYLAAAVVVNKRRRNTMKDLIRVIEQESYEYSDPITQFLECLFV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
             YDF+ AQ K++ECEEV+ ND FL             L+DEF+ENARLFIFETYCRIHQ 
Sbjct  296  RYDFEGAQVKLRECEEVLENDYFLA-----------ALKDEFVENARLFIFETYCRIHQC  344

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA KLN++ E AE+WIVNLIR ++L+AKIDS+ GTV+M    P+ YEQ+++  KG
Sbjct  345  IDLRMLAGKLNMDAEAAEKWIVNLIRHARLNAKIDSQAGTVVMGMQFPSAYEQVMEKAKG  404

Query  211  LSGRTYKLVSQLLEHAQS  158
            LS RT+ L + ++   Q+
Sbjct  405  LSQRTFVLANLVVGAPQT  422



>ref|XP_001636266.1| predicted protein [Nematostella vectensis]
 sp|A7RWP6.1|EIF3E_NEMVE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Nematostella vectensis]
 gb|EDO44203.1| predicted protein [Nematostella vectensis]
Length=448

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 141/192 (73%), Gaps = 11/192 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q +YLNA QT  PH+LRYL TA I NKRRRP  KD +KVIQ E Y+Y DPITEFL C+YV
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKRRRPVLKDLVKVIQQESYTYRDPITEFLECLYV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD AQ+K++ECE V+LND FL           V  RD+F+ENARLFIFET+CRIHQ 
Sbjct  300  NFDFDGAQKKLRECETVLLNDFFL-----------VACRDDFIENARLFIFETFCRIHQC  348

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LAEKLN+  E+AERWIVNLIR +KLDAKIDS+ G V+M    P+VY+Q+I+ TK 
Sbjct  349  ISISMLAEKLNMTPEEAERWIVNLIRNAKLDAKIDSKLGHVVMGVQAPSVYQQVIEKTKN  408

Query  211  LSGRTYKLVSQL  176
            L  +T  L   +
Sbjct  409  LQYKTQVLAGNI  420



>ref|XP_002503313.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64571.1| predicted protein [Micromonas sp. RCC299]
Length=428

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 145/198 (73%), Gaps = 13/198 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++Y+ + Q  APHLLRYLA A I NKRRR   KD ++++Q EQYS  DPITEFL C++V
Sbjct  241  QERYMQSIQAEAPHLLRYLAAAVITNKRRRSMLKDLVRILQNEQYS--DPITEFLVCLFV  298

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            +YDF+AAQQK+ +C+EV+ ND FL           V  R+EF ENARLFIFETYCRIHQ 
Sbjct  299  DYDFEAAQQKLAQCDEVLANDFFL-----------VGCREEFNENARLFIFETYCRIHQC  347

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+  LA KLN++ + AERWIVNLIR++KL+AKIDSE GTV+M    P+++E +++ TK 
Sbjct  348  IDINQLASKLNMDRDSAERWIVNLIRSTKLNAKIDSEAGTVVMGSEAPSIHELVVEKTKA  407

Query  211  LSGRTYKLVSQLLEHAQS  158
            ++G+TY L   +L + Q 
Sbjct  408  ITGKTYALTHAVLSNTQG  425



>ref|XP_002609740.1| hypothetical protein BRAFLDRAFT_114473 [Branchiostoma floridae]
 gb|EEN65750.1| hypothetical protein BRAFLDRAFT_114473 [Branchiostoma floridae]
Length=436

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 139/192 (72%), Gaps = 11/192 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYL TA I NKRRR   KD +KVIQ E Y+Y DPITEFL C+YV
Sbjct  240  QPSYLNAIQTMCPHILRYLTTAVICNKRRRTVLKDLVKVIQQESYTYQDPITEFLECLYV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD AQ+K++ECE V++ND FL           V   +EF+ENARLFIFET+CRIHQ 
Sbjct  300  NFDFDGAQKKLRECETVLVNDFFL-----------VACLEEFIENARLFIFETFCRIHQC  348

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LAEKLN+  ++AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ TKG
Sbjct  349  ISISMLAEKLNMTPDEAERWIVNLIRNARLDAKIDSKLGHVVMGTQAISPYQQVIEKTKG  408

Query  211  LSGRTYKLVSQL  176
            L+ R+  L+  L
Sbjct  409  LAFRSQMLLHNL  420



>ref|XP_002735030.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Saccoglossus kowalevskii]
Length=446

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 143/201 (71%), Gaps = 11/201 (5%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYL TA I NKRRR   KD +KVIQ E Y+Y DPITEFL C+YV
Sbjct  240  QPPYLNAIQTLCPHILRYLTTAVITNKRRRTVLKDLVKVIQQESYTYRDPITEFLECLYV  299

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD AQQK++ECE V++ND FL           V   D+F+ENARLFIFET+CRIHQ 
Sbjct  300  NFDFDGAQQKLRECETVLVNDFFL-----------VACLDDFIENARLFIFETFCRIHQC  348

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LAEKLN++ ++AE+WIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ TKG
Sbjct  349  ISINMLAEKLNMSPDEAEKWIVNLIRNARLDAKIDSKQGHVVMGTQAVSPYQQVIEKTKG  408

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            LS ++  +   + +   ++ Q
Sbjct  409  LSFKSINMAMNIEKREAAKQQ  429



>gb|ELT88021.1| hypothetical protein CAPTEDRAFT_159549 [Capitella teleta]
Length=439

 Score =   221 bits (563),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 138/189 (73%), Gaps = 11/189 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYL TA I NKRRR   KD +KVIQ E Y+Y DPITEFL C+YV
Sbjct  241  QPLYLNAIQTMCPHVLRYLTTAVITNKRRRTVLKDLVKVIQQESYTYKDPITEFLECLYV  300

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            ++DFD AQQK++ECE V++ND FL             LRD F+ENARLFIFET+CRIHQ 
Sbjct  301  HFDFDGAQQKLRECETVLVNDFFL----------VACLRD-FIENARLFIFETFCRIHQC  349

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LA+KLN+  E+AERWIVNLIR ++LDA+IDS+ G V+M     + Y+Q+I+ TKG
Sbjct  350  ISITMLADKLNMGEEEAERWIVNLIRNARLDARIDSKLGHVVMGTQAVSPYQQVIEKTKG  409

Query  211  LSGRTYKLV  185
            L+ R+  LV
Sbjct  410  LAFRSQMLV  418



>ref|XP_007103493.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Physeter catodon]
Length=219

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 145/206 (70%), Gaps = 18/206 (9%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLACV  578
            D YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C+
Sbjct  14   DWYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECL  73

Query  577  YVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIH  398
            YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRIH
Sbjct  74   YVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRIH  122

Query  397  QRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHT  218
            Q I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ T
Sbjct  123  QCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKT  182

Query  217  KGLSGRTYKLV----SQLLEHAQSQA  152
            K LS R+  L      +L ++++S+A
Sbjct  183  KSLSFRSQMLAMNIEKKLNQNSRSEA  208



>ref|XP_002161128.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Hydra vulgaris]
Length=398

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 139/202 (69%), Gaps = 11/202 (5%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYL TA I NKRR+   KD +KVIQ E Y+Y DPITEFL C+ V
Sbjct  194  QSSYLNAIQTTCPHILRYLTTAVITNKRRKQILKDLVKVIQQESYTYRDPITEFLECLLV  253

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD AQ+K+ ECE V+LND FL           +   D+F+ENARLFIFET+CRIHQ 
Sbjct  254  NFDFDGAQKKLLECETVLLNDFFL-----------IACLDDFIENARLFIFETFCRIHQC  302

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LA+KLN++ E AERWIVNLIR ++LDAKIDS+ G V+M      V++Q+I+ TKG
Sbjct  303  ISISMLADKLNMSPEAAERWIVNLIRNARLDAKIDSKQGHVVMGTQAAAVHQQVIERTKG  362

Query  211  LSGRTYKLVSQLLEHAQSQAQP  146
            +  RT  +   + +   S+  P
Sbjct  363  IMYRTQTVAQSIDKKLASKLGP  384



>ref|XP_004349023.1| eukaryotic translation initiation factor 3 subunit E [Capsaspora 
owczarzaki ATCC 30864]
Length=432

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 141/201 (70%), Gaps = 12/201 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYLATA I NKRRRP  KD +++IQ E Y+Y DPIT+ L C+YV
Sbjct  236  QTPYLNAIQTTCPHMLRYLATAVITNKRRRPMLKDLVRIIQQESYTYRDPITQLLECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFDAAQ  ++ECE+V+ ND FL             L D+F+E+AR+ IFETYCRIH+ 
Sbjct  296  NYDFDAAQLVLRECEKVVNNDFFL-----------CSLLDDFIESARMLIFETYCRIHEV  344

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I +G+LAEKLN+  +DAERWIVNLIR +K+DAKIDS+   V+M     N+++ +I+ T  
Sbjct  345  ISIGLLAEKLNMTADDAERWIVNLIRNAKMDAKIDSQLSHVVMGAPTKNIHQDIIEKTNI  404

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            LS R  +L+S  L+   S +Q
Sbjct  405  LSFRA-QLLSSALDKLPSDSQ  424



>gb|EFX82001.1| hypothetical protein DAPPUDRAFT_302804 [Daphnia pulex]
Length=440

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 143/193 (74%), Gaps = 12/193 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKR-RRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            Q++YLNA +T  PH+LRYL TA I+NK+ RR   KD +KVIQ E Y+Y DPITEF+  +Y
Sbjct  240  QNQYLNAIETMCPHILRYLTTAVIINKQNRRTMLKDLVKVIQQESYAYRDPITEFIEHLY  299

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VN+DFDAAQQK+++C++V+LND FL           V + D+F+ENARL IFET+CRIHQ
Sbjct  300  VNFDFDAAQQKLRQCKDVLLNDFFL-----------VAVLDDFIENARLMIFETFCRIHQ  348

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
             I + +LAEKLN+  EDAERWIVNLIR ++LDAKIDS+ G V+M     + Y+QLI+ TK
Sbjct  349  CISIKMLAEKLNMTAEDAERWIVNLIRNARLDAKIDSQQGHVVMATQTVSPYQQLIEKTK  408

Query  214  GLSGRTYKLVSQL  176
             LS R+ KL + +
Sbjct  409  MLSVRSQKLAADI  421



>ref|XP_003058422.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56877.1| predicted protein [Micromonas pusilla CCMP1545]
Length=431

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 143/200 (72%), Gaps = 13/200 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q++Y+ A Q  APHLLRYLA A I NKRRR   KD ++++Q E YS  DPITEFL  ++V
Sbjct  241  QERYMQAIQAEAPHLLRYLAAAIITNKRRRSMLKDLVRILQCETYS--DPITEFLLKLFV  298

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
             YDFD AQ K+ EC+ V+ ND FL           V  +DEF ENARLFIFETYCRIHQR
Sbjct  299  EYDFDGAQTKLAECDVVLENDFFL-----------VGCKDEFNENARLFIFETYCRIHQR  347

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA+KL+++++ AERWIVNLIR++KL+AKIDSE GTV M     +V++ +++ TK 
Sbjct  348  IDIKMLADKLSMDHDSAERWIVNLIRSTKLNAKIDSEKGTVQMYDQAQSVHDMIVEKTKA  407

Query  211  LSGRTYKLVSQLLEHAQSQA  152
            L+ +TY L   +L + Q+QA
Sbjct  408  LTSKTYSLSHAVLSNTQAQA  427



>gb|KFP26814.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Colius striatus]
Length=246

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  40   QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  99

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  100  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  148

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  149  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  208

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  209  TKSLSFRSQML  219



>ref|XP_010205044.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E, partial [Colius striatus]
Length=252

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  46   QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  105

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  106  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  154

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  155  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  214

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  215  TKSLSFRSQML  225



>ref|XP_008329343.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like, partial [Cynoglossus semilaevis]
Length=196

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 135/188 (72%), Gaps = 14/188 (7%)
 Frame = -2

Query  742  YLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C+YV
Sbjct  1    YLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLYV  60

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            N+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRIHQ 
Sbjct  61   NFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRIHQC  109

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ TK 
Sbjct  110  ISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKS  169

Query  211  LSGRTYKL  188
            LS R   L
Sbjct  170  LSFRCQML  177



>gb|KJE91084.1| eukaryotic translation initiation factor 3 subunit E [Capsaspora 
owczarzaki ATCC 30864]
Length=448

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 141/201 (70%), Gaps = 12/201 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            Q  YLNA QT  PH+LRYLATA I NKRRRP  KD +++IQ E Y+Y DPIT+ L C+YV
Sbjct  252  QTPYLNAIQTTCPHMLRYLATAVITNKRRRPMLKDLVRIIQQESYTYRDPITQLLECLYV  311

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDFDAAQ  ++ECE+V+ ND FL             L D+F+E+AR+ IFETYCRIH+ 
Sbjct  312  NYDFDAAQLVLRECEKVVNNDFFL-----------CSLLDDFIESARMLIFETYCRIHEV  360

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            I +G+LAEKLN+  +DAERWIVNLIR +K+DAKIDS+   V+M     N+++ +I+ T  
Sbjct  361  ISIGLLAEKLNMTADDAERWIVNLIRNAKMDAKIDSQLSHVVMGAPTKNIHQDIIEKTNI  420

Query  211  LSGRTYKLVSQLLEHAQSQAQ  149
            LS R  +L+S  L+   S +Q
Sbjct  421  LSFRA-QLLSSALDKLPSDSQ  440



>ref|XP_009699963.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E, partial [Cariama cristata]
 gb|KFP58857.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Cariama cristata]
Length=288

 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 138/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  82   QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  141

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  142  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  190

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  191  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  250

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  251  TKSLSFRSQML  261



>gb|EGW09196.1| Eukaryotic translation initiation factor 3 subunit E [Cricetulus 
griseus]
Length=263

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 145/205 (71%), Gaps = 18/205 (9%)
 Frame = -2

Query  745  KYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C+Y
Sbjct  59   RYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY  118

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRIHQ
Sbjct  119  VNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRIHQ  167

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
             I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ TK
Sbjct  168  CISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK  227

Query  214  GLSGRTYKLV----SQLLEHAQSQA  152
             LS R+  L      +L ++++S+A
Sbjct  228  SLSFRSQMLAMNIEKKLNQNSRSEA  252



>ref|XP_010738667.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Larimichthys crocea]
Length=445

 Score =   217 bits (553),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 146/207 (71%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ EDAERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSPEDAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QAQ T+
Sbjct  409  TKSLSFRSQMLAMNI---EKKQAQSTK  432



>ref|XP_011454873.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Crassostrea gigas]
 gb|EKC40779.1| Eukaryotic translation initiation factor 3 subunit E [Crassostrea 
gigas]
Length=438

 Score =   217 bits (553),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 136/191 (71%), Gaps = 12/191 (6%)
 Frame = -2

Query  757  VNQDKYLNAXQTNAPHLLRYLATAFIVNK-RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            + Q  YLNA QT   H+LRYL TA I NK RRR   KD +KVIQ E Y Y DPITEF+ C
Sbjct  238  IYQPLYLNAIQTTCSHILRYLTTAVITNKSRRRTVMKDLVKVIQQESYKYKDPITEFVEC  297

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQQK++ECEEV++ND FL           V   D+F+ENARL IFET+CRI
Sbjct  298  LYVNFDFDGAQQKLRECEEVLVNDFFL-----------VACLDDFIENARLLIFETFCRI  346

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            H+ I + +LAEKLN+  EDAERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  347  HECISINMLAEKLNMTEEDAERWIVNLIRNARLDAKIDSKLGHVVMGAQAVSPYQQVIEK  406

Query  220  TKGLSGRTYKL  188
            TKGL+ R+  L
Sbjct  407  TKGLAFRSQML  417



>ref|NP_957133.1| eukaryotic translation initiation factor 3 subunit E-A [Danio 
rerio]
 sp|Q6DRI1.2|EI3EA_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-A; Short=eIF3e-A; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-A [Danio rerio]
 gb|AAH61454.1| Eukaryotic translation initiation factor 3, subunit E, a [Danio 
rerio]
Length=446

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQA  152
            TK LS R+ ++++  +E  QS A
Sbjct  409  TKSLSFRS-QMLAMNIEKKQSNA  430



>ref|XP_005924387.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like isoform X3 [Haplochromis burtoni]
Length=396

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  191  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  250

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  251  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  299

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  300  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  359

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QAQ +R
Sbjct  360  TKSLSFRSQMLAMNI---EKKQAQSSR  383



>gb|AAQ97773.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [Danio 
rerio]
Length=448

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  242  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  301

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  302  LYVNFDFDSAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  350

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  351  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  410

Query  220  TKGLSGRTYKLVSQLLEHAQSQA  152
            TK LS R+ ++++  +E  QS A
Sbjct  411  TKSLSFRS-QMLAMNIEKKQSNA  432



>gb|AAT68096.1| eukaryotic translation initiation factor 3 subunit 6 [Danio rerio]
Length=446

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQHESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQA  152
            TK LS R+ ++++  +E  QS A
Sbjct  409  TKSLSFRS-QMLAMNIEKKQSNA  430



>gb|ACO13187.1| Eukaryotic translation initiation factor 3 subunit E [Lepeophtheirus 
salmonis]
Length=447

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 140/204 (69%), Gaps = 12/204 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKR-RRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            Q +YLNA QT  P +LRYL+TA IVNK  RR   KD +KVIQ E Y+Y DPIT F+  +Y
Sbjct  249  QKQYLNAIQTTCPWILRYLSTAVIVNKSSRRSIMKDLVKVIQEESYAYRDPITSFIEDLY  308

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VN+DFD AQQK++ECE+V++ND FL           V   DEF+EN+RL IFET+CRIHQ
Sbjct  309  VNFDFDGAQQKLRECEKVLVNDFFL-----------VSCLDEFIENSRLMIFETFCRIHQ  357

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
             I + +LAEKLN+  EDAERWIVNLIR +KLDAKIDS+ G V+M     + Y+QLID TK
Sbjct  358  CITIDMLAEKLNMKPEDAERWIVNLIRNAKLDAKIDSQMGHVVMGKQTVSPYQQLIDKTK  417

Query  214  GLSGRTYKLVSQLLEHAQSQAQPT  143
             LS RT  L   L +      QP+
Sbjct  418  VLSLRTLTLQVNLEKKKIVHDQPS  441



>gb|AEB61133.1| eukaryotic translation initiation factor 3 subunit E-like protein, 
partial [Equus caballus]
Length=321

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  115  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  174

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  175  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  223

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  224  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  283

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  284  TKSLSFRSQMLAMNIEKKLNQNSRSEA  310



>ref|XP_001702351.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDO96971.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=428

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 138/191 (72%), Gaps = 12/191 (6%)
 Frame = -2

Query  742  YLNAXQTNAPHLLRYLATAFIVNKRR-RPQFKDFIKVIQPEQYSYADPITEFLACVYVNY  566
            Y++A Q NAPHLLRY+A A ++NK++ R   K+ I+ IQ E Y Y+DP+T+FL CV+V+Y
Sbjct  244  YISAIQINAPHLLRYVAVAVVINKKKQRSVLKELIRAIQQESYEYSDPVTQFLECVFVHY  303

Query  565  DFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRID  386
            DFD AQQK+KECE V+ ND FL              +DEF+ENARLFIFETYCRIHQ I 
Sbjct  304  DFDGAQQKLKECEAVLDNDFFLA-----------AYKDEFIENARLFIFETYCRIHQSIS  352

Query  385  MGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGLS  206
            + +LAE+L ++ E AE+WI NLI  +KL+AKIDS++GTV+M     +V+EQL+D  K LS
Sbjct  353  IALLAERLGMDQEAAEKWIANLILNAKLNAKIDSKSGTVVMGTQSQSVHEQLVDKAKMLS  412

Query  205  GRTYKLVSQLL  173
             RTY L + ++
Sbjct  413  VRTYVLANTVV  423



>ref|XP_007254559.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E-A-like [Astyanax mexicanus]
Length=452

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  247  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  306

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  307  LYVNFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  355

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  356  HQCISIGMLADKLNMSPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  415

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + L H      P
Sbjct  416  TKSLSFRSQMLAMNIEKKLSHNNRNETP  443



>gb|KFQ03898.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Haliaeetus albicilla]
 gb|KFQ73755.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Phaethon lepturus]
Length=338

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  132  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  191

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  192  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  240

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  241  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  300

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  301  TKSLSFRSQMLA  312



>ref|XP_009917129.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E, partial [Haliaeetus albicilla]
 ref|XP_010284115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E, partial [Phaethon lepturus]
Length=337

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  131  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  190

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  191  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  239

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  240  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  299

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  300  TKSLSFRSQMLA  311



>ref|XP_004566824.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Maylandia zebra]
 ref|XP_005741381.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Pundamilia nyererei]
Length=445

 Score =   216 bits (549),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QAQ +R
Sbjct  409  TKSLSFRSQMLAMNI---EKKQAQSSR  432



>ref|XP_004580869.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ochotona princeps]
Length=329

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  123  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  182

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  183  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  231

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  232  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  291

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  292  TKSLSFRSQMLAMNIEKKLNQNSRSEA  318



>ref|XP_005924386.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like isoform X2 [Haplochromis burtoni]
Length=445

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QAQ +R
Sbjct  409  TKSLSFRSQMLAMNI---EKKQAQSSR  432



>ref|XP_005924385.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like isoform X1 [Haplochromis burtoni]
Length=460

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  255  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  314

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  315  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  363

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  364  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  423

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QAQ +R
Sbjct  424  TKSLSFRSQMLAMNI---EKKQAQSSR  447



>ref|XP_009961792.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tyto alba]
 ref|XP_010172716.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Caprimulgus carolinensis]
 ref|XP_010124411.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chlamydotis macqueenii]
Length=352

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  146  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  205

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  206  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  254

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  255  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  314

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  315  TKSLSFRSQMLA  326



>ref|XP_007932963.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Orycteropus afer afer]
Length=334

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  128  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  187

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  188  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  236

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  237  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  296

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  297  TKSLSFRSQMLAMNIEKKLNQNSRSEA  323



>ref|XP_005894306.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Bos mutus]
Length=334

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  128  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  187

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  188  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  236

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  237  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  296

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  297  TKSLSFRSQMLAMNIEKKLNQNSRSEA  323



>gb|ELR57436.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Bos mutus]
Length=338

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  132  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  191

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  192  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  240

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  241  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  300

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  301  TKSLSFRSQMLAMNIEKKLNQNSRSEA  327



>ref|XP_008430171.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Poecilia reticulata]
Length=445

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 146/207 (71%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSAEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  LV  +    + QA  +R
Sbjct  409  TKSLSFRSQMLVMNI---EKKQAASSR  432



>ref|XP_006794910.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Neolamprologus brichardi]
Length=445

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQA  152
            TK LS R+ ++++  +E  Q+Q+
Sbjct  409  TKSLSFRS-QMLAMNIEKKQAQS  430



>ref|XP_003453516.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Oreochromis niloticus]
Length=445

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 147/203 (72%), Gaps = 15/203 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQA  152
            TK LS R+ ++++  +E  Q+Q+
Sbjct  409  TKSLSFRS-QMLAMNIEKKQAQS  430



>gb|KFP44698.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Chlamydotis macqueenii]
 gb|KFV42106.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Tyto alba]
 gb|KFZ64574.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Caprimulgus carolinensis]
Length=377

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  171  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  230

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  231  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  279

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  280  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  339

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  340  TKSLSFRSQMLA  351



>ref|XP_005706874.1| translation initiation factor eIF-3 subunit 6 [Galdieria sulphuraria]
 gb|EME30354.1| translation initiation factor eIF-3 subunit 6 [Galdieria sulphuraria]
Length=455

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 133/185 (72%), Gaps = 11/185 (6%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYV  572
            QDKYLN  QTN PH+LRYL++A I N +RR   K+ +K++Q E ++Y DPITEF+ C+YV
Sbjct  236  QDKYLNTIQTNCPHILRYLSSAVITNTKRRHMLKELVKIVQQESHAYHDPITEFVECLYV  295

Query  571  NYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQR  392
            NYDF+ AQ  +++CE  + +D FL           +   DEF+ENARLF+FE YCRIHQ 
Sbjct  296  NYDFEGAQDLLQKCETTLKHDFFL-----------IGTLDEFVENARLFVFEIYCRIHQV  344

Query  391  IDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKG  212
            ID+ +LA KLN++ E AERWIVNLIR ++LDAK+DS+   VIM    P+VYEQ++D TKG
Sbjct  345  IDLNMLAAKLNMDRESAERWIVNLIRNARLDAKVDSQASRVIMGVKTPSVYEQIVDSTKG  404

Query  211  LSGRT  197
            L  RT
Sbjct  405  LIIRT  409



>gb|ACQ58587.1| Eukaryotic translation initiation factor 3 subunit E [Anoplopoma 
fimbria]
Length=445

 Score =   215 bits (547),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 146/206 (71%), Gaps = 15/206 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAIITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  EDAERWIVN IR ++LDAKIDS+ G  +M     + Y+Q+I+ 
Sbjct  349  HQCISINMLADKLNMTPEDAERWIVNFIRNARLDAKIDSKLGHAVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPT  143
            TK LS R+ ++++  +E  Q+Q+  T
Sbjct  409  TKSLSFRS-QILAMNIEKKQAQSTKT  433



>ref|XP_008283264.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Stegastes partitus]
Length=445

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 144/207 (70%), Gaps = 17/207 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPTR  140
            TK LS R+  L   +    + QA  TR
Sbjct  409  TKSLSFRSQMLAMNI---EKKQAHSTR  432



>ref|XP_007563282.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Poecilia formosa]
Length=445

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 140/192 (73%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSAEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLV  185
            TK LS R+  LV
Sbjct  409  TKSLSFRSQMLV  420



>emb|CDQ64768.1| unnamed protein product [Oncorhynchus mykiss]
Length=445

 Score =   214 bits (546),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + HA     P
Sbjct  409  TKSLSFRSQMLAMNIEKKMAHASRNETP  436



>ref|XP_007563199.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Poecilia formosa]
Length=454

 Score =   215 bits (547),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 140/192 (73%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  249  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  308

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  309  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  357

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  358  HQCISISMLADKLNMSAEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  417

Query  220  TKGLSGRTYKLV  185
            TK LS R+  LV
Sbjct  418  TKSLSFRSQMLV  429



>ref|NP_001135167.1| eukaryotic translation initiation factor 3 subunit E [Salmo salar]
 sp|B5DGH9.1|EIF3E_SALSA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Salmo salar]
 gb|ACH70853.1| eukaryotic translation initiation factor 3, subunit E, a [Salmo 
salar]
Length=445

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + HA     P
Sbjct  409  TKSLSFRSQMLAMNIEKKMAHASRNETP  436



>ref|XP_007075897.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Panthera tigris altaica]
Length=396

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 148/209 (71%), Gaps = 18/209 (9%)
 Frame = -2

Query  757  VNQDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFL  587
            ++Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+
Sbjct  188  LSQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFV  247

Query  586  ACVYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYC  407
             C+YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+C
Sbjct  248  ECLYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFC  296

Query  406  RIHQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLI  227
            RIHQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I
Sbjct  297  RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVI  356

Query  226  DHTKGLSGRTYKLV----SQLLEHAQSQA  152
            + TK LS R+  L      +L ++++S+A
Sbjct  357  EKTKSLSFRSQMLAMNIEKKLNQNSRSEA  385



>ref|XP_007543240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X2 [Poecilia formosa]
Length=407

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 140/196 (71%), Gaps = 14/196 (7%)
 Frame = -2

Query  754  NQDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLA  584
            N  +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ 
Sbjct  200  NSPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVE  259

Query  583  CVYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCR  404
            C+YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CR
Sbjct  260  CLYVNFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCR  308

Query  403  IHQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLID  224
            IHQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+
Sbjct  309  IHQCISISMLADKLNMSPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIE  368

Query  223  HTKGLSGRTYKLVSQL  176
             TK LS R+  L   +
Sbjct  369  KTKSLSFRSQMLAMNM  384



>ref|NP_001006349.1| eukaryotic translation initiation factor 3 subunit E [Gallus 
gallus]
 sp|Q5ZLA5.1|EIF3E_CHICK RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Gallus gallus]
 emb|CAG31488.1| hypothetical protein RCJMB04_6o19 [Gallus gallus]
Length=445

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DSE G V+M     + Y+Q+I+ 
Sbjct  348  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSELGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>gb|KFP91969.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Apaloderma vittatum]
Length=404

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  210  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  269

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  270  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  318

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  319  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  378

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  379  TKSLSFRSQMLA  390



>ref|XP_009636687.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Egretta garzetta]
Length=413

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_008640869.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X3 [Corvus brachyrhynchos]
 ref|XP_008940951.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Merops nubicus]
 ref|XP_009076313.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Acanthisitta chloris]
 ref|XP_009321381.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pygoscelis adeliae]
 ref|XP_009487118.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pelecanus crispus]
 ref|XP_009465769.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Nipponia nippon]
 ref|XP_009501058.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Phalacrocorax carbo]
 ref|XP_009560338.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Cuculus canorus]
 ref|XP_009581137.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Fulmarus glacialis]
 ref|XP_009672964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Struthio camelus australis]
 ref|XP_009636688.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Egretta garzetta]
 ref|XP_009811482.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Gavia stellata]
 ref|XP_009874142.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Apaloderma vittatum]
 ref|XP_009942265.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Opisthocomus hoazin]
 ref|XP_009945612.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Leptosomus discolor]
 ref|XP_009981088.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Tauraco erythrolophus]
 ref|XP_010004776.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Chaetura pelagica]
 ref|XP_010149414.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Eurypyga helias]
 ref|XP_010224189.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tinamus guttatus]
 ref|XP_010303999.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Balearica regulorum gibbericeps]
 ref|XP_010707518.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Meleagris gallopavo]
Length=396

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  190  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  249

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  250  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  298

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  299  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  358

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  359  TKSLSFRSQMLA  370



>ref|XP_004569303.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Maylandia zebra]
 ref|XP_005739838.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Pundamilia nyererei]
 ref|XP_005940978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Haplochromis burtoni]
Length=446

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + L H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKKLAHSSRNETP  436



>ref|XP_005431866.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Falco cherrug]
Length=413

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_009874141.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Apaloderma vittatum]
Length=413

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_008940950.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Merops nubicus]
Length=413

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_003447252.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Oreochromis niloticus]
Length=446

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + L H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKRLAHSNRNETP  436



>ref|XP_010303998.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Balearica regulorum gibbericeps]
Length=413

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_009501057.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Phalacrocorax carbo]
Length=413

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_009945610.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Leptosomus discolor]
Length=413

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_009581136.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Fulmarus glacialis]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_005799084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-A-like [Xiphophorus maculatus]
Length=445

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 140/192 (73%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  408

Query  220  TKGLSGRTYKLV  185
            TK LS R+  LV
Sbjct  409  TKSLSFRSQMLV  420



>ref|XP_009942264.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Opisthocomus hoazin]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_009487117.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pelecanus crispus]
 ref|XP_009465761.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Nipponia nippon]
 ref|XP_009560337.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Cuculus canorus]
 ref|XP_009811474.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Gavia stellata]
 ref|XP_009981087.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Tauraco erythrolophus]
 ref|XP_010004775.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Chaetura pelagica]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_005479481.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Zonotrichia albicollis]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>gb|KFV47267.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Gavia stellata]
Length=423

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  217  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  276

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  277  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  325

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  326  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  385

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  386  TKSLSFRSQMLA  397



>gb|EMC86397.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Columba livia]
 gb|KFO12460.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Balearica regulorum gibbericeps]
 gb|KFO77013.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Cuculus canorus]
 gb|KFP15588.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Egretta garzetta]
 gb|KFP54756.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Cathartes aura]
 gb|KFP83589.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Acanthisitta chloris]
 gb|KFQ07375.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Leptosomus discolor]
 gb|KFQ19129.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Merops nubicus]
 gb|KFQ64290.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Pelecanus crispus]
 gb|KFQ87769.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Phoenicopterus ruber ruber]
 gb|KFQ91364.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Nipponia nippon]
 gb|KFR01575.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Opisthocomus hoazin]
 gb|KFU96299.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Chaetura pelagica]
 gb|KFV14540.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Tauraco erythrolophus]
 gb|KFW04762.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Eurypyga helias]
 gb|KFW66459.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Pygoscelis adeliae]
 gb|KFW96348.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Phalacrocorax carbo]
Length=416

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  210  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  269

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  270  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  318

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  319  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  378

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  379  TKSLSFRSQMLA  390



>ref|XP_010149413.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Eurypyga helias]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>gb|KFV81170.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Struthio camelus australis]
 gb|KGL84970.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Tinamus guttatus]
Length=415

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  209  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  268

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  269  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  317

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  318  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  377

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  378  TKSLSFRSQMLA  389



>ref|XP_007670472.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ornithorhynchus anatinus]
Length=396

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  190  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  249

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  250  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  298

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  299  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  358

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  359  TKSLSFRSQMLAMNIEKKLNQNSRSEA  385



>gb|EDL08754.1| mCG16052, isoform CRA_b [Mus musculus]
 gb|EDM16319.1| rCG59689, isoform CRA_b [Rattus norvegicus]
Length=410

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  204  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  263

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  264  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  312

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  313  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  372

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  373  TKSLSFRSQMLAMNIEKKLNQNSRSEA  399



>ref|XP_002199156.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Taeniopygia guttata]
Length=413

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  207  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  266

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  267  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  315

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  316  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  375

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  376  TKSLSFRSQMLA  387



>ref|XP_005170108.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X1 [Danio rerio]
Length=446

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL+TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLSTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKKISHSNRNETP  436



>sp|Q1LUA8.2|EI3EB_DANRE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-B; Short=eIF3e-B; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-B [Danio rerio]
Length=446

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL+TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLSTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKKISHSNRNETP  436



>ref|NP_001279788.1| eukaryotic translation initiation factor 3, subunit E [Callorhinchus 
milii]
 gb|AFK11304.1| eukaryotic translation initiation factor 3 subunit E-A [Callorhinchus 
milii]
Length=445

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LAEKLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLAEKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  409  TKSLSFRSQML  419



>ref|XP_003821799.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pan paniscus]
 ref|XP_003903118.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Papio anubis]
 ref|XP_003938640.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Saimiri boliviensis boliviensis]
 ref|XP_004047480.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 2 [Gorilla gorilla gorilla]
 ref|XP_006943412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Felis catus]
 ref|XP_007999544.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Chlorocebus sabaeus]
 ref|XP_007999545.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Chlorocebus sabaeus]
 ref|XP_008981604.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Callithrix jacchus]
 ref|XP_009211747.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Papio anubis]
 ref|XP_009211748.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Papio anubis]
 ref|XP_009242300.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pongo abelii]
 ref|XP_010369114.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Rhinopithecus roxellana]
 pir||I75615 mammary tumor integration site 6 oncogene protein - mouse
 dbj|BAE00293.1| unnamed protein product [Macaca fascicularis]
 gb|EAW91919.1| eukaryotic translation initiation factor 3, subunit 6 48kDa, 
isoform CRA_b [Homo sapiens]
 dbj|BAG54018.1| unnamed protein product [Homo sapiens]
 gb|AIC63064.1| EIF3E, partial [synthetic construct]
Length=396

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  190  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  249

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  250  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  298

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  299  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  358

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  359  TKSLSFRSQMLAMNIEKKLNQNSRSEA  385



>ref|XP_003256153.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 2 [Nomascus leucogenys]
Length=396

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  190  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  249

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  250  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  298

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  299  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  358

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  359  TKSLSFRSQMLAMNIEKKLNQNSRSEA  385



>ref|XP_005715226.1| Translation initiation factor eIF3, subunit E [Chondrus crispus]
 emb|CDF35407.1| Translation initiation factor eIF3, subunit E [Chondrus crispus]
Length=450

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 131/180 (73%), Gaps = 11/180 (6%)
 Frame = -2

Query  748  DKYLNAXQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQPEQYSYADPITEFLACVYVN  569
            DKYLN  QTN PH+LRYL TA I NKRRR   KD +KVIQ E Y+Y+DPITEF+ C+YVN
Sbjct  244  DKYLNTIQTNCPHILRYLTTAVITNKRRRNVMKDLVKVIQQESYAYSDPITEFVQCLYVN  303

Query  568  YDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQRI  389
            +DF+ AQ  +++CE+ +  D FL K           + D+FLE+AR  IFETYCRIHQ I
Sbjct  304  FDFEGAQDMLQKCEDTLKRDYFLYK-----------MLDDFLEDARRTIFETYCRIHQVI  352

Query  388  DMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTKGL  209
            D+G+LA KLN+   DAE+W+VNLIR ++LDAKIDS+   VIM  T P+VYEQ++D TK L
Sbjct  353  DIGMLASKLNMVQYDAEKWVVNLIRHARLDAKIDSQANQVIMGVTVPSVYEQVVDSTKNL  412



>ref|XP_004697736.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Echinops telfairi]
Length=373

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  146  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  205

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  206  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  254

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  255  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  314

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  315  TKSLSFRSQMLA  326



>emb|CDQ75537.1| unnamed protein product [Oncorhynchus mykiss]
Length=450

 Score =   213 bits (543),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (71%), Gaps = 17/202 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHA  164
            TK LS R+  L   + + + HA
Sbjct  409  TKSLSFRSQMLAMNIEKKMAHA  430



>gb|ACO08955.1| Eukaryotic translation initiation factor 3 subunit 6 [Osmerus 
mordax]
Length=445

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + H+     P
Sbjct  409  TKNLSFRSQMLAMNIEKKISHSNRNETP  436



>ref|XP_007188837.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Balaenoptera acutorostrata scammoni]
Length=445

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 148/209 (71%), Gaps = 18/209 (9%)
 Frame = -2

Query  757  VNQDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFL  587
            ++Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+
Sbjct  237  LSQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFV  296

Query  586  ACVYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYC  407
             C+YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+C
Sbjct  297  ECLYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFC  345

Query  406  RIHQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLI  227
            RIHQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I
Sbjct  346  RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVI  405

Query  226  DHTKGLSGRTYKLV----SQLLEHAQSQA  152
            + TK LS R+  L      +L ++++S+A
Sbjct  406  EKTKSLSFRSQTLAMNIEKKLNQNSRSEA  434



>emb|CAF92057.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=446

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 143/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + H+     P
Sbjct  409  TKSLSFRSQMLTLNIEKKIAHSSRNETP  436



>ref|XP_007543239.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B isoform X1 [Poecilia formosa]
Length=446

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 140/195 (72%), Gaps = 14/195 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQRKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQL  176
            TK LS R+  L   +
Sbjct  409  TKSLSFRSQMLAMNM  423



>ref|XP_006635626.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B-like [Lepisosteus oculatus]
Length=446

 Score =   213 bits (541),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 143/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + L H      P
Sbjct  409  TKSLSFRSQMLAMNIEKKLNHNNRNEAP  436



>ref|XP_005507309.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Columba livia]
Length=462

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  256  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  315

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  316  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  364

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  365  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  424

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  425  TKSLSFRSQMLA  436



>ref|XP_010903799.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E [Esox lucius]
Length=520

 Score =   214 bits (546),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + HA     P
Sbjct  409  TKSLSFRSQMLAMNIEKKMAHANRNETP  436



>ref|XP_010575299.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Haliaeetus leucocephalus]
Length=462

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  256  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  315

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  316  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  364

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  365  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  424

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  425  TKSLSFRSQMLA  436



>ref|XP_003965946.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Takifugu rubripes]
Length=445

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 148/206 (72%), Gaps = 15/206 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN++ E+AERWIVNLI  ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMSPEEAERWIVNLICNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKLVSQLLEHAQSQAQPT  143
            TK LS R+ ++++  +E  Q+Q+  T
Sbjct  409  TKSLSFRS-QVLAMNIEKKQAQSTKT  433



>ref|XP_007075896.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Panthera tigris altaica]
Length=445

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/193 (55%), Positives = 139/193 (72%), Gaps = 14/193 (7%)
 Frame = -2

Query  757  VNQDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFL  587
            ++Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+
Sbjct  237  LSQPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFV  296

Query  586  ACVYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYC  407
             C+YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+C
Sbjct  297  ECLYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFC  345

Query  406  RIHQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLI  227
            RIHQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I
Sbjct  346  RIHQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVI  405

Query  226  DHTKGLSGRTYKL  188
            + TK LS R+  L
Sbjct  406  EKTKSLSFRSQML  418



>ref|XP_005042453.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ficedula albicollis]
 ref|XP_005423539.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Geospiza fortis]
 ref|XP_005517019.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pseudopodoces humilis]
 ref|XP_008640867.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Corvus brachyrhynchos]
 ref|XP_008921430.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Manacus vitellinus]
 ref|XP_009085840.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Serinus canaria]
 ref|XP_010403156.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Corvus cornix cornix]
 gb|KFO65885.1| Eukaryotic translation initiation factor 3 subunit E [Corvus 
brachyrhynchos]
 gb|KFW80352.1| Eukaryotic translation initiation factor 3 subunit E [Manacus 
vitellinus]
Length=445

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>ref|XP_005150980.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Melopsittacus undulatus]
 ref|XP_005231024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Falco peregrinus]
 ref|XP_005507310.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Columba livia]
 ref|XP_008500911.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Calypte anna]
 ref|XP_009280240.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Aptenodytes forsteri]
 ref|XP_009280241.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Aptenodytes forsteri]
 ref|XP_009896494.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Picoides pubescens]
 ref|XP_009890101.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Charadrius vociferus]
 ref|XP_010140722.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Buceros rhinoceros silvestris]
 ref|XP_010184634.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mesitornis unicolor]
 ref|XP_010575300.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Haliaeetus leucocephalus]
 gb|KFM09320.1| Eukaryotic translation initiation factor 3 subunit E [Aptenodytes 
forsteri]
 gb|KFO93656.1| Eukaryotic translation initiation factor 3 subunit E [Buceros 
rhinoceros silvestris]
 gb|KFP07708.1| Eukaryotic translation initiation factor 3 subunit E [Calypte 
anna]
 gb|KFQ37519.1| Eukaryotic translation initiation factor 3 subunit E [Mesitornis 
unicolor]
 gb|KFV65557.1| Eukaryotic translation initiation factor 3 subunit E [Picoides 
pubescens]
 gb|KGL98673.1| Eukaryotic translation initiation factor 3 subunit E [Charadrius 
vociferus]
Length=445

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>ref|XP_008640866.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Corvus brachyrhynchos]
 ref|XP_008921429.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Manacus vitellinus]
Length=462

 Score =   213 bits (542),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  256  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYRDPITEFVEC  315

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  316  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  364

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  365  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  424

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  425  TKSLSFRSQMLA  436



>ref|XP_005613308.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Equus caballus]
Length=460

 Score =   213 bits (542),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQAQPT  143
            TK LS R+  L      +L ++++S+ + T
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEVRTT  437



>ref|XP_001369627.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Monodelphis domestica]
Length=445

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 136/188 (72%), Gaps = 14/188 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDIRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRT  197
            TK LS R+
Sbjct  408  TKSLSFRS  415



>ref|XP_004796181.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Mustela putorius furo]
Length=456

 Score =   213 bits (541),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 147/210 (70%), Gaps = 18/210 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQAQPT  143
            TK LS R+  L      +L ++++S+ + T
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEVRTT  437



>ref|XP_008291531.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-B [Stegastes partitus]
Length=446

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 144/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + + H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKRVAHSNRNETP  436



>ref|XP_006892391.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Elephantulus edwardii]
Length=445

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  408  TKSLSFRSQML  418



>ref|XP_004086680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Oryzias latipes]
Length=445

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNATSPYQQVIEK  408

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  409  TKSLSFRSQMLA  420



>gb|AAX29771.1| eukaryotic translation initiation factor 3 subunit 6 48kDa [synthetic 
construct]
 gb|AAX36929.1| eukaryotic translation initiation factor 3 subunit 6, partial 
[synthetic construct]
 gb|AAX42668.1| eukaryotic translation initiation factor 3 subunit 6, partial 
[synthetic construct]
Length=446

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>gb|AAH17887.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
Length=445

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>dbj|BAB27621.1| unnamed protein product [Mus musculus]
Length=422

 Score =   211 bits (538),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  408  TKSLSFRSQML  418



>gb|EFB25663.1| hypothetical protein PANDA_007264 [Ailuropoda melanoleuca]
Length=433

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>gb|ADO28016.1| eukaryotic translation initiation factor 3 subunit e-b [Ictalurus 
furcatus]
Length=446

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/208 (51%), Positives = 143/208 (69%), Gaps = 17/208 (8%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLN  QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNVIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CR+
Sbjct  300  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRV  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL---VSQLLEHAQSQAQP  146
            TK LS R+  L   + + L H+     P
Sbjct  409  TKSLSFRSQMLAMNIEKKLSHSNRNETP  436



>ref|XP_003760371.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sarcophilus harrisii]
Length=445

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_008322011.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cynoglossus semilaevis]
Length=428

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  223  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  282

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD+AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  283  LYVNFDFDSAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  331

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  332  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  391

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  392  TKSLSFRSQMLA  403



>ref|XP_004457646.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Dasypus novemcinctus]
Length=434

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  228  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  287

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  288  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  336

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  337  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  396

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  397  TKSLSFRSQML  407



>ref|NP_001559.1| eukaryotic translation initiation factor 3 subunit E [Homo sapiens]
 ref|NP_032414.1| eukaryotic translation initiation factor 3 subunit E [Mus musculus]
 ref|NP_001011990.1| eukaryotic translation initiation factor 3 subunit E [Rattus 
norvegicus]
 ref|NP_001245017.1| eukaryotic translation initiation factor 3, subunit E [Macaca 
mulatta]
 ref|NP_001288220.1| eukaryotic translation initiation factor 3, subunit E [Equus 
caballus]
 ref|XP_532304.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 2 [Canis lupus familiaris]
 ref|XP_002710778.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Oryctolagus cuniculus]
 ref|XP_002918756.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ailuropoda melanoleuca]
 ref|XP_003480039.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cavia porcellus]
 ref|XP_003782458.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Otolemur garnettii]
 ref|XP_004000105.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Felis catus]
 ref|XP_004047479.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 1 [Gorilla gorilla gorilla]
 ref|XP_004282986.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Orcinus orca]
 ref|XP_004324100.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Tursiops truncatus]
 ref|XP_004403906.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Odobenus rosmarus divergens]
 ref|XP_004431317.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ceratotherium simum simum]
 ref|XP_004607728.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sorex araneus]
 ref|XP_004771370.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mustela putorius furo]
 ref|XP_004796182.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Mustela putorius furo]
 ref|XP_005072680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Mesocricetus auratus]
 ref|XP_005367570.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Microtus ochrogaster]
 ref|XP_005316305.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ictidomys tridecemlineatus]
 ref|XP_005382024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chinchilla lanigera]
 ref|XP_006189142.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Camelus ferus]
 ref|XP_006211631.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Vicugna pacos]
 ref|XP_006167984.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tupaia chinensis]
 ref|XP_006753964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis davidii]
 ref|XP_006916674.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pteropus alecto]
 ref|XP_006978773.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Peromyscus maniculatus bairdii]
 ref|XP_007446593.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Lipotes vexillifer]
 ref|XP_007524298.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Erinaceus europaeus]
 ref|XP_007640052.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cricetulus griseus]
 ref|XP_007637828.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Cricetulus griseus]
 ref|XP_008053552.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Tarsius syrichta]
 ref|XP_008141617.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Eptesicus fuscus]
 ref|XP_008506418.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Equus przewalskii]
 ref|XP_008567955.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Galeopterus variegatus]
 ref|XP_008687479.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ursus maritimus]
 ref|XP_008849727.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Nannospalax galili]
 ref|XP_010954133.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Camelus bactrianus]
 ref|XP_010983434.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Camelus dromedarius]
 ref|XP_011367760.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Pteropus vampyrus]
 sp|P60228.1|EIF3E_HUMAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=Viral integration 
site protein INT-6 homolog; AltName: Full=eIF-3 p48 [Homo sapiens]
 sp|P60229.1|EIF3E_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=MMTV integration site 
6; AltName: Full=Mammary tumor-associated protein INT-6; 
AltName: Full=Viral integration site protein INT-6; AltName: 
Full=eIF-3 p48 [Mus musculus]
 sp|Q4R6G8.1|EIF3E_MACFA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Macaca 
fascicularis]
 sp|Q641X8.1|EIF3E_RAT RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Rattus 
norvegicus]
 sp|Q5R8K9.2|EIF3E_PONAB RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Pongo abelii]
 gb|AAB58251.1| similar to mouse Int-6 [Homo sapiens]
 gb|AAC51760.1| eIF3-p48 [Homo sapiens]
 gb|AAB88873.1| Int-6 [Homo sapiens]
 gb|AAC51919.1| mammary tumor-associated protein INT6 [Homo sapiens]
 gb|AAH00734.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH08419.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH16706.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH21679.1| Eukaryotic translation initiation factor 3, subunit E [Homo sapiens]
 gb|AAH29177.1| Eukaryotic translation initiation factor 3, subunit E [Mus musculus]
 emb|CAG47071.1| EIF3S6 [Homo sapiens]
 gb|AAH82087.1| Eukaryotic translation initiation factor 3, subunit E [Rattus 
norvegicus]
 emb|CAH92644.1| hypothetical protein [Pongo abelii]
 gb|AAX41093.1| eukaryotic translation initiation factor 3 subunit 6 [synthetic 
construct]
 gb|AAX42420.1| eukaryotic translation initiation factor 3 subunit 6 48kDa [synthetic 
construct]
 dbj|BAE01307.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE38465.1| unnamed protein product [Mus musculus]
 dbj|BAE27546.1| unnamed protein product [Mus musculus]
 dbj|BAE36512.1| unnamed protein product [Mus musculus]
 dbj|BAE26211.1| unnamed protein product [Mus musculus]
 gb|EAW91918.1| eukaryotic translation initiation factor 3, subunit 6 48kDa, 
isoform CRA_a [Homo sapiens]
 gb|ABM83204.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [synthetic 
construct]
 gb|ABM86404.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [synthetic 
construct]
 gb|EDL08753.1| mCG16052, isoform CRA_a [Mus musculus]
 gb|EDM16318.1| rCG59689, isoform CRA_a [Rattus norvegicus]
 dbj|BAI45432.1| eukaryotic translation initiation factor 3, subunit E [synthetic 
construct]
 gb|EHH64366.1| Eukaryotic translation initiation factor 3 subunit E [Macaca 
fascicularis]
 gb|ELK08606.1| Eukaryotic translation initiation factor 3 subunit E [Pteropus 
alecto]
 gb|ELK37587.1| Eukaryotic translation initiation factor 3 subunit E [Myotis 
davidii]
 gb|AIC49071.1| EIF3E, partial [synthetic construct]
 gb|AIC63063.1| EIF3E, partial [synthetic construct]
Length=445

 Score =   212 bits (540),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|NP_001029775.1| eukaryotic translation initiation factor 3 subunit E [Bos taurus]
 ref|XP_004011834.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Ovis aries]
 ref|XP_005689215.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Capra hircus]
 ref|XP_005963084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pantholops hodgsonii]
 ref|XP_005963085.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pantholops hodgsonii]
 ref|XP_006075747.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Bubalus bubalis]
 ref|XP_010861761.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Bison bison bison]
 sp|Q3T102.1|EIF3E_BOVIN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6; AltName: Full=eIF-3 p48 [Bos taurus]
 gb|AAI02189.1| Eukaryotic translation initiation factor 3, subunit E [Bos taurus]
 tpg|DAA22620.1| TPA: eukaryotic translation initiation factor 3 subunit E [Bos 
taurus]
Length=445

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_003903117.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Papio anubis]
 ref|XP_005563983.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Macaca fascicularis]
 ref|XP_008973473.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Pan paniscus]
 ref|XP_010347573.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Saimiri boliviensis boliviensis]
Length=473

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  267  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  326

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  327  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  375

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  376  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  435

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  436  TKSLSFRSQMLAMNIEKKLNQNSRSEA  462



>ref|XP_004679709.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Condylura cristata]
Length=472

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  266  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  325

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  326  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  374

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  375  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  434

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  435  TKSLSFRSQML  445



>ref|XP_010369113.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Rhinopithecus roxellana]
Length=473

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  267  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  326

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  327  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  375

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  376  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  435

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  436  TKSLSFRSQMLAMNIEKKLNQNSRSEA  462



>ref|XP_004370748.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Trichechus manatus latirostris]
Length=473

 Score =   213 bits (542),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  267  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  326

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  327  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  375

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  376  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  435

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  436  TKSLSFRSQMLAMNIEKKLNQNSRSEA  462



>gb|EHH28709.1| Eukaryotic translation initiation factor 3 subunit E [Macaca 
mulatta]
Length=445

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_010614025.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Fukomys damarensis]
Length=445

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_004661452.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Jaculus jaculus]
Length=445

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>gb|AIC63065.1| EIF3E, partial [synthetic construct]
Length=446

 Score =   212 bits (540),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_003256152.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform 1 [Nomascus leucogenys]
Length=473

 Score =   213 bits (541),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  267  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  326

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  327  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  375

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  376  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  435

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  436  TKSLSFRSQMLAMNIEKKLNQNSRSEA  462



>gb|ABF57434.1| eukaryotic translation initiation factor 3, subunit 6 48kDa [Bos 
taurus]
Length=444

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  238  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  297

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  298  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  346

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  347  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  406

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  407  TKSLSFRSQMLAMNIEKKLNQNSRSEA  433



>ref|XP_003408482.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Loxodonta africana]
Length=445

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_002759346.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Callithrix jacchus]
Length=473

 Score =   213 bits (541),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  267  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  326

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  327  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  375

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  376  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  435

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  436  TKSLSFRSQMLAMNIEKKLNQNSRSEA  462



>gb|AAH45079.1| Eif3e-a protein [Xenopus laevis]
Length=423

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  217  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  276

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  277  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  325

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  326  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  385

Query  220  TKGLSGRTYKL  188
            TK L+ R+  L
Sbjct  386  TKSLAFRSQML  396



>emb|CAG33310.1| EIF3S6 [Homo sapiens]
Length=445

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRLVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_006735492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like isoform X1 [Leptonychotes weddellii]
Length=445

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>ref|XP_004850341.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Heterocephalus glaber]
Length=445

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 145/207 (70%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V    +F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLGDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLHQNSRSEA  434



>ref|XP_006005204.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Latimeria chalumnae]
Length=446

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  409  TKSLSFRSQMLA  420



>ref|XP_004850340.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Heterocephalus glaber]
Length=491

 Score =   213 bits (541),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/210 (52%), Positives = 146/210 (70%), Gaps = 18/210 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V    +F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLGDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQAQPT  143
            TK LS R+  L      +L ++++S+ + T
Sbjct  408  TKSLSFRSQMLAMNIEKKLHQNSRSEVRTT  437



>gb|AAX36482.1| eukaryotic translation initiation factor 3 subunit 6 [synthetic 
construct]
Length=445

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISIKMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>gb|ERE52457.1| eukaryotic translation initiation factor 3 subunit E-like protein 
[Cricetulus griseus]
Length=440

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  234  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  293

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  294  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  342

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  343  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  402

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  403  TKSLSFRSQMLAMNIEKKLNQNSRSEA  429



>ref|XP_005662958.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Sus scrofa]
Length=484

 Score =   212 bits (540),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  278  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  337

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  338  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  386

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  387  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  446

Query  220  TKGLSGRTYKL  188
            TK LS R+  L
Sbjct  447  TKSLSFRSQML  457



>ref|XP_003219492.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Anolis carolinensis]
Length=445

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>gb|AAH92025.1| Eif3e-b protein [Xenopus laevis]
Length=352

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  146  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  205

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YV++DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  206  LYVHFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  254

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  255  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  314

Query  220  TKGLSGRTYKLV  185
            TK L+ R+  L 
Sbjct  315  TKSLAFRSQMLA  326



>emb|CAJ82304.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
Length=440

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL  188
            TK L+ R+  L
Sbjct  409  TKSLAFRSQML  419



>ref|XP_006038115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Alligator sinensis]
 ref|XP_006269838.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Alligator mississippiensis]
Length=445

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLN+ QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNSIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYGDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAISPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>ref|XP_004899370.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E-like [Heterocephalus glaber]
Length=465

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 145/207 (70%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  259  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  318

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V    +F+ENARLFIFET+CRI
Sbjct  319  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLGDFIENARLFIFETFCRI  367

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  368  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  427

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  428  TKSLSFRSQMLAMNIEKKLHQNSRSEA  454



>gb|ERE52456.1| eukaryotic translation initiation factor 3 subunit E-like protein 
[Cricetulus griseus]
Length=457

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  234  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  293

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  294  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  342

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  343  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  402

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  403  TKSLSFRSQMLA  414



>ref|NP_001082486.1| eukaryotic translation initiation factor 3 subunit E-A [Xenopus 
laevis]
 sp|Q05AY2.1|EI3EA_XENLA RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E-A; Short=eIF3e-A; AltName: Full=Eukaryotic translation 
initiation factor 3 subunit 6-A [Xenopus laevis]
 gb|AAI23117.1| Eif3e-a protein [Xenopus laevis]
 gb|AAI28928.1| Eif3e-a protein [Xenopus laevis]
Length=446

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL  188
            TK L+ R+  L
Sbjct  409  TKSLAFRSQML  419



>ref|XP_007999543.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X1 [Chlorocebus sabaeus]
Length=496

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  290  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  349

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  350  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  398

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  399  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  458

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  459  TKSLSFRSQMLAMNIEKKLNQNSRSEA  485



>ref|NP_989147.1| eukaryotic translation initiation factor 3 subunit E [Xenopus 
(Silurana) tropicalis]
 sp|Q6P7L9.1|EIF3E_XENTR RecName: Full=Eukaryotic translation initiation factor 3 subunit 
E; Short=eIF3e; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 6 [Xenopus (Silurana) tropicalis]
 gb|AAH61611.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
 gb|AAH80327.1| eukaryotic translation initiation factor 3, subunit 6 [Xenopus 
(Silurana) tropicalis]
Length=446

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 137/191 (72%), Gaps = 14/191 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  240  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  299

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  300  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  348

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  349  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  408

Query  220  TKGLSGRTYKL  188
            TK L+ R+  L
Sbjct  409  TKSLAFRSQML  419



>ref|XP_009454078.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit E [Pan troglodytes]
Length=496

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  290  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  349

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  350  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  398

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  399  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  458

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  459  TKSLSFRSQMLAMNIEKKLNQNSRSEA  485



>gb|EOA98832.1| Eukaryotic translation initiation factor 3 subunit E, partial 
[Anas platyrhynchos]
Length=404

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 138/192 (72%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK--RRRPQ-FKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  P LLRYL TA I NK  R+R Q  KD +KVIQ E Y+Y DPITEF+ C
Sbjct  210  QPQYLNAIQTMCPRLLRYLTTAVITNKDVRKRGQVLKDLVKVIQQESYTYRDPITEFVEC  269

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  270  LYVNFDFDGAQKKLRECETVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  318

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I +G+LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  319  HQCISIGMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  378

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  379  TKSLSFRSQMLA  390



>ref|XP_007056150.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Chelonia mydas]
Length=445

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>ref|XP_006113079.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E isoform X2 [Pelodiscus sinensis]
Length=445

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYQDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  408  TKSLSFRSQMLA  419



>ref|XP_005869124.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis brandtii]
 ref|XP_006085268.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
E [Myotis lucifugus]
 gb|EPQ09502.1| Eukaryotic translation initiation factor 3 subunit E [Myotis 
brandtii]
Length=445

 Score =   210 bits (535),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 146/207 (71%), Gaps = 18/207 (9%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   K+ +KVIQ E Y+Y DPITEF+ C
Sbjct  239  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKELVKVIQQESYTYKDPITEFVEC  298

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  299  LYVNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  347

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ 
Sbjct  348  HQCISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEK  407

Query  220  TKGLSGRTYKLV----SQLLEHAQSQA  152
            TK LS R+  L      +L ++++S+A
Sbjct  408  TKSLSFRSQMLAMNIEKKLNQNSRSEA  434



>gb|KFO18524.1| Eukaryotic translation initiation factor 3 subunit E [Fukomys 
damarensis]
Length=480

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 136/189 (72%), Gaps = 14/189 (7%)
 Frame = -2

Query  745  KYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLACVY  575
            +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C+Y
Sbjct  276  QYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVECLY  335

Query  574  VNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRIHQ  395
            VN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRIHQ
Sbjct  336  VNFDFDGAQKKLRECESVLVNDFFL-----------VACLEDFIENARLFIFETFCRIHQ  384

Query  394  RIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDHTK  215
             I + +LA+KLN+  E+AERWIVNLIR ++LDAKIDS+ G V+M     + Y+Q+I+ TK
Sbjct  385  CISINMLADKLNMTPEEAERWIVNLIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTK  444

Query  214  GLSGRTYKL  188
             LS R+  L
Sbjct  445  SLSFRSQML  453



>gb|EMP39258.1| Eukaryotic translation initiation factor 3 subunit E [Chelonia 
mydas]
Length=472

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 137/192 (71%), Gaps = 14/192 (7%)
 Frame = -2

Query  751  QDKYLNAXQTNAPHLLRYLATAFIVNK---RRRPQFKDFIKVIQPEQYSYADPITEFLAC  581
            Q +YLNA QT  PH+LRYL TA I NK   +RR   KD +KVIQ E Y+Y DPITEF+ C
Sbjct  266  QPQYLNAIQTMCPHILRYLTTAVITNKDVRKRRQVLKDLVKVIQQESYTYKDPITEFVEC  325

Query  580  VYVNYDFDAAQQKMKECEEVILNDPFLGKRVEEGNFSTVPLRDEFLENARLFIFETYCRI  401
            +YVN+DFD AQ+K++ECE V++ND FL           V   ++F+ENARLFIFET+CRI
Sbjct  326  LYVNFDFDGAQKKLRECEAVLVNDFFL-----------VACLEDFIENARLFIFETFCRI  374

Query  400  HQRIDMGVLAEKLNLNYEDAERWIVNLIRTSKLDAKIDSETGTVIMEPTHPNVYEQLIDH  221
            HQ I + +LA+KLN+  E+AERWIVNLIR ++LDAK+DS+ G V+M     + Y+Q+I+ 
Sbjct  375  HQCISISMLADKLNMTPEEAERWIVNLIRNARLDAKLDSKLGHVVMGNNAVSPYQQVIEK  434

Query  220  TKGLSGRTYKLV  185
            TK LS R+  L 
Sbjct  435  TKSLSFRSQMLA  446



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1467725733100