BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033B05

Length=689
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590190.1|  PREDICTED: probable inactive receptor kinase...    289   7e-90   Nicotiana tomentosiformis
ref|XP_004246956.1|  PREDICTED: probable inactive receptor kinase...    288   1e-89   Solanum lycopersicum
ref|XP_009772876.1|  PREDICTED: probable inactive receptor kinase...    288   2e-89   Nicotiana sylvestris
ref|XP_006356869.1|  PREDICTED: probable inactive receptor kinase...    287   6e-89   Solanum tuberosum [potatoes]
ref|XP_007207849.1|  hypothetical protein PRUPE_ppa022997mg             286   8e-89   
gb|KHN40997.1|  Putative inactive receptor kinase                       273   2e-88   Glycine soja [wild soybean]
ref|XP_008244615.1|  PREDICTED: probable inactive receptor kinase...    282   6e-88   Prunus mume [ume]
gb|KHN30614.1|  Putative inactive receptor kinase                       272   6e-88   Glycine soja [wild soybean]
emb|CDP04037.1|  unnamed protein product                                272   7e-88   Coffea canephora [robusta coffee]
gb|KHN24722.1|  Putative inactive receptor kinase                       274   2e-87   Glycine soja [wild soybean]
gb|EYU36892.1|  hypothetical protein MIMGU_mgv1a0177021mg               269   3e-87   Erythranthe guttata [common monkey flower]
ref|XP_008244579.1|  PREDICTED: probable inactive receptor kinase...    281   5e-87   
ref|XP_010252005.1|  PREDICTED: probable inactive receptor kinase...    282   6e-87   Nelumbo nucifera [Indian lotus]
ref|XP_002533837.1|  Nodulation receptor kinase precursor, putative     280   2e-86   
ref|XP_010098027.1|  putative inactive receptor kinase                  281   3e-86   
ref|XP_010244554.1|  PREDICTED: probable inactive receptor kinase...    280   4e-86   Nelumbo nucifera [Indian lotus]
ref|XP_009370892.1|  PREDICTED: probable inactive receptor kinase...    278   9e-86   Pyrus x bretschneideri [bai li]
ref|XP_002276162.3|  PREDICTED: probable inactive receptor kinase...    279   1e-85   Vitis vinifera
emb|CBI15804.3|  unnamed protein product                                279   1e-85   Vitis vinifera
ref|XP_004142674.1|  PREDICTED: probable inactive receptor kinase...    278   1e-85   Cucumis sativus [cucumbers]
ref|XP_004172749.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    278   1e-85   
gb|KDP45679.1|  hypothetical protein JCGZ_17286                         277   2e-85   Jatropha curcas
ref|XP_002528709.1|  Nodulation receptor kinase precursor, putative     277   3e-85   Ricinus communis
gb|KDO54914.1|  hypothetical protein CISIN_1g005693mg                   277   3e-85   Citrus sinensis [apfelsine]
ref|XP_006432052.1|  hypothetical protein CICLE_v10000513mg             276   4e-85   Citrus clementina [clementine]
gb|KDO54912.1|  hypothetical protein CISIN_1g005693mg                   277   7e-85   Citrus sinensis [apfelsine]
ref|XP_006432053.1|  hypothetical protein CICLE_v10000513mg             276   1e-84   Citrus clementina [clementine]
gb|KDO54913.1|  hypothetical protein CISIN_1g005693mg                   277   1e-84   Citrus sinensis [apfelsine]
ref|XP_011041763.1|  PREDICTED: probable inactive receptor kinase...    272   1e-84   Populus euphratica
ref|XP_008355739.1|  PREDICTED: probable inactive receptor kinase...    275   2e-84   
ref|XP_003519295.1|  PREDICTED: probable inactive receptor kinase...    275   3e-84   Glycine max [soybeans]
ref|XP_008463277.1|  PREDICTED: probable inactive receptor kinase...    274   6e-84   Cucumis melo [Oriental melon]
gb|KHN18649.1|  Putative inactive receptor kinase                       272   6e-84   Glycine soja [wild soybean]
ref|XP_003544939.1|  PREDICTED: probable inactive receptor kinase...    274   6e-84   
ref|XP_006591269.1|  PREDICTED: probable inactive receptor kinase...    274   8e-84   Glycine max [soybeans]
ref|XP_003537367.2|  PREDICTED: probable inactive receptor kinase...    274   8e-84   
ref|XP_009374410.1|  PREDICTED: probable inactive receptor kinase...    273   1e-83   Pyrus x bretschneideri [bai li]
ref|XP_011089538.1|  PREDICTED: probable inactive receptor kinase...    273   1e-83   
ref|XP_006602052.1|  PREDICTED: probable inactive receptor kinase...    273   1e-83   Glycine max [soybeans]
ref|XP_003553192.2|  PREDICTED: probable inactive receptor kinase...    273   2e-83   Glycine max [soybeans]
ref|XP_006602049.1|  PREDICTED: probable inactive receptor kinase...    273   2e-83   Glycine max [soybeans]
ref|XP_011089537.1|  PREDICTED: probable inactive receptor kinase...    273   2e-83   Sesamum indicum [beniseed]
ref|XP_006602050.1|  PREDICTED: probable inactive receptor kinase...    273   2e-83   Glycine max [soybeans]
ref|XP_002325632.1|  putative plant disease resistance family pro...    272   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010094441.1|  putative inactive receptor kinase                  272   3e-83   Morus notabilis
ref|XP_007033487.1|  Leucine-rich repeat protein kinase family pr...    272   3e-83   
ref|XP_011041759.1|  PREDICTED: probable inactive receptor kinase...    271   4e-83   Populus euphratica
ref|XP_010683445.1|  PREDICTED: probable inactive receptor kinase...    271   4e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008384658.1|  PREDICTED: probable inactive receptor kinase...    271   4e-83   
ref|XP_010683449.1|  PREDICTED: probable inactive receptor kinase...    271   4e-83   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007142022.1|  hypothetical protein PHAVU_008G245900g             271   5e-83   Phaseolus vulgaris [French bean]
gb|KEH34523.1|  LRR receptor-like kinase                                271   5e-83   Medicago truncatula
ref|XP_004294716.1|  PREDICTED: probable inactive receptor kinase...    271   5e-83   Fragaria vesca subsp. vesca
ref|XP_004500388.1|  PREDICTED: probable inactive receptor kinase...    271   6e-83   
ref|XP_003600547.1|  Leucine-rich repeat receptor-like protein ki...    271   7e-83   
ref|XP_007017100.1|  Leucine-rich repeat protein kinase family pr...    271   8e-83   
ref|XP_006358156.1|  PREDICTED: probable inactive receptor kinase...    271   9e-83   Solanum tuberosum [potatoes]
ref|XP_004302522.1|  PREDICTED: probable inactive receptor kinase...    270   1e-82   Fragaria vesca subsp. vesca
gb|KDP21848.1|  hypothetical protein JCGZ_00635                         271   1e-82   Jatropha curcas
ref|XP_007146903.1|  hypothetical protein PHAVU_006G080200g             271   1e-82   Phaseolus vulgaris [French bean]
ref|XP_009758202.1|  PREDICTED: probable inactive receptor kinase...    270   1e-82   Nicotiana sylvestris
ref|XP_006374053.1|  leucine-rich repeat transmembrane protein ki...    270   2e-82   
ref|XP_007208318.1|  hypothetical protein PRUPE_ppa002781mg             270   2e-82   
ref|XP_008239856.1|  PREDICTED: probable inactive receptor kinase...    270   2e-82   Prunus mume [ume]
ref|XP_003616055.1|  Leucine-rich repeat receptor-like protein ki...    270   3e-82   Medicago truncatula
ref|XP_009592168.1|  PREDICTED: probable inactive receptor kinase...    269   6e-82   Nicotiana tomentosiformis
ref|XP_004490727.1|  PREDICTED: probable inactive receptor kinase...    269   7e-82   Cicer arietinum [garbanzo]
ref|XP_004235218.1|  PREDICTED: probable inactive receptor kinase...    268   8e-82   Solanum lycopersicum
ref|XP_004139930.1|  PREDICTED: probable inactive receptor kinase...    268   9e-82   Cucumis sativus [cucumbers]
ref|XP_008456255.1|  PREDICTED: probable inactive receptor kinase...    268   1e-81   
ref|XP_011084790.1|  PREDICTED: probable inactive receptor kinase...    267   2e-81   Sesamum indicum [beniseed]
ref|XP_011001675.1|  PREDICTED: probable inactive receptor kinase...    265   3e-81   Populus euphratica
gb|KJB20517.1|  hypothetical protein B456_003G153000                    266   5e-81   Gossypium raimondii
ref|XP_002319979.1|  putative plant disease resistance family pro...    266   5e-81   Populus trichocarpa [western balsam poplar]
ref|XP_011001674.1|  PREDICTED: probable inactive receptor kinase...    266   5e-81   Populus euphratica
ref|XP_011011771.1|  PREDICTED: probable inactive receptor kinase...    266   5e-81   Populus euphratica
ref|XP_011001671.1|  PREDICTED: probable inactive receptor kinase...    266   5e-81   Populus euphratica
gb|KDO64166.1|  hypothetical protein CISIN_1g006747mg                   266   6e-81   Citrus sinensis [apfelsine]
ref|XP_006429632.1|  hypothetical protein CICLE_v10011280mg             266   6e-81   Citrus clementina [clementine]
ref|XP_011095165.1|  PREDICTED: probable inactive receptor kinase...    266   6e-81   Sesamum indicum [beniseed]
gb|KHG05843.1|  hypothetical protein F383_32232                         265   2e-80   Gossypium arboreum [tree cotton]
ref|XP_009607538.1|  PREDICTED: probable inactive receptor kinase...    265   4e-80   Nicotiana tomentosiformis
gb|ABK93951.1|  unknown                                                 255   6e-80   Populus trichocarpa [western balsam poplar]
gb|KJB29842.1|  hypothetical protein B456_005G120900                    263   1e-79   Gossypium raimondii
emb|CAN80590.1|  hypothetical protein VITISV_040789                     262   1e-79   Vitis vinifera
gb|KHG17391.1|  hypothetical protein F383_22576                         263   2e-79   Gossypium arboreum [tree cotton]
ref|XP_010653700.1|  PREDICTED: probable inactive receptor kinase...    262   2e-79   
ref|XP_009760496.1|  PREDICTED: probable inactive receptor kinase...    262   2e-79   Nicotiana sylvestris
ref|XP_009337799.1|  PREDICTED: probable inactive receptor kinase...    261   2e-79   
ref|XP_010653698.1|  PREDICTED: probable inactive receptor kinase...    262   3e-79   
ref|XP_011080640.1|  PREDICTED: probable inactive receptor kinase...    261   3e-79   Sesamum indicum [beniseed]
ref|XP_009355011.1|  PREDICTED: probable inactive receptor kinase...    261   3e-79   
ref|XP_009760490.1|  PREDICTED: probable inactive receptor kinase...    262   6e-79   Nicotiana sylvestris
ref|XP_008803002.1|  PREDICTED: probable inactive receptor kinase...    260   1e-78   Phoenix dactylifera
gb|EYU42048.1|  hypothetical protein MIMGU_mgv1a003031mg                259   2e-78   Erythranthe guttata [common monkey flower]
emb|CDP13882.1|  unnamed protein product                                259   2e-78   Coffea canephora [robusta coffee]
ref|XP_008366817.1|  PREDICTED: probable inactive receptor kinase...    258   4e-78   
ref|XP_010922781.1|  PREDICTED: probable inactive receptor kinase...    258   7e-78   
ref|XP_006435960.1|  hypothetical protein CICLE_v10030941mg             257   1e-77   Citrus clementina [clementine]
ref|XP_006435961.1|  hypothetical protein CICLE_v10030941mg             257   1e-77   Citrus clementina [clementine]
gb|KDO67579.1|  hypothetical protein CISIN_1g006886mg                   257   1e-77   Citrus sinensis [apfelsine]
ref|XP_010999642.1|  PREDICTED: probable inactive receptor kinase...    256   3e-77   Populus euphratica
ref|XP_010999638.1|  PREDICTED: probable inactive receptor kinase...    256   5e-77   Populus euphratica
ref|XP_010999639.1|  PREDICTED: probable inactive receptor kinase...    256   6e-77   Populus euphratica
gb|ABR17070.1|  unknown                                                 247   8e-77   Picea sitchensis
ref|XP_006371315.1|  putative plant disease resistance family pro...    255   8e-77   
ref|XP_006371316.1|  hypothetical protein POPTR_0019s09010g             254   1e-76   
ref|XP_010931391.1|  PREDICTED: probable inactive receptor kinase...    254   2e-76   Elaeis guineensis
ref|XP_009798129.1|  PREDICTED: probable inactive receptor kinase...    252   7e-76   Nicotiana sylvestris
ref|XP_010541472.1|  PREDICTED: probable inactive receptor kinase...    251   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_006280146.1|  hypothetical protein CARUB_v10026045mg             251   3e-75   
ref|XP_010541471.1|  PREDICTED: probable inactive receptor kinase...    251   4e-75   
dbj|BAH57151.1|  AT3G08680                                              239   4e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043603.1|  PREDICTED: probable inactive receptor kinase...    249   7e-75   Eucalyptus grandis [rose gum]
ref|XP_006401105.1|  hypothetical protein EUTSA_v10012925mg             249   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_009384331.1|  PREDICTED: probable inactive receptor kinase...    249   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010323112.1|  PREDICTED: probable inactive receptor kinase...    249   1e-74   
ref|XP_010443551.1|  PREDICTED: probable inactive receptor kinase...    249   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_009607078.1|  PREDICTED: probable inactive receptor kinase...    248   3e-74   
ref|XP_006842562.1|  hypothetical protein AMTR_s00077p00144570          235   6e-74   
emb|CDY58565.1|  BnaC03g12450D                                          248   6e-74   Brassica napus [oilseed rape]
ref|XP_008788112.1|  PREDICTED: probable inactive receptor kinase...    247   7e-74   Phoenix dactylifera
gb|KCW50324.1|  hypothetical protein EUGRSUZ_J00100                     247   1e-73   Eucalyptus grandis [rose gum]
ref|XP_002864562.1|  predicted protein                                  247   1e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_010031063.1|  PREDICTED: probable inactive receptor kinase...    247   1e-73   
ref|XP_010483401.1|  PREDICTED: probable inactive receptor kinase...    247   1e-73   
ref|XP_010453493.1|  PREDICTED: probable inactive receptor kinase...    247   1e-73   Camelina sativa [gold-of-pleasure]
ref|NP_200638.1|  leucine-rich repeat protein kinase family protein     247   1e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132067.1|  PREDICTED: probable inactive receptor kinase...    246   1e-73   Brassica rapa
ref|XP_009406050.1|  PREDICTED: probable inactive receptor kinase...    246   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY02808.1|  BnaC02g10810D                                          241   2e-73   
gb|KJB71491.1|  hypothetical protein B456_011G125200                    246   2e-73   Gossypium raimondii
ref|XP_006357316.1|  PREDICTED: probable inactive receptor kinase...    244   5e-73   Solanum tuberosum [potatoes]
gb|ACA61611.1|  hypothetical protein AP2_E06.2                          244   2e-72   Arabidopsis lyrata subsp. petraea
ref|XP_010463311.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    243   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010670041.1|  PREDICTED: probable inactive receptor kinase...    243   2e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21623.1|  hypothetical protein JCGZ_03294                         243   3e-72   Jatropha curcas
ref|XP_007011393.1|  Leucine-rich repeat protein kinase family pr...    242   5e-72   
ref|XP_007011392.1|  Leucine-rich repeat protein kinase family pr...    242   5e-72   Theobroma cacao [chocolate]
ref|XP_006297193.1|  hypothetical protein CARUB_v10013201mg             242   6e-72   Capsella rubella
ref|XP_009146990.1|  PREDICTED: probable inactive receptor kinase...    242   6e-72   Brassica rapa
ref|XP_010464477.1|  PREDICTED: probable inactive receptor kinase...    242   7e-72   Camelina sativa [gold-of-pleasure]
emb|CDY35996.1|  BnaA05g29540D                                          242   8e-72   Brassica napus [oilseed rape]
ref|XP_006407752.1|  hypothetical protein EUTSA_v10020278mg             241   2e-71   Eutrema salsugineum [saltwater cress]
emb|CDP06375.1|  unnamed protein product                                241   2e-71   Coffea canephora [robusta coffee]
ref|NP_187480.1|  leucine-rich repeat protein kinase family protein     240   3e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDY27986.1|  BnaC05g43880D                                          240   4e-71   Brassica napus [oilseed rape]
ref|XP_002882579.1|  hypothetical protein ARALYDRAFT_478170             239   6e-71   
gb|KJB67957.1|  hypothetical protein B456_010G219700                    238   9e-71   Gossypium raimondii
emb|CDY32713.1|  BnaA02g07750D                                          239   1e-70   Brassica napus [oilseed rape]
gb|KHF99691.1|  hypothetical protein F383_18108                         238   1e-70   Gossypium arboreum [tree cotton]
ref|XP_006587908.1|  PREDICTED: probable inactive receptor kinase...    237   2e-70   Glycine max [soybeans]
ref|XP_009386109.1|  PREDICTED: probable inactive receptor kinase...    238   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009126766.1|  PREDICTED: probable inactive receptor kinase...    238   3e-70   Brassica rapa
ref|XP_006602721.1|  PREDICTED: probable inactive receptor kinase...    236   4e-70   Glycine max [soybeans]
ref|XP_009363779.1|  PREDICTED: probable inactive receptor kinase...    237   4e-70   Pyrus x bretschneideri [bai li]
ref|XP_008234182.1|  PREDICTED: probable inactive receptor kinase...    236   5e-70   Prunus mume [ume]
ref|XP_009123870.1|  PREDICTED: probable inactive receptor kinase...    236   6e-70   Brassica rapa
gb|KHN40609.1|  Putative inactive receptor kinase                       236   7e-70   Glycine soja [wild soybean]
ref|XP_007220535.1|  hypothetical protein PRUPE_ppa002812mg             235   2e-69   Prunus persica
gb|KEH35517.1|  receptor-like kinase                                    233   1e-68   Medicago truncatula
gb|KEH23299.1|  LRR receptor-like kinase                                232   2e-68   Medicago truncatula
ref|XP_010322111.1|  PREDICTED: probable inactive receptor kinase...    232   2e-68   Solanum lycopersicum
ref|XP_004241083.1|  PREDICTED: probable inactive receptor kinase...    232   2e-68   
ref|XP_007140053.1|  hypothetical protein PHAVU_008G080500g             232   3e-68   Phaseolus vulgaris [French bean]
ref|XP_009410507.1|  PREDICTED: probable inactive receptor kinase...    232   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004502808.1|  PREDICTED: probable inactive receptor kinase...    233   3e-68   Cicer arietinum [garbanzo]
gb|EEE55588.1|  hypothetical protein OsJ_03884                          221   4e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376328.1|  PREDICTED: probable inactive receptor kinase...    232   4e-68   Malus domestica [apple tree]
emb|CDY22164.1|  BnaC01g39370D                                          230   5e-68   Brassica napus [oilseed rape]
ref|XP_007136405.1|  hypothetical protein PHAVU_009G042300g             231   7e-68   Phaseolus vulgaris [French bean]
ref|XP_004308997.1|  PREDICTED: probable inactive receptor kinase...    231   7e-68   Fragaria vesca subsp. vesca
ref|XP_009391668.1|  PREDICTED: probable inactive receptor kinase...    231   9e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG24076.1|  hypothetical protein F383_10304                         230   2e-67   Gossypium arboreum [tree cotton]
ref|XP_010109178.1|  putative inactive receptor kinase                  229   4e-67   
gb|KJB54134.1|  hypothetical protein B456_009G022300                    229   4e-67   Gossypium raimondii
ref|XP_010921194.1|  PREDICTED: probable inactive receptor kinase...    221   7e-67   Elaeis guineensis
ref|XP_008813233.1|  PREDICTED: probable inactive receptor kinase...    229   7e-67   Phoenix dactylifera
gb|KHN48152.1|  Putative inactive receptor kinase                       217   2e-66   Glycine soja [wild soybean]
ref|XP_004492584.1|  PREDICTED: probable inactive receptor kinase...    227   2e-66   Cicer arietinum [garbanzo]
gb|EEC75189.1|  hypothetical protein OsI_11426                          224   2e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_002281635.1|  PREDICTED: probable inactive receptor kinase...    228   2e-66   Vitis vinifera
emb|CDX88667.1|  BnaA03g09820D                                          227   2e-66   
gb|KHN40012.1|  Putative inactive receptor kinase                       215   2e-66   Glycine soja [wild soybean]
gb|EEE64112.1|  hypothetical protein OsJ_18944                          227   3e-66   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001055854.1|  Os05g0480400                                       227   3e-66   
ref|XP_002324958.1|  leucine-rich repeat transmembrane protein ki...    226   4e-66   
ref|XP_006451034.1|  hypothetical protein CICLE_v10007694mg             226   6e-66   
ref|XP_007013302.1|  Leucine-rich repeat protein kinase family pr...    226   7e-66   
ref|XP_006475765.1|  PREDICTED: probable inactive receptor kinase...    226   1e-65   Citrus sinensis [apfelsine]
ref|XP_008343962.1|  PREDICTED: probable inactive receptor kinase...    225   2e-65   
ref|XP_008386031.1|  PREDICTED: probable inactive receptor kinase...    225   2e-65   
ref|XP_002529343.1|  Nodulation receptor kinase precursor, putative     225   2e-65   Ricinus communis
gb|ACZ98536.1|  protein kinase                                          225   2e-65   Malus domestica [apple tree]
ref|XP_006654545.1|  PREDICTED: probable inactive receptor kinase...    225   2e-65   Oryza brachyantha
ref|XP_011009200.1|  PREDICTED: probable inactive receptor kinase...    225   2e-65   Populus euphratica
ref|XP_010915719.1|  PREDICTED: probable inactive receptor kinase...    225   2e-65   
ref|NP_001050019.1|  Os03g0332900                                       224   3e-65   
ref|XP_008388375.1|  PREDICTED: probable inactive receptor kinase...    224   3e-65   
ref|XP_002456542.1|  hypothetical protein SORBIDRAFT_03g038110          224   3e-65   Sorghum bicolor [broomcorn]
ref|XP_004167200.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    224   4e-65   
ref|XP_004139332.1|  PREDICTED: probable inactive receptor kinase...    224   4e-65   Cucumis sativus [cucumbers]
gb|KHG18372.1|  hypothetical protein F383_03411                         224   4e-65   Gossypium arboreum [tree cotton]
ref|XP_004167125.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    224   5e-65   
ref|XP_004149854.1|  PREDICTED: probable inactive receptor kinase...    224   5e-65   Cucumis sativus [cucumbers]
ref|XP_008458016.1|  PREDICTED: probable inactive receptor kinase...    224   5e-65   Cucumis melo [Oriental melon]
gb|KJB64834.1|  hypothetical protein B456_010G067400                    224   5e-65   Gossypium raimondii
ref|XP_008463343.1|  PREDICTED: probable inactive receptor kinase...    224   5e-65   Cucumis melo [Oriental melon]
gb|KDP32336.1|  hypothetical protein JCGZ_13261                         224   5e-65   Jatropha curcas
ref|XP_009371417.1|  PREDICTED: probable inactive receptor kinase...    224   5e-65   Pyrus x bretschneideri [bai li]
ref|XP_008810859.1|  PREDICTED: probable inactive receptor kinase...    224   6e-65   Phoenix dactylifera
ref|XP_004970381.1|  PREDICTED: probable inactive receptor kinase...    223   7e-65   Setaria italica
ref|XP_004287382.1|  PREDICTED: probable inactive receptor kinase...    224   7e-65   Fragaria vesca subsp. vesca
ref|XP_009362770.1|  PREDICTED: probable inactive receptor kinase...    224   7e-65   
ref|XP_004511532.1|  PREDICTED: probable inactive receptor kinase...    216   1e-64   Cicer arietinum [garbanzo]
ref|XP_007204237.1|  hypothetical protein PRUPE_ppa002548mg             223   1e-64   Prunus persica
gb|ACN57540.1|  At2g26730-like protein                                  210   2e-64   Capsella grandiflora
ref|XP_008242698.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Prunus mume [ume]
ref|XP_008810858.1|  PREDICTED: probable inactive receptor kinase...    223   2e-64   Phoenix dactylifera
gb|EMT17815.1|  Putative inactive receptor kinase                       222   2e-64   
gb|ACN57533.1|  At2g26730-like protein                                  209   2e-64   Capsella grandiflora
dbj|BAB62593.1|  putative receptor-like protein kinase                  222   2e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047774.1|  PREDICTED: probable inactive receptor kinase...    222   3e-64   Eucalyptus grandis [rose gum]
ref|XP_010249925.1|  PREDICTED: probable inactive receptor kinase...    222   3e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002960794.1|  hypothetical protein SELMODRAFT_74002              222   3e-64   
gb|KHN25793.1|  Putative inactive receptor kinase                       222   3e-64   Glycine soja [wild soybean]
gb|EMT09037.1|  Putative inactive receptor kinase                       221   4e-64   
ref|XP_010921193.1|  PREDICTED: probable inactive receptor kinase...    221   4e-64   Elaeis guineensis
gb|ACN57520.1|  At2g26730-like protein                                  209   4e-64   Capsella rubella
gb|EYU35188.1|  hypothetical protein MIMGU_mgv1a002709mg                221   6e-64   Erythranthe guttata [common monkey flower]
ref|XP_010925785.1|  PREDICTED: probable inactive receptor kinase...    221   7e-64   
ref|XP_009374078.1|  PREDICTED: probable inactive receptor kinase...    220   7e-64   
ref|XP_011084098.1|  PREDICTED: probable inactive receptor kinase...    221   7e-64   Sesamum indicum [beniseed]
ref|XP_010938046.1|  PREDICTED: probable inactive receptor kinase...    221   8e-64   Elaeis guineensis
dbj|BAK07296.1|  predicted protein                                      221   8e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ93317.1|  predicted protein                                      220   8e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010533192.1|  PREDICTED: probable inactive receptor kinase...    221   9e-64   Tarenaya hassleriana [spider flower]
ref|NP_001169737.1|  uncharacterized LOC100383618 precursor             220   1e-63   Zea mays [maize]
ref|XP_003526789.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   
ref|XP_010938045.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   Elaeis guineensis
gb|ACN57547.1|  At2g26730-like protein                                  207   2e-63   Capsella grandiflora
ref|XP_003557981.1|  PREDICTED: probable inactive receptor kinase...    219   2e-63   Brachypodium distachyon [annual false brome]
ref|XP_010557581.1|  PREDICTED: probable inactive receptor kinase...    220   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_003564492.1|  PREDICTED: probable inactive receptor kinase...    219   2e-63   Brachypodium distachyon [annual false brome]
gb|KEH35437.1|  receptor-like kinase                                    212   2e-63   Medicago truncatula
ref|NP_001130388.1|  uncharacterized LOC100191484 precursor             219   3e-63   Zea mays [maize]
ref|XP_009362808.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    216   5e-63   
ref|XP_007141331.1|  hypothetical protein PHAVU_008G186900g             218   5e-63   Phaseolus vulgaris [French bean]
ref|XP_010662595.1|  PREDICTED: probable inactive receptor kinase...    218   5e-63   Vitis vinifera
ref|NP_001168214.1|  uncharacterized protein LOC100381972               208   7e-63   
gb|EPS74415.1|  hypothetical protein M569_00340                         218   7e-63   Genlisea aurea
gb|ACN57550.1|  At2g26730-like protein                                  206   9e-63   Capsella grandiflora
ref|XP_006650037.1|  PREDICTED: probable inactive receptor kinase...    218   9e-63   
ref|XP_003568238.1|  PREDICTED: probable inactive receptor kinase...    218   1e-62   Brachypodium distachyon [annual false brome]
ref|XP_003523287.1|  PREDICTED: probable inactive receptor kinase...    218   1e-62   Glycine max [soybeans]
ref|XP_006644911.1|  PREDICTED: probable inactive receptor kinase...    217   1e-62   Oryza brachyantha
ref|XP_003518282.1|  PREDICTED: probable inactive receptor kinase...    218   1e-62   Glycine max [soybeans]
emb|CBI22555.3|  unnamed protein product                                217   2e-62   Vitis vinifera
ref|XP_010098956.1|  putative inactive receptor kinase                  217   2e-62   Morus notabilis
ref|XP_002463400.1|  hypothetical protein SORBIDRAFT_02g043090          217   2e-62   Sorghum bicolor [broomcorn]
ref|XP_004300851.1|  PREDICTED: probable inactive receptor kinase...    217   2e-62   Fragaria vesca subsp. vesca
ref|NP_001060650.1|  Os07g0681100                                       217   2e-62   
gb|KHN00038.1|  Putative inactive receptor kinase                       206   2e-62   Glycine soja [wild soybean]
ref|XP_008649769.1|  PREDICTED: probable inactive receptor kinase...    216   4e-62   
ref|XP_008794990.1|  PREDICTED: probable inactive receptor kinase...    216   5e-62   Phoenix dactylifera
ref|XP_002454913.1|  hypothetical protein SORBIDRAFT_03g001310          214   6e-62   
ref|XP_004961732.1|  PREDICTED: probable inactive receptor kinase...    215   6e-62   Setaria italica
gb|EAZ05160.1|  hypothetical protein OsI_27356                          215   7e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_010254253.1|  PREDICTED: probable inactive receptor kinase...    216   7e-62   Nelumbo nucifera [Indian lotus]
ref|XP_008810158.1|  PREDICTED: probable inactive receptor kinase...    214   7e-62   Phoenix dactylifera
ref|XP_004511531.1|  PREDICTED: probable inactive receptor kinase...    215   7e-62   Cicer arietinum [garbanzo]
ref|XP_010558411.1|  PREDICTED: probable inactive receptor kinase...    214   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_002441272.1|  hypothetical protein SORBIDRAFT_09g023570          215   1e-61   Sorghum bicolor [broomcorn]
gb|KHN25658.1|  Putative inactive receptor kinase                       210   1e-61   Glycine soja [wild soybean]
ref|XP_011076041.1|  PREDICTED: probable inactive receptor kinase...    214   1e-61   Sesamum indicum [beniseed]
ref|XP_010543666.1|  PREDICTED: probable leucine-rich repeat rece...    215   1e-61   Tarenaya hassleriana [spider flower]
gb|AFK38063.1|  unknown                                                 201   1e-61   Lotus japonicus
ref|XP_010473057.1|  PREDICTED: probable inactive receptor kinase...    215   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010417819.1|  PREDICTED: probable inactive receptor kinase...    215   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_002513601.1|  ATP binding protein, putative                      214   2e-61   
gb|KHN37771.1|  Putative inactive receptor kinase                       206   2e-61   
ref|XP_003544853.1|  PREDICTED: probable inactive receptor kinase...    214   2e-61   
gb|AES98409.2|  LRR receptor-like kinase                                214   2e-61   
gb|EMT12910.1|  Putative inactive receptor kinase                       214   2e-61   
ref|XP_009336254.1|  PREDICTED: probable inactive receptor kinase...    214   2e-61   
ref|XP_007038934.1|  Leucine-rich repeat protein kinase family pr...    214   2e-61   
ref|XP_008388374.1|  PREDICTED: probable inactive receptor kinase...    214   2e-61   
gb|EMT08914.1|  Putative inactive receptor kinase                       210   3e-61   
ref|XP_010543665.1|  PREDICTED: probable leucine-rich repeat rece...    215   3e-61   
gb|KHN23405.1|  Putative inactive receptor kinase                       214   3e-61   
ref|XP_003615451.1|  Leucine-rich repeat receptor-like protein ki...    214   4e-61   
ref|XP_003611028.1|  Probably inactive receptor-like protein kinase     213   4e-61   
ref|XP_007137558.1|  hypothetical protein PHAVU_009G136800g             213   4e-61   
ref|XP_006579204.1|  PREDICTED: probable inactive receptor kinase...    208   5e-61   
ref|XP_004236305.1|  PREDICTED: probable inactive receptor kinase...    213   5e-61   
gb|KJB07168.1|  hypothetical protein B456_001G003200                    213   6e-61   
ref|XP_006658137.1|  PREDICTED: probable inactive receptor kinase...    213   6e-61   
ref|XP_009597502.1|  PREDICTED: probable inactive receptor kinase...    213   7e-61   
emb|CDY03526.1|  BnaC01g15560D                                          203   7e-61   
ref|XP_010251541.1|  PREDICTED: probable inactive receptor kinase...    213   7e-61   
ref|XP_003526687.1|  PREDICTED: probable inactive receptor kinase...    213   7e-61   
ref|XP_008793541.1|  PREDICTED: probable inactive receptor kinase...    212   7e-61   
gb|EMT10528.1|  Putative inactive receptor kinase                       213   7e-61   
ref|XP_008793397.1|  PREDICTED: probable inactive receptor kinase...    212   9e-61   
ref|XP_002879005.1|  hypothetical protein ARALYDRAFT_481544             213   1e-60   
ref|XP_004502606.1|  PREDICTED: probable inactive receptor kinase...    211   1e-60   
emb|CDY04464.1|  BnaA07g12900D                                          212   1e-60   
ref|NP_001042446.1|  Os01g0223600                                       209   1e-60   
gb|AFK45382.1|  unknown                                                 211   1e-60   
ref|XP_002317741.1|  hypothetical protein POPTR_0012s01230g             212   1e-60   
ref|XP_009103556.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    212   1e-60   
ref|XP_004502605.1|  PREDICTED: probable inactive receptor kinase...    212   1e-60   
emb|CDX71488.1|  BnaC04g17230D                                          213   1e-60   
gb|ACL52878.1|  unknown                                                 202   1e-60   
ref|XP_003565740.1|  PREDICTED: probable inactive receptor kinase...    212   2e-60   
ref|XP_001774015.1|  predicted protein                                  211   2e-60   
ref|XP_003562443.1|  PREDICTED: probable inactive receptor kinase...    211   2e-60   
ref|XP_006351444.1|  PREDICTED: probable inactive receptor kinase...    212   2e-60   
gb|EYU23030.1|  hypothetical protein MIMGU_mgv1a002522mg                212   2e-60   
gb|EEC74787.1|  hypothetical protein OsI_10572                          205   3e-60   
ref|XP_006374322.1|  hypothetical protein POPTR_0015s06040g             211   3e-60   
ref|XP_011007941.1|  PREDICTED: probable inactive receptor kinase...    211   3e-60   
ref|XP_009614171.1|  PREDICTED: probable inactive receptor kinase...    211   3e-60   
gb|KJB27114.1|  hypothetical protein B456_004G278900                    211   3e-60   
ref|XP_010097875.1|  putative inactive receptor kinase                  211   4e-60   
ref|XP_006397367.1|  hypothetical protein EUTSA_v10022498mg             211   4e-60   
ref|NP_180241.1|  leucine-rich repeat protein kinase family protein     211   4e-60   
gb|AAK92807.1|  putative receptor protein kinase                        211   4e-60   
ref|XP_010925124.1|  PREDICTED: probable inactive receptor kinase...    211   5e-60   
gb|ACU19868.1|  unknown                                                 201   5e-60   
ref|XP_001778286.1|  predicted protein                                  211   5e-60   
gb|ACR38562.1|  unknown                                                 202   5e-60   
gb|KDP25339.1|  hypothetical protein JCGZ_20495                         210   6e-60   
ref|XP_003609204.1|  hypothetical protein MTR_4g113100                  210   7e-60   
ref|XP_008239079.1|  PREDICTED: probable inactive receptor kinase...    210   7e-60   
ref|XP_002509916.1|  ATP binding protein, putative                      208   7e-60   
gb|KHN16761.1|  Putative inactive receptor kinase                       204   8e-60   
dbj|BAJ94608.1|  predicted protein                                      210   8e-60   
gb|AEW08175.1|  hypothetical protein 2_2125_01                          196   9e-60   
ref|XP_003516715.2|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
ref|XP_006590496.1|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
ref|XP_009395807.1|  PREDICTED: probable inactive receptor kinase...    210   1e-59   
gb|KDP22183.1|  hypothetical protein JCGZ_26014                         209   1e-59   
ref|XP_004967473.1|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
ref|XP_009140749.1|  PREDICTED: probable inactive receptor kinase...    210   1e-59   
ref|XP_006439412.1|  hypothetical protein CICLE_v10019314mg             209   1e-59   
gb|KDO76442.1|  hypothetical protein CISIN_1g006922mg                   209   1e-59   
ref|XP_009393622.1|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
gb|EAY91619.1|  hypothetical protein OsI_13254                          199   1e-59   
ref|NP_001051064.1|  Os03g0712400                                       199   1e-59   
ref|XP_009767272.1|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
ref|XP_006476438.1|  PREDICTED: probable inactive receptor kinase...    209   1e-59   
ref|XP_007210296.1|  hypothetical protein PRUPE_ppa002579mg             209   1e-59   
ref|XP_006293818.1|  hypothetical protein CARUB_v10022800mg             209   2e-59   
ref|XP_011001931.1|  PREDICTED: probable inactive receptor kinase...    209   2e-59   
emb|CDY58644.1|  BnaA01g32330D                                          199   2e-59   
emb|CDY48185.1|  BnaA04g15490D                                          209   2e-59   
tpg|DAA57078.1|  TPA: putative leucine-rich repeat receptor-like ...    208   2e-59   
ref|XP_009352353.1|  PREDICTED: probable inactive receptor kinase...    208   2e-59   
ref|XP_011001936.1|  PREDICTED: probable inactive receptor kinase...    208   2e-59   
ref|XP_004958707.1|  PREDICTED: probable inactive receptor kinase...    208   3e-59   
gb|KDO56147.1|  hypothetical protein CISIN_1g007167mg                   208   3e-59   
ref|XP_007154939.1|  hypothetical protein PHAVU_003G159700g             208   3e-59   
ref|XP_010658906.1|  PREDICTED: probable inactive receptor kinase...    208   3e-59   
ref|XP_010916177.1|  PREDICTED: probable inactive receptor kinase...    208   4e-59   
ref|XP_008392458.1|  PREDICTED: probable inactive receptor kinase...    207   5e-59   
ref|XP_009399835.1|  PREDICTED: probable inactive receptor kinase...    207   6e-59   
gb|KJB52632.1|  hypothetical protein B456_008G271600                    207   6e-59   
dbj|BAA94519.1|  putative receptor-like kinase                          207   7e-59   
ref|XP_008437363.1|  PREDICTED: probable inactive receptor kinase...    207   7e-59   
ref|XP_004143879.1|  PREDICTED: probable inactive receptor kinase...    207   7e-59   
ref|XP_004167870.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    207   7e-59   
ref|XP_003527143.1|  PREDICTED: probable inactive receptor kinase...    207   7e-59   
ref|XP_003602176.1|  Leucine-rich repeat receptor-like protein ki...    211   7e-59   
ref|XP_009399834.1|  PREDICTED: probable inactive receptor kinase...    207   7e-59   
emb|CDP12117.1|  unnamed protein product                                207   7e-59   
gb|EPS63924.1|  hypothetical protein M569_10855                         207   8e-59   
gb|KFK24939.1|  hypothetical protein AALP_AA8G045400                    207   8e-59   
ref|XP_004490516.1|  PREDICTED: probable inactive receptor kinase...    207   9e-59   
ref|XP_008376682.1|  PREDICTED: probable inactive receptor kinase...    206   1e-58   
ref|XP_007158557.1|  hypothetical protein PHAVU_002G162400g             206   1e-58   
emb|CDP03386.1|  unnamed protein product                                207   1e-58   
ref|XP_008380496.1|  PREDICTED: probable inactive receptor kinase...    206   1e-58   
gb|KFK32479.1|  hypothetical protein AALP_AA6G247800                    207   1e-58   
gb|KHG27491.1|  hypothetical protein F383_14041                         206   1e-58   
ref|XP_006490586.1|  PREDICTED: probable inactive receptor kinase...    206   1e-58   
ref|XP_008234792.1|  PREDICTED: probable inactive receptor kinase...    206   2e-58   
gb|KJB83149.1|  hypothetical protein B456_013G231600                    194   2e-58   
ref|XP_009352112.1|  PREDICTED: probable inactive receptor kinase...    206   2e-58   
ref|XP_003522551.1|  PREDICTED: probable inactive receptor kinase...    206   2e-58   
ref|XP_004308019.1|  PREDICTED: probable inactive receptor kinase...    207   2e-58   
ref|XP_009409433.1|  PREDICTED: probable inactive receptor kinase...    206   2e-58   
gb|KHG17719.1|  hypothetical protein F383_03334                         206   2e-58   
gb|KHN44239.1|  Putative inactive receptor kinase                       206   2e-58   
gb|AET05610.2|  LRR receptor-like kinase                                206   2e-58   
ref|XP_010538821.1|  PREDICTED: probable inactive receptor kinase...    205   2e-58   
ref|XP_006829650.1|  hypothetical protein AMTR_s00122p00112840          206   3e-58   
ref|XP_007040424.1|  Leucine-rich repeat protein kinase family pr...    205   3e-58   
gb|KHN43642.1|  Putative inactive receptor kinase                       201   3e-58   
ref|XP_003631134.1|  Atypical receptor-like kinase MARK                 206   4e-58   
ref|XP_009375580.1|  PREDICTED: probable inactive receptor kinase...    205   4e-58   
ref|XP_010059849.1|  PREDICTED: probable inactive receptor kinase...    206   4e-58   
ref|XP_009137362.1|  PREDICTED: probable inactive receptor kinase...    205   5e-58   
ref|XP_009796898.1|  PREDICTED: probable inactive receptor kinase...    205   5e-58   
ref|XP_004508557.1|  PREDICTED: probable inactive receptor kinase...    205   5e-58   
ref|XP_007220432.1|  hypothetical protein PRUPE_ppa002831mg             204   6e-58   
gb|ACR34746.1|  unknown                                                 201   6e-58   
ref|XP_010268752.1|  PREDICTED: probable inactive receptor kinase...    205   7e-58   
ref|XP_006645650.1|  PREDICTED: probable inactive receptor kinase...    205   7e-58   
gb|KEH21182.1|  LRR receptor-like kinase                                204   7e-58   
gb|KHN10529.1|  Putative inactive receptor kinase                       202   7e-58   
emb|CDY47625.1|  BnaA01g13400D                                          205   8e-58   
ref|XP_002303623.1|  leucine-rich repeat transmembrane protein ki...    204   8e-58   
ref|XP_002299495.1|  leucine-rich repeat transmembrane protein ki...    204   9e-58   
gb|EEE59802.1|  hypothetical protein OsJ_12326                          199   1e-57   
gb|KHN45250.1|  Putative inactive receptor kinase                       201   1e-57   
ref|XP_008813619.1|  PREDICTED: probable inactive receptor kinase...    199   1e-57   
ref|XP_001752184.1|  predicted protein                                  204   1e-57   
ref|XP_006580544.1|  PREDICTED: probable inactive receptor kinase...    203   1e-57   
gb|KHN00136.1|  Putative inactive receptor kinase                       203   1e-57   
ref|XP_009380537.1|  PREDICTED: probable inactive receptor kinase...    204   1e-57   
gb|AES72427.2|  LRR receptor-like kinase                                203   2e-57   
ref|XP_009782917.1|  PREDICTED: probable inactive receptor kinase...    204   2e-57   
ref|XP_009122125.1|  PREDICTED: probable leucine-rich repeat rece...    203   2e-57   
gb|AAN05336.1|  Putative leucine-rich repeat transmembrane protei...    204   2e-57   
emb|CDX98821.1|  BnaC09g50140D                                          203   2e-57   
ref|NP_001049422.1|  Os03g0223000                                       204   2e-57   
ref|XP_003530966.1|  PREDICTED: probable inactive receptor kinase...    203   2e-57   
ref|XP_004503646.1|  PREDICTED: probable inactive receptor kinase...    203   3e-57   
emb|CDX94213.1|  BnaC07g38470D                                          202   3e-57   
ref|XP_001778285.1|  predicted protein                                  203   3e-57   
ref|XP_011084477.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    202   3e-57   
ref|XP_009137388.1|  PREDICTED: probable inactive receptor kinase...    202   3e-57   
ref|XP_006584744.1|  PREDICTED: probable inactive receptor kinase...    202   4e-57   
ref|XP_011080874.1|  PREDICTED: probable inactive receptor kinase...    202   4e-57   
ref|XP_006398978.1|  hypothetical protein EUTSA_v10012946mg             202   5e-57   
ref|XP_004137511.1|  PREDICTED: probable inactive receptor kinase...    202   5e-57   
ref|XP_007160555.1|  hypothetical protein PHAVU_002G331400g             202   6e-57   
emb|CDP05105.1|  unnamed protein product                                202   6e-57   
ref|XP_009759771.1|  PREDICTED: probable inactive receptor kinase...    202   7e-57   
ref|XP_009628885.1|  PREDICTED: probable inactive receptor kinase...    202   7e-57   
gb|KJB10488.1|  hypothetical protein B456_001G203900                    201   7e-57   
gb|ACN30771.1|  unknown                                                 202   7e-57   
gb|KHG20593.1|  putative inactive receptor kinase -like protein         201   7e-57   
ref|XP_011022559.1|  PREDICTED: probable inactive receptor kinase...    201   7e-57   
ref|XP_008466324.1|  PREDICTED: probable inactive receptor kinase...    202   8e-57   
emb|CBI33513.3|  unnamed protein product                                201   8e-57   
gb|KHN09234.1|  Putative inactive receptor kinase                       196   9e-57   
ref|XP_007141021.1|  hypothetical protein PHAVU_008G160700g             201   9e-57   
ref|XP_010271320.1|  PREDICTED: probable inactive receptor kinase...    202   9e-57   
ref|NP_001168844.1|  uncharacterized LOC100382649 precursor             202   9e-57   
ref|XP_011026938.1|  PREDICTED: probable inactive receptor kinase...    201   1e-56   
ref|XP_004163815.1|  PREDICTED: probable inactive receptor kinase...    202   1e-56   
ref|XP_008381374.1|  PREDICTED: probable inactive receptor kinase...    191   1e-56   
ref|XP_011026937.1|  PREDICTED: probable inactive receptor kinase...    201   1e-56   
ref|XP_002871141.1|  hypothetical protein ARALYDRAFT_325150             201   1e-56   
ref|XP_002276147.1|  PREDICTED: probable inactive receptor kinase...    201   1e-56   
ref|XP_009629119.1|  PREDICTED: probable inactive receptor kinase...    201   1e-56   
gb|EMT33198.1|  hypothetical protein F775_43654                         196   1e-56   
ref|XP_008660393.1|  PREDICTED: probable inactive receptor kinase...    201   1e-56   
ref|XP_011073578.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_004245544.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
gb|KEH40435.1|  LRR receptor-like kinase                                200   2e-56   
ref|XP_003525182.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_010104998.1|  putative inactive receptor kinase                  201   2e-56   
ref|XP_004503256.1|  PREDICTED: probable inactive receptor kinase...    202   2e-56   
ref|XP_003530064.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|NP_001152341.1|  LOC100285980 precursor                             201   2e-56   
ref|XP_008775508.1|  PREDICTED: LOW QUALITY PROTEIN: probable ina...    201   2e-56   
gb|AFW89165.1|  putative leucine-rich repeat receptor-like protei...    201   2e-56   
ref|NP_196135.1|  putative leucine-rich repeat receptor-like prot...    201   2e-56   
ref|XP_009799943.1|  PREDICTED: probable inactive receptor kinase...    201   2e-56   
ref|XP_002972265.1|  hypothetical protein SELMODRAFT_267563             199   3e-56   
ref|XP_007036910.1|  Receptor-like kinase 1                             200   3e-56   
ref|NP_001168611.1|  uncharacterized LOC100382395 precursor             200   3e-56   
ref|XP_001752185.1|  predicted protein                                  200   4e-56   
ref|XP_010676354.1|  PREDICTED: probable inactive receptor kinase...    199   4e-56   
ref|XP_007160136.1|  hypothetical protein PHAVU_002G295600g             200   4e-56   
ref|XP_006651742.1|  PREDICTED: probable inactive receptor kinase...    199   4e-56   
ref|XP_002984179.1|  hypothetical protein SELMODRAFT_156455             199   4e-56   
ref|XP_010688116.1|  PREDICTED: probable inactive receptor kinase...    200   5e-56   
ref|XP_006343895.1|  PREDICTED: probable inactive receptor kinase...    199   5e-56   
emb|CAN82203.1|  hypothetical protein VITISV_018964                     199   6e-56   
ref|XP_010916205.1|  PREDICTED: probable inactive receptor kinase...    200   6e-56   
ref|XP_009400513.1|  PREDICTED: probable inactive receptor kinase...    199   7e-56   
ref|XP_006422104.1|  hypothetical protein CICLE_v10004549mg             199   7e-56   
ref|XP_006413522.1|  hypothetical protein EUTSA_v10024674mg             199   9e-56   
ref|NP_194105.1|  Leucine-rich repeat protein kinase family protein     199   9e-56   
ref|XP_006350601.1|  PREDICTED: probable inactive receptor kinase...    199   9e-56   
ref|XP_002533427.1|  ATP binding protein, putative                      199   1e-55   
ref|XP_010671535.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_004985160.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_009617419.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_010036979.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
ref|XP_004250172.1|  PREDICTED: probable inactive receptor kinase...    199   1e-55   
gb|EYU24506.1|  hypothetical protein MIMGU_mgv1a0087053mg               191   1e-55   
gb|AGL74765.1|  ovary receptor kinase 11                                198   1e-55   
gb|AGO98727.1|  ovary receptor kinase 11                                198   1e-55   
ref|XP_002869766.1|  hypothetical protein ARALYDRAFT_914223             198   1e-55   
gb|KJB19053.1|  hypothetical protein B456_003G082600                    198   2e-55   



>ref|XP_009590190.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009590191.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=645

 Score =   289 bits (740),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVI  505
            G+AHIHSV G +L HGNI+SSNVLLT D +GCISD GLTPLMG  TIP RSAGYRAPEVI
Sbjct  461  GIAHIHSVAGGKLIHGNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIPSRSAGYRAPEVI  520

Query  504  ETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAEL  325
            ETRK TQKSDVYS GV LLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFDAEL
Sbjct  521  ETRKCTQKSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAEL  580

Query  324  INYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXRS  145
            I + Q+++DEMVQ+LQ+AMACV KVPE RP M++VV+MIE+I+Q D  NRPS EDNK RS
Sbjct  581  IKF-QNIQDEMVQMLQIAMACVAKVPETRPDMNQVVQMIEDIQQSDSGNRPSSEDNKSRS  639

Query  144  PSS  136
            P+S
Sbjct  640  PTS  642



>ref|XP_004246956.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=633

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 155/183 (85%), Gaps = 1/183 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVI  505
            G+AHIH+V G +L HGNIKSSNVLLTQD +GCISD GLTPLMGF TIP RSAGYRAPEVI
Sbjct  449  GIAHIHAVSGGKLIHGNIKSSNVLLTQDNSGCISDVGLTPLMGFPTIPSRSAGYRAPEVI  508

Query  504  ETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAEL  325
            ET+K TQKSDVYS GV LLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFD EL
Sbjct  509  ETKKCTQKSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDTEL  568

Query  324  INYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXRS  145
            I + Q+ EDEMVQ+LQ+AMACV  VPE RP M ++V+MIE+I+Q D  NRPS EDNK RS
Sbjct  569  IKF-QNNEDEMVQMLQIAMACVANVPETRPGMSQIVQMIEDIQQIDSGNRPSSEDNKSRS  627

Query  144  PSS  136
            P+S
Sbjct  628  PTS  630



>ref|XP_009772876.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=648

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVI  505
            G+AHIHSV G +L HGNI+SSNVLLT D +GCISD GLTPLMG  TIP RSAGYRAPEVI
Sbjct  464  GIAHIHSVTGGKLIHGNIRSSNVLLTHDNSGCISDVGLTPLMGSPTIPSRSAGYRAPEVI  523

Query  504  ETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAEL  325
            ETRK TQKSDVYS GV LLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFDAEL
Sbjct  524  ETRKCTQKSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDAEL  583

Query  324  INYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXRS  145
            I + Q++EDEMVQ+LQ+AM CV KVPE RP M++VV+MIE+I+Q D  NRPS EDNK RS
Sbjct  584  IKF-QNIEDEMVQMLQIAMTCVAKVPETRPDMNQVVQMIEDIQQSDSGNRPSSEDNKSRS  642

Query  144  PSS  136
            P+S
Sbjct  643  PTS  645



>ref|XP_006356869.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006356870.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=653

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 154/183 (84%), Gaps = 1/183 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVI  505
            G+AHIH+V G +L HGNIKSSNVLLT D NGCISD GLTPLMGF TIP +SAGYRAPEVI
Sbjct  469  GIAHIHAVSGGKLIHGNIKSSNVLLTHDNNGCISDVGLTPLMGFPTIPSKSAGYRAPEVI  528

Query  504  ETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAEL  325
            ET+K TQKSDVYS GV LLELLTGKAPVQ    +EVVDLP+WVQSVVREEWTAEVFD EL
Sbjct  529  ETKKCTQKSDVYSFGVLLLELLTGKAPVQPPGHDEVVDLPRWVQSVVREEWTAEVFDVEL  588

Query  324  INYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXRS  145
            I + Q++EDEMVQ+LQ+AM CV  VPE RP M +VV+MIE+I+Q D  NRPS EDNK RS
Sbjct  589  IKF-QNIEDEMVQMLQIAMTCVANVPETRPDMSQVVQMIEDIQQIDSGNRPSSEDNKSRS  647

Query  144  PSS  136
            P+S
Sbjct  648  PTS  650



>ref|XP_007207849.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
 gb|EMJ09048.1| hypothetical protein PRUPE_ppa022997mg, partial [Prunus persica]
Length=623

 Score =   286 bits (731),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G + THGNIKSSNVLLTQDLNG ISDFGL PLM F TIP RS GYRAPEV
Sbjct  438  KGLAHIHSASGGKFTHGNIKSSNVLLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEV  497

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  498  IETKKSFQKSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  557

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP M+EVVRMIEEIR PD  NRPS EDN+ +
Sbjct  558  LMRY-QNIEEELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNRSK  616



>gb|KHN40997.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGN+KSSNVLL  D +GCISDFGLTPLM     P R+AGYRAPEV
Sbjct  67   RGIAHIHSVGGPKFTHGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPSRAAGYRAPEV  126

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS G+ LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  127  IETRKHTHKSDVYSFGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  186

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEEIR  D  NRPS E+N+ +
Sbjct  187  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMDEVVRMIEEIRLSDSENRPSSEENRSK  245

Query  147  SPSS  136
              S+
Sbjct  246  EESA  249



>ref|XP_008244615.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Prunus mume]
Length=554

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN LLTQDLNG ISDFGL PLM F TIP RS GYRAPEV
Sbjct  369  KGLAHIHSASGGKFIHGNIKSSNALLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEV  428

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  429  IETKKSFQKSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  488

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP M+EVVRMIEEIR PD  NRPS EDN+ +
Sbjct  489  LMRY-QNIEEELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNRSK  547



>gb|KHN30614.1| Putative inactive receptor kinase [Glycine soja]
Length=253

 Score =   272 bits (696),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G +  HGN+KSSNVLL QD +GCISDFGLTPLM   + P R+AGYRAPEV
Sbjct  67   RGIAHIHSVGGPKFAHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPSRAAGYRAPEV  126

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  127  IETRKHTHKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  186

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIR  D  NRPS E+N+ +
Sbjct  187  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIRLSDSENRPSSEENRSK  245

Query  147  SPSS  136
              S+
Sbjct  246  EEST  249



>emb|CDP04037.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   272 bits (695),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGN+KSSNVLL QDL+GC+SD GL PLM F     R AGYRAPEV
Sbjct  67   RGIAHIHSVGGPKFTHGNVKSSNVLLNQDLDGCVSDLGLAPLMNFPATRSRQAGYRAPEV  126

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  127  METRKHTHKSDVYSFGVLLLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  186

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  187  LMRF-QNIEEEMVQMLQIAMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  245



>gb|KHN24722.1| Putative inactive receptor kinase, partial [Glycine soja]
Length=327

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  142  KGLAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEV  201

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  202  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  261

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDE VRMIEEIRQ D  NRPS E+NK +
Sbjct  262  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENKSK  320



>gb|EYU36892.1| hypothetical protein MIMGU_mgv1a0177021mg, partial [Erythranthe 
guttata]
Length=208

 Score =   269 bits (687),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH HS  GA+ THGNIKSSNVLL QDL GC+SDFGL PLM       RSAGYRAPEV
Sbjct  23   KGIAHAHSAGGAKFTHGNIKSSNVLLNQDLEGCVSDFGLAPLMNHPATTSRSAGYRAPEV  82

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLE+LTGK P  S A+++++DLP+WVQSVVREEWTAEVFD E
Sbjct  83   VETRKHTHKSDVYSFGVILLEMLTGKQPTSSPARDDIIDLPRWVQSVVREEWTAEVFDVE  142

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV K P+MRP MDEVVRMIEE+RQ D  NRPS ++NK +
Sbjct  143  LMRF-QNIEEEMVQMLQIAMACVAKAPDMRPNMDEVVRMIEEVRQSDSENRPSSDENKSK  201



>ref|XP_008244579.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244587.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244595.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244604.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
 ref|XP_008244609.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Prunus mume]
Length=633

 Score =   281 bits (720),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN LLTQDLNG ISDFGL PLM F TIP RS GYRAPEV
Sbjct  448  KGLAHIHSASGGKFIHGNIKSSNALLTQDLNGSISDFGLAPLMNFATIPSRSVGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  508  IETKKSFQKSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP M+EVVRMIEEIR PD  NRPS EDN+ +
Sbjct  568  LMRY-QNIEEELVQMLQIAMACVARVPDMRPTMEEVVRMIEEIRPPDSDNRPSSEDNRSK  626



>ref|XP_010252005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252007.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252008.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252009.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252010.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010252011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=676

 Score =   282 bits (722),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH+  G + THGNIKSSNVLL QD +GCISDFGL PLM F   P RS GYRAPEV
Sbjct  491  RGIAHIHAEGGGKFTHGNIKSSNVLLNQDQDGCISDFGLVPLMNFPVTPSRSVGYRAPEV  550

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLELLTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  551  IETRKPTQKSDVYSFGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVE  610

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRPKM+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  611  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPKMEEVVRMIEEIRQSDSENRPSSEENKSK  669



>ref|XP_002533837.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF28551.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=635

 Score =   280 bits (716),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+HS  G + THGNIKSSNVLL QD +GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  450  RGIAHLHSAGGPKFTHGNIKSSNVLLNQDHDGCISDFGLTPLMNVPATPSRSAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS +++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETRKHTHKSDVYSFGVLLLEMLTGKAPLQSPSRDDMVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  570  LMRY-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEIRQSDSENRPSSEENKSK  628



>ref|XP_010098027.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB74410.1| putative inactive receptor kinase [Morus notabilis]
Length=711

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 154/184 (84%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +  HGNIKSSNVLL+QDL+GCISDFGL PLM F  IP RS GYRAPEV
Sbjct  526  RGIAHIHSAAGGKFVHGNIKSSNVLLSQDLSGCISDFGLAPLMNFPAIPSRSIGYRAPEV  585

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK +QKSDVYS GV LLE+LTGKAPVQS  +++V DLP+WVQSVVREEWTAEVFD E
Sbjct  586  IETRKFSQKSDVYSFGVILLEMLTGKAPVQSPGRDDVADLPRWVQSVVREEWTAEVFDVE  645

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AMACV KVP+MRP M+EVVRMIEEIR  D  +RPS EDNK +
Sbjct  646  LMKY-QNIEEELVQMLQIAMACVAKVPDMRPTMEEVVRMIEEIRPSDSESRPSPEDNKSK  704

Query  147  SPSS  136
             P +
Sbjct  705  GPET  708



>ref|XP_010244554.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244555.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244556.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244557.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
 ref|XP_010244558.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nelumbo 
nucifera]
Length=642

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +  HGNIKSSNVLLTQD +GCISDFGL  LM F  IP RS GYRAPEV
Sbjct  457  RGIAHIHSEGGGKFIHGNIKSSNVLLTQDQDGCISDFGLASLMNFPVIPSRSVGYRAPEV  516

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLELLTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  517  IETRKPTQKSDVYSFGVLLLELLTGKAPLQSPGHDDVVDLPRWVQSVVREEWTAEVFDVE  576

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP++RPKM+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  577  LMRY-QNIEEEMVQMLQIAMACVAKVPDVRPKMEEVVRMIEEIRQSDSENRPSSEENKSK  635



>ref|XP_009370892.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009370912.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=639

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSNVLLTQDLNG +SDFGL PLM  TTIP RS GYRAPEV
Sbjct  445  KGLAHIHSASGGKFIHGNIKSSNVLLTQDLNGSMSDFGLAPLMNLTTIPSRSVGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQ+   ++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  505  IETKKSFQKSDVYSFGVMLLEMLTGKAPVQTPGHDDVVDLPRWVQSVVREEWTAEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AM CV +VP+MRP M+EVVRMIEEIR PD  NRPS +DNK +
Sbjct  565  LMKY-QNIEEELVQMLQIAMTCVARVPDMRPTMEEVVRMIEEIRPPDSENRPSSDDNKSK  623



>ref|XP_002276162.3| PREDICTED: probable inactive receptor kinase At5g58300 [Vitis 
vinifera]
Length=666

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ HIHSV G + THGNIKSSNVLL QD  GCISDFGLTPLM F     R+AGYRAPEV
Sbjct  481  RGITHIHSVGGGKFTHGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSSRNAGYRAPEV  540

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  541  IESRKHTHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIE  600

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  601  LMRY-QNIEEEMVQMLQLAMACVAKVPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  659



>emb|CBI15804.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ HIHSV G + THGNIKSSNVLL QD  GCISDFGLTPLM F     R+AGYRAPEV
Sbjct  471  RGITHIHSVGGGKFTHGNIKSSNVLLNQDFEGCISDFGLTPLMNFPATSSRNAGYRAPEV  530

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  531  IESRKHTHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDIE  590

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  591  LMRY-QNIEEEMVQMLQLAMACVAKVPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  649



>ref|XP_004142674.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN54462.1| hypothetical protein Csa_4G334730 [Cucumis sativus]
Length=638

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN+LLTQDLNGCISDFGLTPLM    IP RS GYRAPEV
Sbjct  445  KGLAHIHSASGGKFIHGNIKSSNILLTQDLNGCISDFGLTPLMNSPAIPSRSVGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAP QS  +++V+DLP+WVQSVVREEWT+EVFD E
Sbjct  505  IETRKSTQKSDVYSFGVILLEMLTGKAPSQSPGRDDVMDLPRWVQSVVREEWTSEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP MD+VVRMIEEIR  D   RPS EDNK
Sbjct  565  LMKY-QNIEEELVQMLQIAMACVSRVPDMRPTMDDVVRMIEEIRSLDSGTRPSSEDNK  621



>ref|XP_004172749.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At5g58300-like [Cucumis sativus]
Length=638

 Score =   278 bits (711),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 151/178 (85%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN+LLTQDLNGCISDFGLTPLM    IP RS GYRAPEV
Sbjct  445  KGLAHIHSASGGKFIHGNIKSSNILLTQDLNGCISDFGLTPLMNSPAIPSRSVGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAP QS  +++V+DLP+WVQSVVREEWT+EVFD E
Sbjct  505  IETRKSTQKSDVYSFGVILLEMLTGKAPSQSPGRDDVMDLPRWVQSVVREEWTSEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP MD+VVRMIEEIR  D   RPS EDNK
Sbjct  565  LMKY-QNIEEELVQMLQIAMACVSRVPDMRPTMDDVVRMIEEIRSLDSGTRPSSEDNK  621



>gb|KDP45679.1| hypothetical protein JCGZ_17286 [Jatropha curcas]
Length=634

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HS  G + THGNIKSSNVLL Q+ +GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  449  KGIAHLHSAGGPKFTHGNIKSSNVLLNQEHDGCISDFGLTPLMNVPATPSRSAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS A++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  509  IETRKHTHKSDVYSFGVLLLEMLTGKAPLQSPARDDMVDLPRWVQSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_002528709.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33698.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=633

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G R  H NIKSSNVL+TQDL G +SDFGLTP+M +  +P R+AGYRAPEV
Sbjct  450  RGIAHIHSAAGGRFIHANIKSSNVLITQDLCGSVSDFGLTPIMSYPAVPSRTAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LTGKAPVQS  Q++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETRKPTQKSDVYSFGVLLLEMLTGKAPVQSTGQDDVVDLPRWVQSVVREEWTAEVFDLE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMVQ+LQ+AMACV +VP+MRP MDEVVRMIEEIR PD  N PS E+ K
Sbjct  570  LLKY-QNIEEEMVQMLQIAMACVARVPDMRPTMDEVVRMIEEIRVPDSLNHPSSEEYK  626



>gb|KDO54914.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
 gb|KDO54915.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=635

 Score =   277 bits (708),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGVAHIHS+ G + THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  450  RGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  570  LMRF-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  628



>ref|XP_006432052.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464957.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006464958.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR45292.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=635

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGVAHIHS+ G + THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  450  RGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  570  LMRF-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  628



>gb|KDO54912.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=672

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGVAHIHS+ G + THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  487  RGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEV  546

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  547  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVE  606

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  607  LMRF-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  665



>ref|XP_006432053.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
 ref|XP_006464956.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR45293.1| hypothetical protein CICLE_v10000513mg [Citrus clementina]
Length=672

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGVAHIHS+ G + THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  487  RGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEV  546

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  547  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVE  606

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  607  LMRF-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  665



>gb|KDO54913.1| hypothetical protein CISIN_1g005693mg [Citrus sinensis]
Length=682

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGVAHIHS+ G + THGNIK+SNVL+ QDL+GCISDFGLTPLM     P RSAGYRAPEV
Sbjct  497  RGVAHIHSMGGPKFTHGNIKASNVLINQDLDGCISDFGLTPLMNVPATPSRSAGYRAPEV  556

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  557  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPTRDDMVDLPRWVQSVVREEWTAEVFDVE  616

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+ MACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  617  LMRF-QNIEEEMVQMLQIGMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  675



>ref|XP_011041763.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=510

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HSV G + THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEV
Sbjct  325  RGISHLHSVGGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEV  384

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  385  IETRKHTHKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  444

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  445  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENKSK  503



>ref|XP_008355739.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=639

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSNVLLTQDL G ISDFGL  LM  TTIP RS GYRAPEV
Sbjct  445  KGLAHIHSASGGKFIHGNIKSSNVLLTQDLYGSISDFGLALLMNLTTIPSRSVGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQS+ +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  505  IETKKSFQKSDVYSFGVMLLEMLTGKAPVQSSGRDDVVDLPRWVQSVVREEWTAEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AM CV +VP+MRP M+EVVRMIEEIR PD  NRPS +DNK +
Sbjct  565  LMKY-QNIEEELVQMLQIAMTCVARVPDMRPTMEEVVRMIEEIRPPDSENRPSSDDNKSK  623



>ref|XP_003519295.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006575457.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_006575458.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=654

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGN+KSSNVLL  D +GCISDFGLTPLM     P R+AGYRAPEV
Sbjct  468  RGIAHIHSVGGPKFTHGNVKSSNVLLNHDNDGCISDFGLTPLMNVPATPSRAAGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS G+ LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  528  IETRKHTHKSDVYSFGILLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEEIR  D  NRPS E+N+ +
Sbjct  588  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMDEVVRMIEEIRLSDSENRPSSEENRSK  646

Query  147  SPSS  136
              S+
Sbjct  647  EESA  650



>ref|XP_008463277.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463278.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463279.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463281.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463282.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008463283.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=640

 Score =   274 bits (700),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 149/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN+LLTQD NGCISDFGLTPLM    IP RS GYRAPEV
Sbjct  445  KGLAHIHSASGGKFIHGNIKSSNILLTQDPNGCISDFGLTPLMNSPAIPSRSVGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAP QS  +++V+DLP+WVQSVVREEWT+EVFD E
Sbjct  505  IETRKSTQKSDVYSFGVVLLEMLTGKAPSQSPGRDDVIDLPRWVQSVVREEWTSEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+E+VQ+LQ+AMACV +VP+MRP MDEVVRMIEEIR      RPS EDNK
Sbjct  565  LMKY-QNIEEELVQMLQIAMACVSRVPDMRPTMDEVVRMIEEIRSLHSGTRPSSEDNK  621



>gb|KHN18649.1| Putative inactive receptor kinase [Glycine soja]
Length=585

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  403  KGLAHVHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEV  462

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  463  IEARKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  522

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  523  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  581



>ref|XP_003544939.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
Length=656

 Score =   274 bits (701),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G +  HGN+KSSNVLL QD +GCISDFGLTPLM   + P R+AGYRAPEV
Sbjct  470  RGIAHIHSVGGPKFAHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPSTPSRAAGYRAPEV  529

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  530  IETRKHTHKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  589

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIR  D  NRPS E+N+ +
Sbjct  590  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIRLSDSENRPSSEENRSK  648

Query  147  SPSS  136
              S+
Sbjct  649  EEST  652



>ref|XP_006591269.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=670

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  485  KGLAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEV  544

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  545  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  604

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDE VRMIEEIRQ D  NRPS E+NK +
Sbjct  605  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENKSK  663



>ref|XP_003537367.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006591268.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=671

 Score =   274 bits (701),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  486  KGLAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRAAGYRAPEV  545

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  546  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  605

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDE VRMIEEIRQ D  NRPS E+NK +
Sbjct  606  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEAVRMIEEIRQSDSENRPSSEENKSK  664



>ref|XP_009374410.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=634

 Score =   273 bits (698),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 154/180 (86%), Gaps = 2/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKS+NVLL+QDLNGCISD GLTPLM  +    RSAGYRAPEV
Sbjct  450  RGIAHIHSVGGLKFTHGNIKSTNVLLSQDLNGCISDVGLTPLMNVSATA-RSAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETR+ + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  509  IETRRHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_011089538.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
 ref|XP_011089539.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Sesamum indicum]
Length=636

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+HS+ GA+ THGNIKSSNVLL QDL+GC+SDFGL PLM   +   R AGYRAPEV
Sbjct  451  RGIAHLHSIGGAKFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLE+LTGK P+QS ++E++VDLP+WVQSVVREEWTAEVFD E
Sbjct  511  METRKHTHKSDVYSFGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP +DEVVRMIEE+RQ D  NRPS ++NK +
Sbjct  571  LMRF-QNIEEEMVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVRQSDSENRPSSDENKSK  629



>ref|XP_006602052.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X5 [Glycine max]
Length=640

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  458  KGLAHVHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEV  517

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  518  IEARKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  577

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  578  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  636



>ref|XP_003553192.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
 ref|XP_006602051.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X4 [Glycine max]
Length=654

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  472  KGLAHVHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEV  531

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  532  IEARKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  591

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  592  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  650



>ref|XP_006602049.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
Length=668

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  486  KGLAHVHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEV  545

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  546  IEARKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  605

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  606  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  664



>ref|XP_011089537.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Sesamum indicum]
Length=655

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 153/180 (85%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+HS+ GA+ THGNIKSSNVLL QDL+GC+SDFGL PLM   +   R AGYRAPEV
Sbjct  470  RGIAHLHSIGGAKFTHGNIKSSNVLLNQDLDGCVSDFGLAPLMNHPSTSSRHAGYRAPEV  529

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLE+LTGK P+QS ++E++VDLP+WVQSVVREEWTAEVFD E
Sbjct  530  METRKHTHKSDVYSFGVILLEMLTGKQPIQSPSREDIVDLPRWVQSVVREEWTAEVFDVE  589

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP +DEVVRMIEE+RQ D  NRPS ++NK +
Sbjct  590  LMRF-QNIEEEMVQMLQIAMACVAKVPDMRPSIDEVVRMIEEVRQSDSENRPSSDENKSK  648



>ref|XP_006602050.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=667

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+HSV G + THGNIKSSNVLL QD +GCISDFGL PLM     P R+AGYRAPEV
Sbjct  485  KGLAHVHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAPLMNVPATPSRTAGYRAPEV  544

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  545  IEARKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  604

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  605  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRQSDSENRPSSEENKSK  663



>ref|XP_002325632.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEF00014.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=636

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HSV G + THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEV
Sbjct  451  RGISHLHSVGGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  511  IETRKHTHKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  571  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENKSK  629



>ref|XP_010094441.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXB56022.1| putative inactive receptor kinase [Morus notabilis]
Length=634

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS+ G + THGN+K+SNVLL QDL+GCISDFGLTPLM     P RS GYRAPEV
Sbjct  449  KGIAHIHSMGGPKFTHGNVKASNVLLNQDLDGCISDFGLTPLMNAHATPSRSVGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WV SVVREEWTAEVFD E
Sbjct  509  IETRKYTHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVHSVVREEWTAEVFDIE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M++VVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIAMACVTKVPDMRPSMEQVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_007033487.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007033488.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04413.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY04414.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G + +HGNIKSSNVLL QDL+GCISDFGLT LM F  +P RSAGYRAPEV
Sbjct  454  KGIAYIHSCAGGKFSHGNIKSSNVLLNQDLHGCISDFGLTSLMSFPAVPSRSAGYRAPEV  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LTGK+PVQ +  E+VVDLP+WVQSVVREEWTAEVFD E
Sbjct  514  IETRKFTQKSDVYSFGVLLLEMLTGKSPVQLSGHEDVVDLPRWVQSVVREEWTAEVFDVE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AM CV ++P+MRP M+EV RM+EEIR  D  NRPS EDN+ +
Sbjct  574  LMKY-QNVEEELVQMLQIAMTCVARLPDMRPTMEEVTRMMEEIRPSDSENRPSSEDNRSK  632

Query  147  SPSS  136
              ++
Sbjct  633  GSNT  636



>ref|XP_011041759.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041760.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041761.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011041762.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=636

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HSV G + THGNIKS+NVLL+QD +GCISDFGLTPLM       RSAGYRAPEV
Sbjct  451  RGISHLHSVGGPKFTHGNIKSTNVLLSQDHDGCISDFGLTPLMNVPATSSRSAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  511  IETRKHTHKSDVYSFGVVLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  571  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENKSK  629



>ref|XP_010683445.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683446.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683447.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010683448.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=643

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 154/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G R THGNIKSSNV L++D+NGCISDFGL PLM F  +PPR+AGYRAPE 
Sbjct  456  KGIAHIHSAAGGRFTHGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVPPRTAGYRAPET  515

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK TQKSDVYS GV LLELLTGK PVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  516  VETRKITQKSDVYSFGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTE  575

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS--XEDNK  154
            L+  +Q++E+E+VQ+LQ+AMACV KVP++RP M EVVRMIEE RQ D  +RPS   E +K
Sbjct  576  LMR-NQNIEEELVQMLQIAMACVSKVPDLRPDMGEVVRMIEETRQSDSSSRPSPEAEGSK  634

Query  153  XRSPSS  136
             ++P +
Sbjct  635  SKAPET  640



>ref|XP_008384658.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=634

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKS+NVLL+QDLNGCISD GLTPLM       RSAGYRAPEV
Sbjct  450  RGIAHIHSVGGPKFTHGNIKSTNVLLSQDLNGCISDVGLTPLMNVPATA-RSAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETR+ + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  509  IETRRHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPSMEEVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_010683449.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=641

 Score =   271 bits (694),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 154/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G R THGNIKSSNV L++D+NGCISDFGL PLM F  +PPR+AGYRAPE 
Sbjct  454  KGIAHIHSAAGGRFTHGNIKSSNVFLSEDVNGCISDFGLAPLMSFPAVPPRTAGYRAPET  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK TQKSDVYS GV LLELLTGK PVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  514  VETRKITQKSDVYSFGVLLLELLTGKTPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDTE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS--XEDNK  154
            L+  +Q++E+E+VQ+LQ+AMACV KVP++RP M EVVRMIEE RQ D  +RPS   E +K
Sbjct  574  LMR-NQNIEEELVQMLQIAMACVSKVPDLRPDMGEVVRMIEETRQSDSSSRPSPEAEGSK  632

Query  153  XRSPSS  136
             ++P +
Sbjct  633  SKAPET  638



>ref|XP_007142022.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 ref|XP_007142023.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14016.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
 gb|ESW14017.1| hypothetical protein PHAVU_008G245900g [Phaseolus vulgaris]
Length=655

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 152/184 (83%), Gaps = 1/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGN+KSSNVLL QD +GCISDFGLTPLM     P R+AGYRAPEV
Sbjct  469  RGIAHIHSVGGPKFTHGNVKSSNVLLNQDNDGCISDFGLTPLMNVPATPSRAAGYRAPEV  528

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  529  IETRKHSHKSDVYSFGVLLLEMLTGKAPQQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  588

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EV RMIEEIR  D  NRPS E+N+ +
Sbjct  589  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPTMEEVARMIEEIRLSDSENRPSSEENRSK  647

Query  147  SPSS  136
              S+
Sbjct  648  EEST  651



>gb|KEH34523.1| LRR receptor-like kinase [Medicago truncatula]
Length=650

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEV
Sbjct  465  RGMAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPSRAAGYRAPEV  524

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  525  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  584

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVV+MIEEIRQ D  NRPS E+NK +
Sbjct  585  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPNMDEVVKMIEEIRQSDSENRPSSEENKSK  643



>ref|XP_004294716.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=630

 Score =   271 bits (693),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 152/178 (85%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEV
Sbjct  447  RGIAHIHSVGGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATS-RSAGYRAPEV  505

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  506  IETRKHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  565

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIE+IRQ D  NRPS EDNK
Sbjct  566  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEDIRQSDSENRPSSEDNK  622



>ref|XP_004500388.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=647

 Score =   271 bits (693),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEV
Sbjct  462  RGIAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLAALMNVPATPSRAAGYRAPEV  521

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  522  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  581

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVRMIEEIR  D  NRPS E+NK +
Sbjct  582  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRMIEEIRLSDSENRPSSEENKSK  640



>ref|XP_003600547.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES70798.1| LRR receptor-like kinase [Medicago truncatula]
Length=660

 Score =   271 bits (694),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEV
Sbjct  475  RGMAHIHSVGGPKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPANPSRAAGYRAPEV  534

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  535  IETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  594

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVV+MIEEIRQ D  NRPS E+NK +
Sbjct  595  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPNMDEVVKMIEEIRQSDSENRPSSEENKSK  653



>ref|XP_007017100.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY34719.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=671

 Score =   271 bits (694),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H + G + THGN+KSSNVLL QD +GCISD GLTPLM     P R+AGYRAPEV
Sbjct  486  RGIAHVHFMGGPKFTHGNVKSSNVLLNQDHDGCISDLGLTPLMNVPVTPSRTAGYRAPEV  545

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  546  IETRKHTHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  605

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  606  LMRF-QNIEEEMVQMLQIAMACVAKVPDMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  664



>ref|XP_006358156.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358157.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Solanum tuberosum]
Length=635

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G + THGNIKSSNVLLT+DL+GCISDFGLTPLM + +   R AGYRAPEV
Sbjct  449  KGIAHIHTEGGVKFTHGNIKSSNVLLTRDLDGCISDFGLTPLMNYISYKYRCAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LTGK+P+  + Q+EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  509  IETRKGTQKSDVYSFGVLLLEMLTGKSPLPLSGQDEVVDLPRWVRSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ +ACV KVP+MRP M EVVRMIEEIRQP+   RPS ED++ +
Sbjct  569  LLKY-QNIEEEMVQMLQIGLACVAKVPDMRPAMGEVVRMIEEIRQPEGETRPSSEDSRSK  627



>ref|XP_004302522.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466405.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=633

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSN+L+TQDLNGCISDFGLTPLM F TIP RS GYRAPEV
Sbjct  448  KGLAHIHSSGGGKFIHGNIKSSNILITQDLNGCISDFGLTPLMNFATIPSRSVGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RKS QKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  508  IEARKSFQKSDVYSFGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRP  172
            L+ + Q++E+E+VQ+LQ+AMACV  VP++RP M+EVV+MIE+IR PD  NRP
Sbjct  568  LMRF-QNIEEELVQMLQIAMACVQNVPDLRPTMEEVVKMIEDIRPPDSENRP  618



>gb|KDP21848.1| hypothetical protein JCGZ_00635 [Jatropha curcas]
Length=657

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +  HGNIKSSN+LLTQDL G ISDFGLTP+M + ++P RSAGYRAPEV
Sbjct  475  RGIAHIHSAGGGKFIHGNIKSSNLLLTQDLRGRISDFGLTPIMSYPSVPARSAGYRAPEV  534

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAPVQS  Q+EVVDLP+WVQSVVREEWTAEVFD E
Sbjct  535  IETRKSTQKSDVYSFGVLLLEMLTGKAPVQSTGQDEVVDLPRWVQSVVREEWTAEVFDVE  594

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AM+CV +VP+ RP M+EVVRMIEEIR  D  N  S E+ +  
Sbjct  595  LMRY-QNIEEEMVQMLQIAMSCVARVPDTRPTMNEVVRMIEEIRPTDSVNHTSEENTESN  653

Query  147  S  145
            +
Sbjct  654  T  654



>ref|XP_007146903.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
 gb|ESW18897.1| hypothetical protein PHAVU_006G080200g [Phaseolus vulgaris]
Length=657

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 152/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV G++ THGNIKSSNVLL QD +GCISDFGL  LM     P R+AGYRAPEV
Sbjct  472  KGLAHIHSVGGSKFTHGNIKSSNVLLNQDNDGCISDFGLASLMNVPATPSRAAGYRAPEV  531

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  532  VETRKHSHKSDVYSFGVLLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  591

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV K+P+MRP MDEVVR+IEEIRQ D  NRPS E+NK +
Sbjct  592  LMRY-QNIEEEMVQMLQIAMACVAKMPDMRPSMDEVVRLIEEIRQSDSENRPSSEENKSK  650



>ref|XP_009758202.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=652

 Score =   270 bits (691),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS+ G ++THGNIKSSNVLL QD+  C+SDFGL P+M F   P R  GYRAPEV
Sbjct  467  RGIAHIHSMGGPKVTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPSRHPGYRAPEV  526

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  527  IETRKHTHKSDVYSFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  586

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACVG+VP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  587  LMRF-QNIEEEMVQMLQIAMACVGRVPDMRPTMDEVVRMIEEVRQSDSDNRPSSEENKSK  645



>ref|XP_006374053.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|ERP51850.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=626

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 152/178 (85%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G +  HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RSAGYRAPEV
Sbjct  446  KGIAYIHSACGGKFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSAGYRAPEV  505

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRKSTQKSDVYS GV LLE+LTGKAPVQS   ++V+DLP+WVQSVVREEWTAEVFD E
Sbjct  506  IDTRKSTQKSDVYSFGVVLLEMLTGKAPVQSPGHDDVIDLPRWVQSVVREEWTAEVFDEE  565

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMV++LQ+AMACV  VP+MRP M+EVVRMIEE+   +  NRPS E+NK
Sbjct  566  LMRY-QNIEEEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  622



>ref|XP_007208318.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
 gb|EMJ09517.1| hypothetical protein PRUPE_ppa002781mg [Prunus persica]
Length=634

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS+ G + THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEV
Sbjct  450  RGIAHIHSMGGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT-RSAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  509  IETRKHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_008239856.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=634

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 2/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS+ G + THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEV
Sbjct  450  RGIAHIHSMGGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATT-RSAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  509  IETRKHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D  NRPS E+NK +
Sbjct  569  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEENKSK  627



>ref|XP_003616055.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula]
 gb|AES99013.1| receptor-like kinase [Medicago truncatula]
Length=651

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G R THGN+KSSNVLL QD +GCISDFGLTPLM     P R+ GYRAPEV
Sbjct  466  RGIAHLHLVGGPRFTHGNVKSSNVLLNQDNDGCISDFGLTPLMNIPATPSRTMGYRAPEV  525

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP QS  ++++VDLP+WV+SVVREEWTAEVFD E
Sbjct  526  IETRKHTHKSDVYSFGVLLLEMLTGKAPQQSPVRDDMVDLPRWVRSVVREEWTAEVFDVE  585

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS +DNK +
Sbjct  586  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSDNRPSSDDNKSK  644



>ref|XP_009592168.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=652

 Score =   269 bits (687),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ HIHS+ G ++THGNIKSSNVLL QD+  C+SDFGL P+M F   P R  GYRAPEV
Sbjct  467  RGITHIHSMGGPKVTHGNIKSSNVLLNQDMEACVSDFGLAPVMNFPAAPSRHPGYRAPEV  526

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  527  IETRKHTHKSDVYSFGVLMLEMLTGKQPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  586

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACVG+VP+MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  587  LMRF-QNIEEEMVQMLQIAMACVGRVPDMRPTMDEVVRMIEEVRQSDSDNRPSSEENKSK  645



>ref|XP_004490727.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004490728.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
Length=653

 Score =   269 bits (687),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+HSV G + THGN+KSSNVLL QD + CISDFGLTP M     P R+ GYRAPEV
Sbjct  468  RGIAHLHSVGGPKFTHGNVKSSNVLLNQDNDSCISDFGLTPFMNVPATPSRAIGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  528  IETRKHTHKSDVYSFGVLLLEMLTGKAPQQSPVRDDMVDLPRWVQSVVREEWTAEVFDVE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ MACV KVP+MRP M+EVVRMIEEIRQ D  NRPS ++NK +
Sbjct  588  LMRY-QNIEEEMVQMLQIGMACVAKVPDMRPNMEEVVRMIEEIRQSDSDNRPSSDENKSK  646



>ref|XP_004235218.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318222.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318223.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
 ref|XP_010318224.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=635

 Score =   268 bits (685),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G + THGNIKSSNVLLT+DL+GCISDFGLTP+M + +   R AGYRAPEV
Sbjct  449  KGIAHIHTEGGVKFTHGNIKSSNVLLTRDLDGCISDFGLTPMMNYISFKYRCAGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LTGK+P+    Q+EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  509  IETRKGTQKSDVYSFGVLLLEMLTGKSPLPLPGQDEVVDLPRWVRSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ +ACV KVP+MRP M EVVRMIEEIRQP    RPS ED++ +
Sbjct  569  LLKY-QNIEEEMVQMLQIGLACVAKVPDMRPAMGEVVRMIEEIRQPQGETRPSSEDSRSK  627



>ref|XP_004139930.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 ref|XP_004154555.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cucumis 
sativus]
 gb|KGN46766.1| hypothetical protein Csa_6G133750 [Cucumis sativus]
Length=630

 Score =   268 bits (684),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH++ G + THGNIK+SNVLL QD+N C+SDFGLTPLM   T   R+AGYRAPEV
Sbjct  447  KGIAHIHAMGGPKFTHGNIKASNVLLIQDVNACVSDFGLTPLMNVPT--SRTAGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK T KSDVYS GV LLE+LTGKAP+QS  ++E+VDLP+WVQSVVREEWTAEVFD E
Sbjct  505  IEARKHTHKSDVYSFGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AM CV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  565  LMRY-QNIEEEMVQMLQIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDSENRPSSEENKSK  623



>ref|XP_008456255.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
 ref|XP_008456256.1| PREDICTED: probable inactive receptor kinase At5g58300 [Cucumis 
melo]
Length=630

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+V G + THGNIK+SNVLL Q++N C+SDFGLTPLM   T   R+AGYRAPEV
Sbjct  447  KGIAHIHAVGGPKFTHGNIKASNVLLIQEINACVSDFGLTPLMNVPT--SRTAGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK T KSDVYS GV LLE+LTGKAP+QS  ++E+VDLP+WVQSVVREEWTAEVFD E
Sbjct  505  IEARKHTHKSDVYSFGVLLLEMLTGKAPLQSPGRDEMVDLPRWVQSVVREEWTAEVFDVE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+AM CV K+P+MRP MDEVVRMIEEIRQ D  NRPS E+NK +
Sbjct  565  LMRY-QNIEEEMVQMLQIAMTCVAKLPDMRPNMDEVVRMIEEIRQSDSENRPSSEENKSK  623



>ref|XP_011084790.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084791.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084792.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084793.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084794.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084795.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084796.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084797.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011084800.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=635

 Score =   267 bits (682),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 152/183 (83%), Gaps = 1/183 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  GA+ THGNIKSSN+LL   L+GC+SDFGL+P+M +  I  R AGYRAPEV
Sbjct  450  RGLAHIHSEGGAKHTHGNIKSSNILLNASLDGCVSDFGLSPMMNYIPIKYRVAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK +QK+DVYS GV LLE+LTGK+P+Q    ++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  510  IETRKVSQKADVYSFGVVLLEMLTGKSPIQYTGYDDVVDLPRWVRSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+A+ACV KVP+MRP MDEVVRMIE+IRQ +  NRPS EDN+ +
Sbjct  570  LMKY-QNIEEEMVQMLQIALACVAKVPDMRPSMDEVVRMIEDIRQSELENRPSSEDNRSK  628

Query  147  SPS  139
              S
Sbjct  629  DSS  631



>ref|XP_011001675.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=586

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G    HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEV
Sbjct  406  KGIAYIHSACGGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEV  465

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRKSTQKSDVYS GV LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD E
Sbjct  466  IDTRKSTQKSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEE  525

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMV++LQ+AMACV  VP+MRP M+EVVRMIEE+   +  NRPS E+NK
Sbjct  526  LMRY-QNIEEEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  582



>gb|KJB20517.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20518.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20520.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
 gb|KJB20521.1| hypothetical protein B456_003G153000 [Gossypium raimondii]
Length=657

 Score =   266 bits (681),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HS+ G + THGNIKSSNVL+ Q+ +GCISD GLTPLM     P RS GYRAPEV
Sbjct  472  RGISHVHSMGGPKFTHGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPSRSVGYRAPEV  531

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  532  IETRKHTHKSDVYSFGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVE  591

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KV +MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  592  LMRF-QNIEEEMVQMLQIAMACVAKVADMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  650



>ref|XP_002319979.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|EEE95902.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=635

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HS  G + THGNIKSSNVLL+QD +GCISDFGLTPLM       RSAGYRAPEV
Sbjct  450  RGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET K + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS E NK +
Sbjct  570  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSK  628



>ref|XP_011001674.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=631

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G    HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEV
Sbjct  451  KGIAYIHSACGGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRKSTQKSDVYS GV LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD E
Sbjct  511  IDTRKSTQKSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMV++LQ+AMACV  VP+MRP M+EVVRMIEE+   +  NRPS E+NK
Sbjct  571  LMRY-QNIEEEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  627



>ref|XP_011011771.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011772.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011773.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011774.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
 ref|XP_011011775.1| PREDICTED: probable inactive receptor kinase At5g58300 [Populus 
euphratica]
Length=635

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HS  G + THGNIKSSNVLL+QD +GCISDFGLTPLM       RSAGYRAPEV
Sbjct  450  RGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET K + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ M CV KVP+MRP M+EVVRMIEEIRQ D  NRPS E NK +
Sbjct  570  LMRY-QNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSK  628



>ref|XP_011001671.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
 ref|XP_011001672.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=632

 Score =   266 bits (679),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 150/178 (84%), Gaps = 1/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G    HGNIKSSNVLL QDL+GCISDFGLTPL+ + ++P RS GYRAPEV
Sbjct  452  KGIAYIHSACGGNFIHGNIKSSNVLLMQDLHGCISDFGLTPLLSYPSVPSRSVGYRAPEV  511

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRKSTQKSDVYS GV LLE+LTGKAPVQS   ++++DLP+WVQSVVREEWTAEVFD E
Sbjct  512  IDTRKSTQKSDVYSFGVVLLEMLTGKAPVQSPGHDDLIDLPRWVQSVVREEWTAEVFDEE  571

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ Y Q++E+EMV++LQ+AMACV  VP+MRP M+EVVRMIEE+   +  NRPS E+NK
Sbjct  572  LMRY-QNIEEEMVEMLQIAMACVAVVPDMRPTMEEVVRMIEEVGPSESENRPSSEENK  628



>gb|KDO64166.1| hypothetical protein CISIN_1g006747mg [Citrus sinensis]
Length=632

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G +   GNIKSSNVLL+QDL GCISDFGLTPLM   T+P RSAGYRAPEV
Sbjct  448  KGIAHIHAAVGGKFILGNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVPSRSAGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+K TQKSDVYS GV LLE+LTGKAP+Q+   E+VVDLP+WVQSVVREEWT+EVFD E
Sbjct  508  IETKKPTQKSDVYSFGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+ Y +++E+EMVQ+LQ+AM+CV KVP+MRP M+EVVRMIE+IR  D  N+PS ED
Sbjct  568  LMRY-ENIEEEMVQMLQIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDSENQPSSED  622



>ref|XP_006429632.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
 ref|XP_006481232.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 ref|XP_006481233.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006481234.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR42872.1| hypothetical protein CICLE_v10011280mg [Citrus clementina]
Length=632

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 149/176 (85%), Gaps = 1/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G +   GNIKSSNVLL+QDL GCISDFGLTPLM   T+P RSAGYRAPEV
Sbjct  448  KGIAHIHAAVGGKFILGNIKSSNVLLSQDLQGCISDFGLTPLMNTPTVPSRSAGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+K TQKSDVYS GV LLE+LTGKAP+Q+   E+VVDLP+WVQSVVREEWT+EVFD E
Sbjct  508  IETKKPTQKSDVYSFGVLLLEMLTGKAPIQAPGHEDVVDLPRWVQSVVREEWTSEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+ Y +++E+EMVQ+LQ+AM+CV KVP+MRP M+EVVRMIE+IR  D  N+PS ED
Sbjct  568  LMRY-ENIEEEMVQMLQIAMSCVAKVPDMRPTMEEVVRMIEDIRPSDSENQPSSED  622



>ref|XP_011095165.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
 ref|XP_011095166.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=643

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFT-TIPPRSAGYRAPE  511
            +GVAHIHS  G + THGNIKSSNVLLTQD NGCI+DFGLTPLMG   TIP RSAGYRAPE
Sbjct  460  KGVAHIHSTAGGKQTHGNIKSSNVLLTQDFNGCITDFGLTPLMGIIPTIPSRSAGYRAPE  519

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V ETRKSTQKSDVYS GV LLELLTGKAP +   Q+EVVDLP+WVQSVVREEWTAEVFDA
Sbjct  520  VTETRKSTQKSDVYSFGVLLLELLTGKAPTKLVGQDEVVDLPRWVQSVVREEWTAEVFDA  579

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            +L+ Y Q++E+EMVQ+LQ+AM CV +VP+ RP MDEVV+MI +IR  D  N+ S E +  
Sbjct  580  DLVKY-QNIEEEMVQMLQIAMNCVAQVPDARPAMDEVVKMIGKIRPSDSENQSSSEKSMS  638

Query  150  RSPS  139
             SPS
Sbjct  639  LSPS  642



>gb|KHG05843.1| hypothetical protein F383_32232 [Gossypium arboreum]
Length=659

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 150/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++H+HS+ G + THGNIKSSNVL+ Q+ +GCISD GLTPLM     P R+ GYRAPEV
Sbjct  474  RGISHVHSMGGPKFTHGNIKSSNVLINQEHDGCISDLGLTPLMNVPATPSRTVGYRAPEV  533

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  534  IETRKHTHKSDVYSFGVLLLEMLTGKAPLQSPRRDDMVDLPRWVQSVVREEWTAEVFDVE  593

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KV +MRP MDEVVRMIEE+RQ D  NRPS E+NK +
Sbjct  594  LMRF-QNIEEEMVQMLQIAMACVAKVADMRPNMDEVVRMIEEVRQSDSENRPSSEENKSK  652



>ref|XP_009607538.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607539.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607540.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
 ref|XP_009607541.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=690

 Score =   265 bits (677),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G + THGNIKSSN+LLT+D +GCISDFGLTPLM +     R AGYRAPEV
Sbjct  499  KGIAHIHTEGGVKFTHGNIKSSNILLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEV  558

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  559  IETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVE  618

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ +ACV KVP+MRP M EVVRMIE+IRQP+   RPS EDN+ +
Sbjct  619  LLKY-QNIEEEMVQMLQIGLACVAKVPDMRPSMGEVVRMIEDIRQPEGETRPSSEDNRSK  677



>gb|ABK93951.1| unknown [Populus trichocarpa]
Length=351

 Score =   255 bits (651),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  170  RGIARIHSEGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  229

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  230  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  289

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  290  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  343



>gb|KJB29842.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
 gb|KJB29843.1| hypothetical protein B456_005G120900 [Gossypium raimondii]
Length=660

 Score =   263 bits (672),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G +  HGNIKSSNVLLT+DL+GCISDFGLTPLM    +P RSAGYRAPEV
Sbjct  475  KGIAYIHSSGGGKFIHGNIKSSNVLLTKDLHGCISDFGLTPLMTSPKVPSRSAGYRAPEV  534

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK TQKSDVYS GV LLE+LTGKA  QS+  ++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  535  IESRKFTQKSDVYSFGVLLLEMLTGKAATQSSGHKDVVDLPRWVQSVVREEWTAEVFDVE  594

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AM CV ++P+MRP M+EV RMIEEIR     NRPS EDN+ +
Sbjct  595  LMKY-QNIEEELVQMLQIAMTCVARLPDMRPTMEEVTRMIEEIRPSVSENRPSSEDNRSK  653



>emb|CAN80590.1| hypothetical protein VITISV_040789 [Vitis vinifera]
Length=625

 Score =   262 bits (670),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 2/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+ HIHS  G + THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEV
Sbjct  441  KGIVHIHSANGGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  501  IETRKSTQKSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+   QS E+EMVQ+LQ+AMACV K+P+MRPKM+EVVR++EEIR  D  NRPS  DN+ +
Sbjct  561  LMK-DQSYEEEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPS-SDNQSK  618

Query  147  SPSS  136
              ++
Sbjct  619  GSTA  622



>gb|KHG17391.1| hypothetical protein F383_22576 [Gossypium arboreum]
Length=661

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 148/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A+IHS  G +  HGNIKSSNVLLT+DL+GCISDFGLTPLM    +P RSAGYRAPEV
Sbjct  476  KGIAYIHSSGGGKFIHGNIKSSNVLLTEDLHGCISDFGLTPLMTSPKVPSRSAGYRAPEV  535

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK TQKSDVYS GV LLE+LTGKA  QS+   +VVDLP+WVQSVVREEWTAEVFD E
Sbjct  536  IESRKFTQKSDVYSFGVLLLEMLTGKAATQSSGHADVVDLPRWVQSVVREEWTAEVFDVE  595

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+E+VQ+LQ+AM CV ++P+MRP M+EV RMIEEIR     NRPS EDN+ +
Sbjct  596  LMKY-QNIEEELVQMLQIAMTCVARLPDMRPSMEEVTRMIEEIRPSVSENRPSSEDNRSK  654



>ref|XP_010653700.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Vitis vinifera]
 emb|CBI32886.3| unnamed protein product [Vitis vinifera]
Length=634

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 2/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+ HIHS  G + THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEV
Sbjct  450  KGIVHIHSANGGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  510  IETRKSTQKSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+   QS E+EMVQ+LQ+AMACV K+P+MRPKM+EVVR++EEIR  D  NRPS  DN+ +
Sbjct  570  LMK-DQSYEEEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPS-SDNQSK  627

Query  147  SPSS  136
              ++
Sbjct  628  GSTA  631



>ref|XP_009760496.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760502.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009760506.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Nicotiana sylvestris]
Length=646

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G + THGNIKSSNVLLT+D +GCISDFGLTPLM +     R AGYRAPEV
Sbjct  462  KGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEV  521

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  522  IETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVE  581

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ +ACV KVP+MRP M +VVRMIEEIRQP    RPS ED++ +
Sbjct  582  LLKY-QNIEEEMVQMLQIGLACVAKVPDMRPSMGQVVRMIEEIRQPQGETRPSSEDSRSK  640



>ref|XP_009337799.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=636

 Score =   261 bits (668),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGN+KSSNVLL QDL G ISDFGL PLM FT IP RS GYRAPEV
Sbjct  442  KGLAHIHSASGGKFIHGNVKSSNVLLMQDLTGSISDFGLAPLMNFTAIPSRSVGYRAPEV  501

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  502  IETKKSFQKSDVYSFGVMLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  561

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+   +++E+E+VQ+LQ+AM CV  VP+MRP M+EVVRMIE+IR PD  NR S ED    
Sbjct  562  LMRC-ENIEEELVQMLQIAMTCVATVPDMRPTMEEVVRMIEDIRPPDSENRSSSEDKSKA  620

Query  147  S  145
            S
Sbjct  621  S  621



>ref|XP_010653698.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
 ref|XP_010653699.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Vitis vinifera]
Length=667

 Score =   262 bits (670),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 152/184 (83%), Gaps = 2/184 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+ HIHS  G + THGNIKSSNVLLTQD++G ISDFGLT LM +  +  RS GYRAPEV
Sbjct  483  KGIVHIHSANGGKFTHGNIKSSNVLLTQDVDGQISDFGLTSLMNYPLVTSRSLGYRAPEV  542

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGKAPVQS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  543  IETRKSTQKSDVYSYGVLLLEMLTGKAPVQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  602

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+   QS E+EMVQ+LQ+AMACV K+P+MRPKM+EVVR++EEIR  D  NRPS  DN+ +
Sbjct  603  LMK-DQSYEEEMVQMLQIAMACVAKMPDMRPKMEEVVRLMEEIRPSDSENRPS-SDNQSK  660

Query  147  SPSS  136
              ++
Sbjct  661  GSTA  664



>ref|XP_011080640.1| PREDICTED: probable inactive receptor kinase At5g58300 [Sesamum 
indicum]
Length=640

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  GAR THGNIKSSNVLL QD+  C+SDFGL PLM       R  GYRAPEV
Sbjct  461  RGIAHLHAAGGARFTHGNIKSSNVLLNQDVEACVSDFGLAPLMNSPASSSRHTGYRAPEV  520

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV LLE+LTGK P+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  521  IETRKHTHKSDVYSFGVMLLEMLTGKQPIQSPGRDDIVDLPRWVQSVVREEWTAEVFDIE  580

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ + Q++E+EMVQ+LQ+AMACV KVP+ RP MDEVVRMIEE+R  D  NRPS E+NK +
Sbjct  581  LMRF-QNIEEEMVQMLQIAMACVAKVPDARPNMDEVVRMIEEVRPSDSENRPSSEENKSK  639



>ref|XP_009355011.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
 ref|XP_009355020.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=623

 Score =   261 bits (667),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G + THGNIKS+NVLL+QDL+GCISD GLTPLM       RSAGYRAPEV
Sbjct  449  RGIAHIHSVGGPKFTHGNIKSTNVLLSQDLDGCISDVGLTPLMNVPATA-RSAGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGKAP+QS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  508  IETRKHSHKSDVYSFGVVLLEMLTGKAPLQSPGRDDMVDLPRWVQSVVREEWTAEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ Y Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIEEIRQ D  NR S E
Sbjct  568  LMRY-QNIEEEMVQMLQIAMACVAKVPDMRPTMEEVVRMIEEIRQSDSENRQSSE  621



>ref|XP_009760490.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Nicotiana sylvestris]
Length=717

 Score =   262 bits (670),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIH+  G + THGNIKSSNVLLT+D +GCISDFGLTPLM +     R AGYRAPEV
Sbjct  533  KGIAHIHTEGGVKFTHGNIKSSNVLLTRDQDGCISDFGLTPLMNYIPFKYRCAGYRAPEV  592

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LT K+P+  +  +EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  593  IETRKGTQKSDVYSFGVLLLEMLTAKSPIPLSGHDEVVDLPRWVRSVVREEWTAEVFDVE  652

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+ +ACV KVP+MRP M +VVRMIEEIRQP    RPS ED++ +
Sbjct  653  LLKY-QNIEEEMVQMLQIGLACVAKVPDMRPSMGQVVRMIEEIRQPQGETRPSSEDSRSK  711



>ref|XP_008803002.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803003.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803004.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803005.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
 ref|XP_008803006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=635

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 147/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPE  511
            RG+AHIH+  G + THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPE
Sbjct  451  RGIAHIHTEGGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRIVVGYRAPE  510

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRKSTQKSDVYS GV LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD 
Sbjct  511  VIETRKSTQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            EL+ Y Q++E+EMVQ+LQ+AMACV + P+ RP+M+EV+RMIEE+R  D  NRPS E +K
Sbjct  571  ELMRY-QNIEEEMVQMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSGNRPSSEKSK  628



>gb|EYU42048.1| hypothetical protein MIMGU_mgv1a003031mg [Erythranthe guttata]
Length=614

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 150/187 (80%), Gaps = 3/187 (2%)
 Frame = -3

Query  687  RGVAHIHSV--PGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMG-FTTIPPRSAGYRA  517
            +GVA+IHS    G +LTHGNIKSSNVLLTQ+ +  I+DFGL P+MG    IP R AGYRA
Sbjct  428  KGVAYIHSAGAAGGKLTHGNIKSSNVLLTQNSDARITDFGLIPVMGGIPGIPSRGAGYRA  487

Query  516  PEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVF  337
            PE+++T KSTQKSD+YS GV +LELLTGKAPVQ   Q+EV DLP+WVQSVVREEWTAEVF
Sbjct  488  PELVQTGKSTQKSDIYSFGVLILELLTGKAPVQPMGQDEVEDLPRWVQSVVREEWTAEVF  547

Query  336  DAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            DA+LI YH ++E+EMVQ+LQ+ +ACV KVPEMRP M EVVRMIEEIR  D  NR S E +
Sbjct  548  DADLIKYHNNIEEEMVQMLQIGLACVAKVPEMRPAMSEVVRMIEEIRLTDSENRTSSEKS  607

Query  156  KXRSPSS  136
            +  SP+S
Sbjct  608  RSTSPAS  614



>emb|CDP13882.1| unnamed protein product [Coffea canephora]
Length=639

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 149/180 (83%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  GAR +HGNIKSSNVLL ++ +GCI+DFGL P+M    +  R  GY APEV
Sbjct  454  RGIAHIHSDGGARFSHGNIKSSNVLLNKEQDGCITDFGLNPVMNSLGVKTRGIGYHAPEV  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK+TQKSDVYS GV LLE+LTGK+P+ S+  ++V+DLP+WV+SVVREEWTAEVFD E
Sbjct  514  IETRKATQKSDVYSFGVLLLEMLTGKSPIHSSGHDDVIDLPRWVRSVVREEWTAEVFDVE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQ+LQ+A++CV K P+MRP MDEVVR++E+IRQ +  NRPS EDN+ +
Sbjct  574  LMKY-QNVEEEMVQMLQIALSCVAKAPDMRPSMDEVVRLMEDIRQSELENRPSSEDNRSK  632



>ref|XP_008366817.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
 ref|XP_008366818.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=636

 Score =   258 bits (660),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 142/172 (83%), Gaps = 1/172 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS    +  HGN+KSSNVLL QDL G ISDFGL PLM F  IP RS GYRAPEV
Sbjct  442  KGLAHIHSASEGKFIHGNVKSSNVLLMQDLTGSISDFGLAPLMNFXAIPSRSVGYRAPEV  501

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+KS QKSDVYS GV LLE+LTGKAPVQS  ++++VDLP+WVQSVVREEWTAEVFD E
Sbjct  502  IETKKSFQKSDVYSFGVMLLEMLTGKAPVQSPGRDDIVDLPRWVQSVVREEWTAEVFDVE  561

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRP  172
            L+ Y +++E+E+VQ+LQ+AM CV  VP+MRP M+EVVRMIEEIR PD  NRP
Sbjct  562  LMRY-ENIEEELVQMLQIAMTCVATVPDMRPTMEEVVRMIEEIRPPDSENRP  612



>ref|XP_010922781.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922782.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922783.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922784.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922785.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010922786.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=635

 Score =   258 bits (658),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            RG+AHIH+  G + THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPE
Sbjct  451  RGIAHIHTEGGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNIHATPSRVVVGYRAPE  510

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRKSTQKSDVYS GV LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD 
Sbjct  511  VIETRKSTQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            EL+ Y Q++E+EMVQ+LQ+AMACV + P+ RP M++V+RMIEE+R  D  NRPS E +K
Sbjct  571  ELMRY-QNIEEEMVQMLQIAMACVARAPDQRPIMEDVIRMIEEVRHSDSENRPSSEKSK  628



>ref|XP_006435960.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486130.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Citrus sinensis]
 gb|ESR49200.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=638

 Score =   257 bits (657),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+ THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV
Sbjct  457  RGIAFIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEV  516

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRK++QKSDVYS GV LLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  517  TETRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVE  576

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ Y Q +E+EMVQ+LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR S
Sbjct  577  LLKY-QDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELKNRAS  628



>ref|XP_006435961.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
 ref|XP_006486131.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Citrus sinensis]
 ref|XP_006486132.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Citrus sinensis]
 gb|ESR49201.1| hypothetical protein CICLE_v10030941mg [Citrus clementina]
Length=627

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+ THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV
Sbjct  446  RGIAFIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEV  505

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRK++QKSDVYS GV LLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  506  TETRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVE  565

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ Y Q +E+EMVQ+LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR S
Sbjct  566  LLKY-QDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELKNRAS  617



>gb|KDO67579.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
 gb|KDO67580.1| hypothetical protein CISIN_1g006886mg [Citrus sinensis]
Length=627

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+ THGNIKSSNVLLTQDLNGCISD GL  L+ F T   R+ GYRAPEV
Sbjct  446  RGIAFIHSEGGAKFTHGNIKSSNVLLTQDLNGCISDVGLAHLINFPTTATRTIGYRAPEV  505

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRK++QKSDVYS GV LLE+LTGKAP+Q +  ++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  506  TETRKASQKSDVYSFGVLLLEMLTGKAPLQHSGHDDVVDLPRWVRSVVREEWTAEVFDVE  565

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ Y Q +E+EMVQ+LQ+A++CV KVP+ RPKMD+VVRMIE+I+QP+  NR S
Sbjct  566  LLKY-QDVEEEMVQMLQIALSCVAKVPDSRPKMDDVVRMIEQIQQPELRNRAS  617



>ref|XP_010999642.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X3 [Populus euphratica]
Length=630

 Score =   256 bits (654),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  449  RGIARIHSEGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  509  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  569  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  622



>ref|XP_010999638.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Populus euphratica]
Length=656

 Score =   256 bits (653),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  475  RGIARIHSEGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  534

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  535  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  594

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  595  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  648



>ref|XP_010999639.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999640.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
 ref|XP_010999641.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Populus euphratica]
Length=655

 Score =   256 bits (653),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIKSSNV+LT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  474  RGIARIHSEGGAKFFHGNIKSSNVILTSDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  533

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  534  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  593

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  594  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  647



>gb|ABR17070.1| unknown [Picea sitchensis]
Length=340

 Score =   247 bits (630),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG++HIH   G + THGNIKSSNVLLT DL+GC+SDFGL PL        R AGYRAPEV
Sbjct  138  RGISHIHEEGGGKFTHGNIKSSNVLLTTDLDGCVSDFGLVPLFSAAAAANRIAGYRAPEV  197

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLELLTGKAP Q++  +E +DLP+WVQSVVREEWTAEVFD E
Sbjct  198  IETRKVTQKSDVYSFGVLLLELLTGKAPNQASLNDEGIDLPRWVQSVVREEWTAEVFDVE  257

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ--PDFXNRPSXEDNK  154
            L+ Y Q++E+EMVQLLQ+AMACV  VP+ RP+M +VV+MIE++RQ   D  NR S +D  
Sbjct  258  LMRY-QNIEEEMVQLLQIAMACVAAVPDQRPRMQDVVKMIEDMRQFETDDGNRQSSDDKS  316

Query  153  XRS  145
              S
Sbjct  317  KES  319



>ref|XP_006371315.1| putative plant disease resistance family protein [Populus trichocarpa]
 gb|ERP49112.1| putative plant disease resistance family protein [Populus trichocarpa]
Length=630

 Score =   255 bits (651),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  449  RGIARIHSEGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  509  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  569  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  622



>ref|XP_006371316.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
 gb|ERP49113.1| hypothetical protein POPTR_0019s09010g [Populus trichocarpa]
Length=655

 Score =   254 bits (650),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A IHS  GA+  HGNIK+SNVLLT DL+GCISD GL PLM F T   R+ GYRAPEV
Sbjct  474  RGIARIHSEGGAKFFHGNIKASNVLLTPDLDGCISDVGLAPLMNFPTTMYRTIGYRAPEV  533

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK++QKSDVYS GV LLE+LTGKAP+Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  534  IETRKASQKSDVYSFGVLLLEMLTGKAPLQVPGHDSVVDLPRWVRSVVREEWTAEVFDVE  593

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+  HQ++E+EMVQ+LQ+A+ACV K P+MRPKMDEVVRMIEEI+  D  NR S +
Sbjct  594  LVR-HQNIEEEMVQMLQIALACVAKAPDMRPKMDEVVRMIEEIQHSDSKNRSSSD  647



>ref|XP_010931391.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931392.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
 ref|XP_010931393.1| PREDICTED: probable inactive receptor kinase At5g58300 [Elaeis 
guineensis]
Length=636

 Score =   254 bits (648),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            RG+AHIH+  G + THGNIK+SNVLLTQDL  C+SDFGL PLM     P R   GYRAPE
Sbjct  451  RGIAHIHTDGGGKFTHGNIKASNVLLTQDLEACVSDFGLAPLMNTHATPSRVVVGYRAPE  510

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRKSTQ+SDVYS GV LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD 
Sbjct  511  VIETRKSTQRSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            EL+ Y Q++E+EMVQ+LQ+AMACV + P+ RP+M+EV+RMIEE+R  D  NR S E+
Sbjct  571  ELMRY-QNIEEEMVQMLQIAMACVARAPDQRPRMEEVIRMIEEVRHSDSENRQSSEE  626



>ref|XP_009798129.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798130.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
 ref|XP_009798131.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
sylvestris]
Length=625

 Score =   252 bits (644),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G +  HGNIKSSNVLL QDL  C+SDFGL P+M F   P R  GYRAPEV
Sbjct  450  RGIAHIHSVGGPKFAHGNIKSSNVLLKQDLEACVSDFGLAPIMNFPAAPTRYPGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGK P+QS  ++++VDLP+WVQSV++EEWT+EVFD +
Sbjct  510  IETRKHSHKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVD  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVV+MIEE+RQ D  NR S E
Sbjct  570  LMRF-QNIEEEMVQMLQIAMACVAKVPDMRPNMEEVVKMIEEVRQSDSENRQSSE  623



>ref|XP_010541472.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
 ref|XP_010541473.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Tarenaya hassleriana]
Length=628

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 147/177 (83%), Gaps = 3/177 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G +  HGNIKSSNVL+ Q+ +GCISD GLT LM   T   R+AGYRAPEV
Sbjct  448  KGIAHLHAVGGPKFAHGNIKSSNVLINQETDGCISDSGLTSLMAMPTT--RAAGYRAPEV  505

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRK T KSDVYS GV LLE+LTGKAP+QS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  506  TETRKQTHKSDVYSFGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  565

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            L+ + Q++E+EMVQ+LQVAMACV ++P+MRP MD+VVRMIEEIR  D  NRPS EDN
Sbjct  566  LMRF-QNIEEEMVQMLQVAMACVARLPDMRPDMDQVVRMIEEIRLSDSDNRPSSEDN  621



>ref|XP_006280146.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
 gb|EOA13044.1| hypothetical protein CARUB_v10026045mg [Capsella rubella]
Length=658

 Score =   251 bits (641),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 149/178 (84%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ QD +GCISDFGL+PLM     P R AGYRAPEV
Sbjct  468  KGIAHLHAVGGPKFSHGNIKSSNVIMKQDSDGCISDFGLSPLMAVPIAPMRGAGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSD+YS GV +LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  528  IETRKHTHKSDIYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV ++PE+RP MD++VRMIEEIR  D    RPS +DN
Sbjct  588  LMRF-QNIEEEMVQMLQIAMACVAQMPEVRPTMDDIVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_010541471.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Tarenaya hassleriana]
Length=652

 Score =   251 bits (641),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G +  HGNIKSSNVL+ Q+ +GCISD GLT LM   T   R+AGYRAPEV
Sbjct  472  KGIAHLHAVGGPKFAHGNIKSSNVLINQETDGCISDSGLTSLMAMPTT--RAAGYRAPEV  529

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRK T KSDVYS GV LLE+LTGKAP+QS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  530  TETRKQTHKSDVYSFGVLLLEMLTGKAPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  589

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            L+ + Q++E+EMVQ+LQVAMACV ++P+MRP MD+VVRMIEEIR  D  NRPS EDN 
Sbjct  590  LMRF-QNIEEEMVQMLQVAMACVARLPDMRPDMDQVVRMIEEIRLSDSDNRPSSEDNN  646



>dbj|BAH57151.1| AT3G08680 [Arabidopsis thaliana]
Length=256

 Score =   239 bits (611),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQ+L+ C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  67   RGISHIHSASGAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  126

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  127  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  186

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR S
Sbjct  187  ELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRAS  244



>ref|XP_010043603.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW88397.1| hypothetical protein EUGRSUZ_A00785 [Eucalyptus grandis]
Length=613

 Score =   249 bits (636),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 144/173 (83%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G R  HGNIKSSNVLLTQDL GCIS+FGLTPL+    +PPRSAGYRAPEV
Sbjct  441  KGIAHIHSAGGGRFIHGNIKSSNVLLTQDLQGCISEFGLTPLIRTPAVPPRSAGYRAPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            ++TRK TQKSD+YS GV LLE+LTGK+P+QS  +E+V DLP+WVQSVVREEWTAEVFD E
Sbjct  501  MKTRKPTQKSDIYSFGVLLLEMLTGKSPIQSPRREDVFDLPRWVQSVVREEWTAEVFDEE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+    ++E+E+V++L++A+ACV ++P+ RP MDEVVRMIEE+R  D  N PS
Sbjct  561  LLR-DGNIEEELVEMLKIALACVDRMPDGRPTMDEVVRMIEEVRPSDSENPPS  612



>ref|XP_006401105.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
 gb|ESQ42558.1| hypothetical protein EUTSA_v10012925mg [Eutrema salsugineum]
Length=650

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNG-CISDFGLTPLMGFTTIPPRSAGYRAPE  511
            +G+AH+H+V G + +HGNIKSSNV++ Q+ +  CISDFGL PLM     P R AGYRAPE
Sbjct  462  KGIAHLHAVGGPKFSHGNIKSSNVIMKQESSDVCISDFGLAPLMAVPVAPMRGAGYRAPE  521

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK T KSD+YS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD 
Sbjct  522  VIETRKHTHKSDIYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDV  581

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            EL+ + Q++E+EMVQ+LQVAMACV ++PE+RP MDEVVRMIEEIR  D   RPS +DN
Sbjct  582  ELMRF-QNIEEEMVQMLQVAMACVAQMPEVRPTMDEVVRMIEEIRASDSETRPSSDDN  638



>ref|XP_009384331.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384332.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384333.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384334.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384335.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 144/179 (80%), Gaps = 2/179 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPE  511
            RGVAHIH+  G +  HG+IKS+NVLLTQ+L+ C++D+GL P M   T   R   GYRAPE
Sbjct  449  RGVAHIHAEGGGKFIHGDIKSNNVLLTQELDACVADYGLAPFMSSATTSSRIVVGYRAPE  508

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK TQKSDVYS GV LLE+LTGKAP+QS  +++VVDLP+WVQSVVREEWTAEVFD 
Sbjct  509  VIETRKYTQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVVDLPRWVQSVVREEWTAEVFDV  568

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            EL+  HQ +E+EMVQ+LQ+AMACV K P+ RPKM+E++RMIE+IR  D  NRPS E +K
Sbjct  569  ELMR-HQHIEEEMVQMLQIAMACVAKSPDQRPKMEELIRMIEDIRHSDSENRPSSEKSK  626



>ref|XP_010323112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Solanum 
lycopersicum]
Length=627

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 144/175 (82%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS+ G + THGNIKSSNVLL QD+  CISDFGL P+M F   P R  GYRAPEV
Sbjct  452  KGIAHIHSMGGPKFTHGNIKSSNVLLKQDMEACISDFGLAPIMNFPAAPSRYPGYRAPEV  511

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK + KSDVYS GV LLE+LTGK P+QS  ++++VDLP+WVQSVVREEWT+EVFD +
Sbjct  512  IESRKHSHKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVVREEWTSEVFDVD  571

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q++E+EMVQ+LQ+AMACV KVP+MRP M+EVVRMIE++RQ +  NR S E
Sbjct  572  LMRF-QNIEEEMVQMLQIAMACVVKVPDMRPNMEEVVRMIEDVRQSNSENRHSSE  625



>ref|XP_010443551.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443552.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010443553.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=661

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  471  KGIAHLHAVGGPKFSHGNIKSSNVIMKQETDACISDFGLTPLMAVPIAPMRGAGYRAPEV  530

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK+P+QS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  531  IETRKHTHKSDVYSFGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  590

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV ++PE+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  591  LMRF-QNIEEEMVQMLQIAMACVAQMPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  647



>ref|XP_009607078.1| PREDICTED: probable inactive receptor kinase At5g58300 [Nicotiana 
tomentosiformis]
Length=625

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHSV G +  HGNIKSSNVLL QDL  CISDFGL P+M F   P R  GYRAPEV
Sbjct  450  RGIAHIHSVGGPKFAHGNIKSSNVLLKQDLEACISDFGLAPIMNFPVAPTRYPGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK + KSDVYS GV LLE+LTGK P+QS  ++++VDLP+WVQSV++EEWT+EVFD +
Sbjct  510  IETRKHSHKSDVYSFGVLLLEMLTGKQPMQSPGRDDMVDLPRWVQSVLKEEWTSEVFDVD  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q++E+EMVQ+LQ+AMACV KV +MRP M+EVV+MI+E+RQ D  NR S E
Sbjct  570  LMRF-QNIEEEMVQMLQIAMACVAKVADMRPNMEEVVKMIKEVRQSDSENRQSSE  623



>ref|XP_006842562.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
 gb|ERN04237.1| hypothetical protein AMTR_s00077p00144570 [Amborella trichopoda]
Length=219

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 148/189 (78%), Gaps = 11/189 (6%)
 Frame = -3

Query  687  RGVAHIHS-VPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP---PRSAGYR  520
            RG+AH+HS + G + THGNIKSSN+LLT +L   +SDFGL PLM     P   PR+ GYR
Sbjct  26   RGIAHLHSDIGGGKFTHGNIKSSNILLTPELEPLVSDFGLAPLMS-PPAPGPHPRAPGYR  84

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSA-----AQEEVVDLPKWVQSVVREE  355
            APE +ETR++TQKSDVYS GV LLELLTGK+P Q+        E++ DLP+WVQSVVREE
Sbjct  85   APETLETRRATQKSDVYSFGVLLLELLTGKSPAQAHQAQAQGSEDIADLPRWVQSVVREE  144

Query  354  WTAEVFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNR  175
            WTAEVFD EL+ Y Q++E+EMVQ+LQVAMACV +VP++RPKM EVV+M+E+++Q D  NR
Sbjct  145  WTAEVFDVELMRY-QNIEEEMVQMLQVAMACVARVPDLRPKMSEVVKMVEDVKQSDSENR  203

Query  174  PSXEDNKXR  148
            PS EDN+ +
Sbjct  204  PSSEDNRSK  212



>emb|CDY58565.1| BnaC03g12450D [Brassica napus]
Length=653

 Score =   248 bits (632),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G + +HGNIK+SNV++ Q+ + C+SDFGL+PLM     P R AGYRAPEV
Sbjct  465  KGVAHLHEVGGPKFSHGNIKASNVIMKQENDVCVSDFGLSPLMSVPIAPMRGAGYRAPEV  524

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I TRK T KSDVYS GV +LE+LTGK+PVQSA++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  525  IVTRKHTHKSDVYSFGVLILEMLTGKSPVQSASREDMVDLPRWVQSVVREEWTSEVFDVE  584

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV  VPE+RP MDEVVRMIEEIR  D    RPS +DN
Sbjct  585  LMKF-QNIEEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  641



>ref|XP_008788112.1| PREDICTED: probable inactive receptor kinase At5g58300 [Phoenix 
dactylifera]
Length=636

 Score =   247 bits (631),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 142/177 (80%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            RG+AHIH+  G +  HGNIK+SNVLLTQDL  CISDFGL PLM     P R   GYRAPE
Sbjct  451  RGMAHIHTEGGGKFAHGNIKASNVLLTQDLEACISDFGLAPLMNTHATPSRVVVGYRAPE  510

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK TQKSDVYS GV LLE+LTGKAP+QS  +++V DLP+WVQSVVREEWTAEVFD 
Sbjct  511  VIETRKYTQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            EL+ Y +++E+EMVQ+LQ+AMACV + P+ RP+M+EV+RMI+E+R  D  NR S E+
Sbjct  571  ELMRY-RNIEEEMVQMLQIAMACVARAPDQRPRMEEVIRMIDEVRHSDSENRASSEE  626



>gb|KCW50324.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
 gb|KCW50325.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=630

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            + +AHIHS PGA+  HGNIKS NV LTQD +GC+SD GLTPLM  + I PR  GY APEV
Sbjct  449  KAIAHIHSEPGAKCVHGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAITPRVIGYYAPEV  508

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK TQKSDVYS GV LLE+LTGK P++    ++V+DLP+WV+SVVREEWTAEVFD E
Sbjct  509  IESRKVTQKSDVYSFGVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVE  568

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ Y +++E+EMVQ+LQ+A+ CV KVP+MRPKMDEV R+I+E+R+P+  +RPS
Sbjct  569  LLKY-ENVEEEMVQMLQIALTCVTKVPDMRPKMDEVARLIDEVREPEAKDRPS  620



>ref|XP_002864562.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  468  KGIAHLHAVGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV +LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  528  METRKHTHKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV ++PE+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  588  LMRF-QNIEEEMVQMLQIAMACVAQMPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_010031063.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031064.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031065.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 ref|XP_010031066.1| PREDICTED: probable inactive receptor kinase At5g58300 [Eucalyptus 
grandis]
 gb|KCW50323.1| hypothetical protein EUGRSUZ_J00100 [Eucalyptus grandis]
Length=633

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 142/173 (82%), Gaps = 1/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            + +AHIHS PGA+  HGNIKS NV LTQD +GC+SD GLTPLM  + I PR  GY APEV
Sbjct  452  KAIAHIHSEPGAKCVHGNIKSLNVFLTQDHDGCVSDVGLTPLMNLSAITPRVIGYYAPEV  511

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RK TQKSDVYS GV LLE+LTGK P++    ++V+DLP+WV+SVVREEWTAEVFD E
Sbjct  512  IESRKVTQKSDVYSFGVLLLEMLTGKTPLKHPGLDDVIDLPRWVRSVVREEWTAEVFDVE  571

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ Y +++E+EMVQ+LQ+A+ CV KVP+MRPKMDEV R+I+E+R+P+  +RPS
Sbjct  572  LLKY-ENVEEEMVQMLQIALTCVTKVPDMRPKMDEVARLIDEVREPEAKDRPS  623



>ref|XP_010483401.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483402.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483403.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483404.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483406.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483407.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010483408.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  466  KGIAHLHAVGGPKFSHGNIKSSNVIMKQETDACISDFGLTPLMAVPIAPMRGAGYRAPEV  525

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T K+DVYS GV +LE+LTGK+P+QS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  526  IETRKHTHKTDVYSFGVLILEMLTGKSPIQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  585

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV ++P++RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  586  LMRF-QNIEEEMVQMLQIAMACVAQMPDVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  642



>ref|XP_010453493.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453499.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
 ref|XP_010453515.1| PREDICTED: probable inactive receptor kinase At5g58300 [Camelina 
sativa]
Length=656

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  466  KGIAHLHAVGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEV  525

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK+P+QS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  526  IETRKHTHKSDVYSFGVLILEMLTGKSPIQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  585

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+A+ACV ++P++RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  586  LMRF-QNIEEEMVQMLQIAIACVAQMPDVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  642



>ref|NP_200638.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_001119458.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9LVM0.1|Y5830_ARATH RecName: Full=Probable inactive receptor kinase At5g58300; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAA96921.1| receptor-like protein kinase [Arabidopsis thaliana]
 gb|AAL57654.1| unknown protein [Arabidopsis thaliana]
 gb|AAN64529.1| At5g58299/At5g58299 [Arabidopsis thaliana]
 gb|ACN59396.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED97030.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AED97031.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=654

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+  G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  468  KGIAHLHAAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV +LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  528  METRKHTHKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDIE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV +VPE+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  588  LMRF-QNIEEEMVQMLQIAMACVAQVPEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_009132067.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=650

 Score =   246 bits (629),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 146/178 (82%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G++ +HGNIKSSNV++ Q+ + C+SDFGL+PLM     P R AGYRAPEV
Sbjct  462  KGVAHLHEVGGSKFSHGNIKSSNVIMKQENDVCVSDFGLSPLMSVPIAPMRGAGYRAPEV  521

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I TRK T KSDVYS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  522  IVTRKHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  581

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV  VPE+RP MDEVVRMIEEIR  D    RPS +DN
Sbjct  582  LMKF-QNIEEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  638



>ref|XP_009406050.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406051.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009406052.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 143/176 (81%), Gaps = 1/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+HS  G +  HGNIKSSNVLLTQ+L+ C+S+FGL PLM     P R  GYRAPEV
Sbjct  447  RGIAHLHSQGGGKFIHGNIKSSNVLLTQELDACVSEFGLAPLMSSAATPSRVVGYRAPEV  506

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RKSTQKSDVYS GV LLELLTGK+P QS  +++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  507  IEHRKSTQKSDVYSFGVFLLELLTGKSPFQSPGRDDVVDLPRWVQSVVREEWTAEVFDVE  566

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+ Y  ++E++MVQ+LQVAM CV +V E RPKM++VVRMIE++++ +  NRPS ED
Sbjct  567  LMRY-PNIEEDMVQMLQVAMQCVVRVAEQRPKMEDVVRMIEDVQRSNSENRPSSED  621



>emb|CDY02808.1| BnaC02g10810D [Brassica napus]
Length=421

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G + +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEV
Sbjct  233  KGVAHLHQVGGPKFSHGNIKSSNMIMKQESDVCVSDYGLTSLMAVPVTPMRGAGYRAPEV  292

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  293  IETRKHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  352

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+   Q++E+EMVQ+LQ+AMACV +V E+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  353  LMKV-QNIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  409



>gb|KJB71491.1| hypothetical protein B456_011G125200 [Gossypium raimondii]
Length=628

 Score =   246 bits (628),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+ H+H+  G +  HGNIK SNVLLTQDL+GCISDFGLT LM   T+P R+ GYRAPE 
Sbjct  450  KGITHLHASGGGKFVHGNIKPSNVLLTQDLHGCISDFGLTSLMSSPTVPSRAVGYRAPEA  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAP-VQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            IETRK TQKSDVYS GV LLE+LTGKA  VQ++  E+VVDLP+WVQSVVREEWTAEVFD 
Sbjct  510  IETRKFTQKSDVYSFGVLLLEMLTGKAAVVQTSGHEDVVDLPRWVQSVVREEWTAEVFDI  569

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            EL+ Y+  +E+E+VQ+LQ+AMACV ++P++RP M+EV R IEEIR  D  NRPS +
Sbjct  570  ELMKYND-IEEELVQMLQIAMACVARLPDVRPSMEEVTRTIEEIRSSDSENRPSSD  624



>ref|XP_006357316.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Solanum 
tuberosum]
Length=592

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 141/165 (85%), Gaps = 1/165 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G + THGNIK+SN+LLT+DL+GCISDFGL+PLM +T I  ++AGY APEV
Sbjct  428  KGIAHIHSEGGVKFTHGNIKASNILLTRDLDGCISDFGLSPLMNYTAIKNKAAGYHAPEV  487

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV +LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDAE
Sbjct  488  IETRKGTQKSDVYSFGVLVLELLTGKSPLPLPRHEDVVNLPRWVRAVVKEEWTAEVFDAE  547

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++++EMV +LQ+A+ CV KVP+MRP MDEV++MIE+I+ 
Sbjct  548  LMKYH-NIQEEMVHMLQIALLCVAKVPDMRPSMDEVIKMIEQIKH  591



>gb|ACA61611.1| hypothetical protein AP2_E06.2 [Arabidopsis lyrata subsp. petraea]
Length=658

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AH+H+V G + +HGNIKSSNV++ Q+ + CISDFGLTPLM     P R AGYRAPEV
Sbjct  468  KGIAHLHAVGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGAGYRAPEV  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV +LE+LTGK+PVQS +++++VDLP+WVQSVVREEWT+EVFD E
Sbjct  528  METRKHTHKSDVYSFGVLILEMLTGKSPVQSPSRDDMVDLPRWVQSVVREEWTSEVFDVE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDF-XNRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV ++ E+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  588  LMRF-QNIEEEMVQMLQIAMACVAQMHEVRPTMDDVVRMIEEIRVSDSETTRPSSDDN  644



>ref|XP_010463311.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Camelina sativa]
Length=637

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  448  RGISHIHSAAGAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  507

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  508  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  567

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV MIEEIR     P   NR S
Sbjct  568  ELIKQQHNVEEEMVQMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRAS  625



>ref|XP_010670041.1| PREDICTED: probable inactive receptor kinase At5g58300 [Beta 
vulgaris subsp. vulgaris]
Length=635

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ HIHS  G +  HGNIKSSNVLL+QD  GCISDFGL  LM F  I  RS GY APEV
Sbjct  447  RGILHIHSEAGGKFIHGNIKSSNVLLSQDYEGCISDFGLPLLMNFQGITSRSIGYHAPEV  506

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSA-AQEEVVDLPKWVQSVVREEWTAEVFDA  331
            IE RK++QKSDVYS GV LLE+LTGKAP++++    +V+DLP+WVQSVVREEWT+EVFDA
Sbjct  507  IEVRKASQKSDVYSFGVLLLEILTGKAPLKTSHGHNDVIDLPRWVQSVVREEWTSEVFDA  566

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            EL+    + E+EMV +LQ+A+ACV +VP+MRPKMD+VVRMIEEIR  +   RPS ++NK 
Sbjct  567  ELLRCPNA-EEEMVHMLQIALACVARVPDMRPKMDDVVRMIEEIRPSESEERPSSDENKS  625

Query  150  R  148
            +
Sbjct  626  K  626



>gb|KDP21623.1| hypothetical protein JCGZ_03294 [Jatropha curcas]
Length=632

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS+ G +  HGN+K+SNVLLT DL+G +SD GLTPLM F     R+ GYRAPEV
Sbjct  451  RGIAHIHSLGGVKCVHGNVKASNVLLTPDLDGLMSDVGLTPLMNFPATISRTIGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IET+K  QKSDV+S GV LLE+LTGKAP+Q+  +++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  511  IETQKLNQKSDVFSFGVVLLEMLTGKAPLQAPGRDDVVDLPRWVRSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ Y Q++EDEMVQ+LQ+A+ACV K P+MRP MDEVVRM+E I+  +  N PS E
Sbjct  571  LMKY-QNIEDEMVQMLQIALACVAKAPDMRPTMDEVVRMMEGIQHSESKNLPSSE  624



>ref|XP_007011393.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20203.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=634

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH+  G + THGNIKSSN+LL+ +L GC+SD GL PLM       R  GYRAPEV
Sbjct  453  RGIAHIHTEGGGKCTHGNIKSSNILLSDELEGCVSDVGLAPLMNAPVTMSRIMGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRK TQKSDVYS GV LLE+LT KAP+Q +  +EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  513  IQTRKVTQKSDVYSFGVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q  ++EMVQ+LQ+A+ACV K  E RPKMDE+VRMIE+IRQP+  NR S E
Sbjct  573  LLRF-QHFQEEMVQMLQIALACVAKTTETRPKMDEIVRMIEDIRQPESKNRTSSE  626



>ref|XP_007011392.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20202.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=639

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH+  G + THGNIKSSN+LL+ +L GC+SD GL PLM       R  GYRAPEV
Sbjct  458  RGIAHIHTEGGGKCTHGNIKSSNILLSDELEGCVSDVGLAPLMNAPVTMSRIMGYRAPEV  517

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRK TQKSDVYS GV LLE+LT KAP+Q +  +EVVDLP+WV+SVVREEWTAEVFD E
Sbjct  518  IQTRKVTQKSDVYSFGVLLLEMLTAKAPLQPSGHDEVVDLPRWVRSVVREEWTAEVFDVE  577

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q  ++EMVQ+LQ+A+ACV K  E RPKMDE+VRMIE+IRQP+  NR S E
Sbjct  578  LLRF-QHFQEEMVQMLQIALACVAKTTETRPKMDEIVRMIEDIRQPESKNRTSSE  631



>ref|XP_006297193.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 ref|XP_006297194.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30091.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
 gb|EOA30092.1| hypothetical protein CARUB_v10013201mg [Capsella rubella]
Length=633

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  444  RGISHIHSAAGAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  503

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  504  TIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  563

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR S
Sbjct  564  ELIKQQHNVEEEMVQMLQIAMACVSKHPDTRPSMEEVVNMMEEIRPSGSGPGSGNRAS  621



>ref|XP_009146990.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=635

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            +G+AHIHS  GA+L HGNIKS NVLLTQDLN C+SD+G+ PLM   T +P RS GYRAPE
Sbjct  445  KGIAHIHSSSGAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPE  504

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  505  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  564

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            ELI    ++E+EMVQ+LQVAMACV K P+ RP M+EVV M+EE+R
Sbjct  565  ELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>ref|XP_010464477.1| PREDICTED: probable inactive receptor kinase At3g08680 [Camelina 
sativa]
Length=638

 Score =   242 bits (617),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQDL+ C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  449  RGISHIHSAAGAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  508

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK T+KSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  509  AIETRKHTKKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  568

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV MIEEIR     P   NR S
Sbjct  569  ELIKQQHNVEEEMVQMLQIAMACVSKHPDTRPSMEEVVNMIEEIRPTGSGPGSGNRAS  626



>emb|CDY35996.1| BnaA05g29540D [Brassica napus]
Length=635

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 1/165 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            +G+AHIHS  GA+L HGNIKS NVLLTQDLN C+SD+G+ PLM   T +P RS GYRAPE
Sbjct  445  KGIAHIHSSSGAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPE  504

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  505  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  564

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            ELI    ++E+EMVQ+LQVAMACV K P+ RP M+EVV M+EE+R
Sbjct  565  ELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVR  609



>ref|XP_006407752.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
 gb|ESQ49205.1| hypothetical protein EUTSA_v10020278mg [Eutrema salsugineum]
Length=639

 Score =   241 bits (615),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 140/183 (77%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQDL+ C+SDFG+ PLM   T +P RS GYRAPE
Sbjct  449  RGISHIHSATGAKLLHGNIKSPNVLLTQDLHVCVSDFGIAPLMSHHTLLPSRSLGYRAPE  508

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  509  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  568

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV M+EEIR P   + P    N+ 
Sbjct  569  ELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIR-PSTGSGPGSA-NRA  626

Query  150  RSP  142
             SP
Sbjct  627  SSP  629



>emb|CDP06375.1| unnamed protein product [Coffea canephora]
Length=667

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 147/183 (80%), Gaps = 11/183 (6%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH V G +L+HGNIKSSNVLLTQDL+GC SDFG+TP++G   +P RS+GYRAPEV
Sbjct  489  RGIAHIHCVAGRKLSHGNIKSSNVLLTQDLSGCASDFGVTPIVG---LPRRSSGYRAPEV  545

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAA-------QEEVVDLPKWVQSVVREEWT  349
             ETRK TQ SDVYS GV LLELLTGKAPV   A       Q+ VVDLP+WVQSV REEWT
Sbjct  546  SETRKYTQMSDVYSFGVVLLELLTGKAPVVQPAGQGQGQGQDGVVDLPRWVQSVAREEWT  605

Query  348  AEVFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            AEVFDA+L+  +  +EDEMVQ+LQ+AMACV + P+MRP M++VVRMI+EIRQPD  NRP+
Sbjct  606  AEVFDAQLVK-NPDIEDEMVQMLQIAMACVARTPDMRPNMEQVVRMIQEIRQPDPGNRPT  664

Query  168  XED  160
              D
Sbjct  665  SAD  667



>ref|NP_187480.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 ref|NP_974257.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 sp|Q9C9Y8.1|Y3868_ARATH RecName: Full=Probable inactive receptor kinase At3g08680; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51359.1|AC012562_20 putative protein kinase; 49514-51513 [Arabidopsis thaliana]
 gb|ACN59313.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE74662.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
 gb|AEE74663.1| leucine-rich repeat protein kinase family protein [Arabidopsis 
thaliana]
Length=640

 Score =   240 bits (613),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQ+L+ C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  451  RGISHIHSASGAKLLHGNIKSPNVLLTQELHVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  510

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  511  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR S
Sbjct  571  ELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPSMEEVVNMMEEIRPSGSGPGSGNRAS  628



>emb|CDY27986.1| BnaC05g43880D [Brassica napus]
Length=631

 Score =   240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 138/183 (75%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            +G+AHIHS  GA+L HGNIKS NVLL QDLN C+SD+G+ PLM   T +P RS GYRAPE
Sbjct  441  KGIAHIHSSSGAKLLHGNIKSPNVLLMQDLNACVSDYGIAPLMSHHTLLPSRSLGYRAPE  500

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  501  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  560

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            ELI    ++E+EMVQ+LQVAMACV K P+ RP M+EVV M+EE+R  +     S   N+ 
Sbjct  561  ELIKQQHNVEEEMVQMLQVAMACVSKHPDSRPSMEEVVNMMEEVRPSNGSGAGS--GNRA  618

Query  150  RSP  142
             SP
Sbjct  619  SSP  621



>ref|XP_002882579.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58838.1| hypothetical protein ARALYDRAFT_478170 [Arabidopsis lyrata subsp. 
lyrata]
Length=639

 Score =   239 bits (611),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG++HIHS  GA+L HGNIKS NVLLTQ+L  C+SDFG+ PLM   T IP RS GYRAPE
Sbjct  450  RGISHIHSASGAKLLHGNIKSPNVLLTQELQVCVSDFGIAPLMSHHTLIPSRSLGYRAPE  509

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK TQKSDVYS GV LLE+LTGKA  ++   EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  510  AIETRKHTQKSDVYSFGVLLLEMLTGKAAGKTTGHEEVVDLPKWVQSVVREEWTGEVFDV  569

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR----QPDFXNRPS  169
            ELI    ++E+EMVQ+LQ+AMACV K P+ RP M+EVV M+EEIR     P   NR S
Sbjct  570  ELIKQQHNVEEEMVQMLQIAMACVSKHPDSRPTMEEVVNMMEEIRPSGSGPGSGNRAS  627



>gb|KJB67957.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67958.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
 gb|KJB67959.1| hypothetical protein B456_010G219700 [Gossypium raimondii]
Length=609

 Score =   238 bits (608),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A+IH+  G + THGNIKSSNVLL+ +L  C+SD GLTPLM       R  GYRAPEV
Sbjct  428  RGIANIHTEGGGKFTHGNIKSSNVLLSDELEACVSDAGLTPLMNAPLTTSRIVGYRAPEV  487

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LT KAP+Q + Q++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  488  IETRKITQKSDVYSFGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVE  547

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q+ ++EMVQ+LQ+A+ CV K P+MRP MDE +RMIE++RQ +  NR S E
Sbjct  548  LLRF-QTFQEEMVQMLQIALTCVAKTPDMRPTMDEAIRMIEDVRQSESKNRTSSE  601



>emb|CDY32713.1| BnaA02g07750D [Brassica napus]
Length=651

 Score =   239 bits (610),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G + +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEV
Sbjct  463  KGVAHLHQVGGPKFSHGNIKSSNMIMKQESDVCVSDYGLTSLMAVPVTPMRGAGYRAPEV  522

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  523  IETRKHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  582

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+   Q++E+EMVQ+LQ+AMACV +V E+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  583  LMKV-QNIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  639



>gb|KHF99691.1| hypothetical protein F383_18108 [Gossypium arboreum]
Length=609

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 1/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A+IH+  G + THGNIKSSNVLL+ +L  C+SD GLTPLM       R  GYRAPEV
Sbjct  428  RGIANIHTEGGGKFTHGNIKSSNVLLSDELEACVSDVGLTPLMNAPLSTSRIVGYRAPEV  487

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK TQKSDVYS GV LLE+LT KAP+Q + Q++VVDLP+WV+SVVREEWTAEVFD E
Sbjct  488  IETRKITQKSDVYSFGVLLLEMLTAKAPLQPSGQDDVVDLPRWVRSVVREEWTAEVFDVE  547

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ + Q+ ++EMVQ+LQ+A+ CV K P+MRP MDE +RMIE++RQ +  NR S E
Sbjct  548  LLRF-QTFQEEMVQMLQIALTCVAKTPDMRPTMDEAIRMIEDVRQSESKNRTSSE  601



>ref|XP_006587908.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Glycine 
max]
 gb|KHN29485.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +L HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY APEV
Sbjct  442  RGIAHIHSANGRKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCA-SSRSPGYGAPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RKST+KSDVYS GV LLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD E
Sbjct  501  IESRKSTKKSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            L+ Y  ++EDE+VQ+LQ+AMACV  +P+ RP M+EVV+ IEEIR
Sbjct  561  LMRY-PNIEDELVQMLQLAMACVAAMPDTRPSMEEVVKTIEEIR  603



>ref|XP_009386109.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386110.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009386111.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=633

 Score =   238 bits (607),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH   G +L HGNIKS+NVLLTQ+L+ C+S+FGL  LM     P R  GYRAPEV
Sbjct  448  RGIAHIHVQGGGKLIHGNIKSANVLLTQELSACVSEFGLALLMNCAATPSRIMGYRAPEV  507

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +E +KST+KSDVYS GV LLELLTGK+PVQ+   +EVVDLP+WVQSVVREEWTAEVFD E
Sbjct  508  LEQQKSTEKSDVYSFGVFLLELLTGKSPVQTPGHDEVVDLPRWVQSVVREEWTAEVFDVE  567

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y  ++E++MVQ+L VAM CV +VP+ RP M++VVRMIE++R  +  +RPS E+ K +
Sbjct  568  LMKY-PNIEEDMVQMLHVAMQCVARVPDRRPTMEDVVRMIEDVRHSNSESRPSSEEGKAK  626



>ref|XP_009126766.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brassica 
rapa]
Length=651

 Score =   238 bits (607),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G + +HGNIKSSN+++ Q+ + C+SD+GLT LM     P R AGYRAPEV
Sbjct  463  KGVAHLHQVGGPKFSHGNIKSSNMIMKQENDVCVSDYGLTSLMVVPVTPMRGAGYRAPEV  522

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRK T KSDVYS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  523  IETRKHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  582

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+   Q++E+EMVQ+LQ+AMACV +V E+RP MD+VVRMIEEIR  D    RPS +DN
Sbjct  583  LMKV-QNIEEEMVQMLQIAMACVAQVAEVRPSMDDVVRMIEEIRVSDSSETRPSSDDN  639



>ref|XP_006602721.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Glycine max]
 ref|XP_003551618.2| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Glycine max]
Length=607

 Score =   236 bits (603),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 135/164 (82%), Gaps = 2/164 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +L HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY +PEV
Sbjct  442  RGLAHIHSANGKKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCG-SSRSPGYGSPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RKSTQKSDVYS GV LLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD E
Sbjct  501  IESRKSTQKSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            L+ Y  ++EDE+VQ+LQ+AMACV  +P++RP M+EVVR IEE+R
Sbjct  561  LMRY-PNIEDELVQMLQLAMACVAVMPDVRPSMEEVVRTIEELR  603



>ref|XP_009363779.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=635

 Score =   237 bits (605),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 2/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV GA+ +HGNIKS+N+LLTQ+L  CISD GL+PLM F     R+ GYRAPE 
Sbjct  455  KGLAHIHSV-GAKCSHGNIKSTNILLTQELEACISDVGLSPLMSFPPAMSRAIGYRAPEA  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            ++ RK+T KSDVYS GV LLE+LTGKA ++    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  514  VDMRKTTHKSDVYSFGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+ +H  +E+EMVQ+LQ+A+ACV K+PE RP MDEVVRMIEE+RQ D   RPS E
Sbjct  574  LLKHHH-IEEEMVQVLQIALACVTKLPETRPNMDEVVRMIEELRQSDTKTRPSSE  627



>ref|XP_008234182.1| PREDICTED: probable inactive receptor kinase At5g58300 [Prunus 
mume]
Length=601

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  GA+ +HGNIKS+NVLLTQDL  CI+D GL+PLM F     R+ GYRAPE 
Sbjct  421  KGIAHIHS-EGAKCSHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMSRATGYRAPEA  479

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             + RK + KSDVYS GV LLE+LTGK  +Q    + V+DLP+WV+SVVREEWTAEVFD E
Sbjct  480  TDMRKISHKSDVYSFGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLE  539

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+   Q +E+EMVQ+LQ+A+ACV K+PE RP+MDEVVRMIEEIRQ D   RPS E
Sbjct  540  LLR-QQHIEEEMVQMLQIALACVSKLPEARPRMDEVVRMIEEIRQSDTKTRPSSE  593



>ref|XP_009123870.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
 ref|XP_009123879.1| PREDICTED: probable inactive receptor kinase At3g08680 [Brassica 
rapa]
Length=618

 Score =   236 bits (603),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 135/179 (75%), Gaps = 6/179 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            +G++HIHS  GA+L HGNIKS NVLLTQDLN C+SD+ + PLM   T +P RS GYRAPE
Sbjct  428  KGISHIHSASGAKLLHGNIKSPNVLLTQDLNACVSDYSIAPLMSHHTLLPSRSLGYRAPE  487

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETRK T KSDVYS GV LLE+LTGKA  ++A  EE+VDLPKWVQSVVREEWT EVFD 
Sbjct  488  AIETRKHTHKSDVYSFGVLLLEMLTGKAAGKTAGHEELVDLPKWVQSVVREEWTGEVFDV  547

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ-----PDFXNRPS  169
            ELI    ++E+EMVQ LQ+AMACV + P+ RP M+EVV M+EEIR      P   NR S
Sbjct  548  ELIKQQHNVEEEMVQTLQIAMACVSRHPDSRPSMEEVVNMMEEIRASTGSGPGSANRAS  606



>gb|KHN40609.1| Putative inactive receptor kinase [Glycine soja]
Length=607

 Score =   236 bits (602),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIHS  G +L HGNIKSSNV+L+ DL GCISDFGLTPL  F     RS GY +PEV
Sbjct  442  RGLAHIHSANGKKLVHGNIKSSNVILSIDLQGCISDFGLTPLTNFCG-SSRSPGYGSPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE+RKSTQKSDVYS GV LLE+LTGK PVQ +  +EVVDLPKWVQSVVREEWTAEVFD E
Sbjct  501  IESRKSTQKSDVYSFGVLLLEMLTGKTPVQYSGHDEVVDLPKWVQSVVREEWTAEVFDLE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            L+ Y  ++EDE+VQ+LQ+AMACV  +P+ RP M+EVVR IEE+R
Sbjct  561  LMRY-PNIEDELVQMLQLAMACVAVMPDARPSMEEVVRTIEELR  603



>ref|XP_007220535.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
 gb|EMJ21734.1| hypothetical protein PRUPE_ppa002812mg [Prunus persica]
Length=631

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 135/175 (77%), Gaps = 2/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  GA+ +HGNIKS+NVLLTQDL  CI+D GL+PLM F     R+ GYRAPE 
Sbjct  451  KGIAHIHS-EGAKCSHGNIKSTNVLLTQDLEACITDVGLSPLMNFPATMSRATGYRAPEA  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             + RK + KSDVYS GV LLE+LTGK  +Q    + V+DLP+WV+SVVREEWTAEVFD E
Sbjct  510  TDMRKISHKSDVYSFGVLLLEMLTGKTTLQYPGHDSVIDLPRWVKSVVREEWTAEVFDLE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+   Q +E+EMVQ+LQ+A+ACV K+PE RP MDEVVRMIEEIRQ D   RPS E
Sbjct  570  LLR-QQHIEEEMVQMLQIALACVSKLPEARPSMDEVVRMIEEIRQSDTKTRPSSE  623



>gb|KEH35517.1| receptor-like kinase [Medicago truncatula]
Length=635

 Score =   233 bits (595),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A IH+  G + THGNIKS+NVL+T++ + CISD GL PLM       R+ GYRAPEV
Sbjct  453  KGIAFIHTEGGQKFTHGNIKSTNVLITEEFDSCISDVGLPPLMNAPATMSRTNGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             +++K TQKSDVYS GV LLELLTGK P++    E+VVDLP+WV+SVVREEWTAEVFD E
Sbjct  513  TDSKKITQKSDVYSFGVLLLELLTGKVPMRYPGYEDVVDLPRWVRSVVREEWTAEVFDEE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+   Q +E+EMVQ+LQ+A+ACV K P+MRP+MDE VRMIEEI+ P+F NR S E 
Sbjct  573  LLR-GQYVEEEMVQMLQIALACVAKTPDMRPRMDEAVRMIEEIKNPEFKNRTSSES  627



>gb|KEH23299.1| LRR receptor-like kinase [Medicago truncatula]
Length=611

 Score =   232 bits (592),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSNVLLT DL GCISDFGLTPL      P    GYRAPEV
Sbjct  445  KGIAHIHSANGRKHVHGNIKSSNVLLTIDLQGCISDFGLTPLTSLCVSPKSPPGYRAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             E+RK TQKSDVYS GV LLE+LTGK PVQ +  ++VVDLPKWVQSVVREEWTAEVFD +
Sbjct  505  NESRKYTQKSDVYSFGVLLLEMLTGKTPVQYSGHDDVVDLPKWVQSVVREEWTAEVFDLD  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            L+ Y  ++E+++VQ+LQ+AMACV ++P+ RP M+EVVRMIE+IR
Sbjct  565  LMRY-SNIEEDLVQMLQLAMACVAEMPDTRPSMEEVVRMIEDIR  607



>ref|XP_010322111.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Solanum lycopersicum]
Length=594

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            +G+AHIHS  G + THGNIK+SN+LLT+DL+GCISDFGL+PLM  T+I    A GY APE
Sbjct  429  KGIAHIHSEGGTKFTHGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPE  488

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK TQKSDVYS GV +LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDA
Sbjct  489  VIETRKGTQKSDVYSFGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDA  548

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
             L+ YH ++++EMV +LQ+A+ CV KVP+MRP M EV++MIE+I+ 
Sbjct  549  VLMKYH-NIQEEMVHMLQIALLCVAKVPDMRPSMGEVIKMIEQIKH  593



>ref|XP_004241083.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Solanum lycopersicum]
Length=593

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            +G+AHIHS  G + THGNIK+SN+LLT+DL+GCISDFGL+PLM  T+I    A GY APE
Sbjct  428  KGIAHIHSEGGTKFTHGNIKASNILLTRDLDGCISDFGLSPLMNHTSIKNNKAVGYHAPE  487

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK TQKSDVYS GV +LELLTGK+P+     E+VV+LP+WV++VV+EEWTAEVFDA
Sbjct  488  VIETRKGTQKSDVYSFGVLVLELLTGKSPLPLPGHEDVVNLPRWVRAVVKEEWTAEVFDA  547

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
             L+ YH ++++EMV +LQ+A+ CV KVP+MRP M EV++MIE+I+ 
Sbjct  548  VLMKYH-NIQEEMVHMLQIALLCVAKVPDMRPSMGEVIKMIEQIKH  592



>ref|XP_007140053.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
 gb|ESW12047.1| hypothetical protein PHAVU_008G080500g [Phaseolus vulgaris]
Length=607

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RGV HIHS  G +L HGNIKSSNV+LT DL GCISDFGLTPL  F     RS GY APEV
Sbjct  442  RGVCHIHSANGRKLVHGNIKSSNVILTIDLQGCISDFGLTPLTNFCA-SSRSPGYGAPEV  500

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IETRKSTQKSDVYS GV LLE+LTGK PVQ +  +E VDLPKWVQSVVREEWTAEVFD E
Sbjct  501  IETRKSTQKSDVYSFGVLLLEMLTGKTPVQYSGHDEEVDLPKWVQSVVREEWTAEVFDLE  560

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  199
            L+ Y  ++EDE+VQ+LQ+AMACV  +P+ RP M EVV+ IEEI
Sbjct  561  LMRY-PNIEDELVQMLQLAMACVAVMPDSRPSMVEVVKTIEEI  602



>ref|XP_009410507.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 2/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPE  511
            RG+  IH     +  HG+IKS+N+LLTQ+L+ C+ D+GL PLM     P R   GYRAPE
Sbjct  450  RGIGCIHIDGSGKFIHGDIKSNNILLTQELDACVCDYGLAPLMNSAATPSRIVVGYRAPE  509

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            VIETRK TQKSDVYS GV LLE+LTGKAP+QS  +++V DLP+WVQSVVREEWTAEVFD 
Sbjct  510  VIETRKYTQKSDVYSFGVLLLEMLTGKAPLQSPGRDDVADLPRWVQSVVREEWTAEVFDV  569

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            EL+ Y   +E+EMVQ+LQ+AMACV K P+ RPKM+EV+RMIE+I+  D  NRPS E
Sbjct  570  ELMRYPH-IEEEMVQMLQIAMACVSKAPDQRPKMEEVIRMIEDIQHSDSENRPSSE  624



>ref|XP_004502808.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X1 [Cicer arietinum]
 ref|XP_004502809.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X2 [Cicer arietinum]
 ref|XP_004502810.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Cicer arietinum]
Length=644

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 137/177 (77%), Gaps = 1/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A IHS  G + THGNIKS+NVL+TQ+L+ CISD GL PLM       R+ GYRAPEV
Sbjct  462  KGIAFIHSEGGPKFTHGNIKSTNVLITQELDSCISDVGLPPLMNTPATMSRANGYRAPEV  521

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ++RK TQKSDVYS GV LLE+LTGK P++    E+ VDLP+WV+SVVREEWTAEVFD E
Sbjct  522  TDSRKITQKSDVYSFGVLLLEMLTGKVPMRYPGYEDFVDLPRWVRSVVREEWTAEVFDEE  581

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            ++   Q +E+EMVQ+LQ+ +ACV K P+MRP+MDE VRMIEEI+ P+F NR S E +
Sbjct  582  VLR-GQYVEEEMVQMLQIGLACVAKTPDMRPRMDEAVRMIEEIKHPEFKNRTSSESD  637



>gb|EEE55588.1| hypothetical protein OsJ_03884 [Oryza sativa Japonica Group]
Length=251

 Score =   221 bits (564),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 139/183 (76%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV
Sbjct  67   RGIAHLHAEGGGKFIHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPARLVGYRAPEV  126

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+K TQKSDVYS GV +LE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD 
Sbjct  127  LETKKPTQKSDVYSFGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDV  186

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNR-PSXEDNK  154
            +L+  H ++EDEMVQ+LQVAMACV   P+ RPKMDEV+R I EIR     +R P  E  K
Sbjct  187  DLLR-HPNIEDEMVQMLQVAMACVAAPPDQRPKMDEVIRRIVEIRNSYSGSRTPPEEKQK  245

Query  153  XRS  145
              S
Sbjct  246  DES  248



>ref|XP_008376328.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   232 bits (591),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 137/173 (79%), Gaps = 2/173 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHSV GA+ +HGNIKS+N+LLTQ+L  CISD GL+PLM F     R+ GYR PE 
Sbjct  455  KGLAHIHSV-GAKCSHGNIKSTNILLTQELEACISDVGLSPLMNFPPAMSRAIGYRPPEA  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+ RK+T KSDVYS GV LLE+LTGKA ++    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  514  IDMRKTTHKSDVYSFGVLLLEMLTGKATLEYLGHDCVVDLPRWVKSVVREEWTAEVFDLE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            L+ +H  +E+EMVQ+LQ+A+ACV K+PE RP MDEVVRMI E+RQ D   RPS
Sbjct  574  LLKHHH-IEEEMVQVLQIALACVTKLPETRPNMDEVVRMIGELRQSDTKTRPS  625



>emb|CDY22164.1| BnaC01g39370D [Brassica napus]
Length=565

 Score =   230 bits (587),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 133/183 (73%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTT-IPPRSAGYRAPE  511
            +G+AHIHS  GA+L HGNIKS NVLLTQDLN C+SD+G+ PLM     +  RS GY APE
Sbjct  225  KGIAHIHSASGAKLLHGNIKSPNVLLTQDLNACVSDYGIAPLMSHHAFLSSRSLGYIAPE  284

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
             IETR+ T KSD+YS GV LLE+LTGKA  ++A  EEVVDLPKWVQSVVREEWT EVFD 
Sbjct  285  AIETRQHTHKSDMYSFGVLLLEMLTGKAAGKTAGHEEVVDLPKWVQSVVREEWTGEVFDV  344

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            ELI    + E+EMVQ LQ+AMACV K P+ RP M+EVV M+EEIR   F        N+ 
Sbjct  345  ELIKQQHNAEEEMVQTLQIAMACVSKHPDSRPSMEEVVNMMEEIRA--FTGSGPGSANRA  402

Query  150  RSP  142
             SP
Sbjct  403  SSP  405



>ref|XP_007136405.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 ref|XP_007136406.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08399.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
 gb|ESW08400.1| hypothetical protein PHAVU_009G042300g [Phaseolus vulgaris]
Length=640

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A IHS  G + THGNIKS+NVL++Q+L GCISD GL PLM       RS GYRAPEV
Sbjct  459  KGIAFIHSEGGPKFTHGNIKSNNVLISQELEGCISDVGLPPLMNTPATMSRSNGYRAPEV  518

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             +++K TQKSDVYS GV LLE+LTGK P++    E+VVDLP+WV+SVVREEWTAEVFD E
Sbjct  519  TDSKKITQKSDVYSFGVVLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEE  578

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+   Q +E+EMVQ+LQ+A+ACV K  E RP+MDEV RMIEEI+ P+  NRPS E 
Sbjct  579  LLR-GQYVEEEMVQMLQIALACVAKGSENRPRMDEVARMIEEIKHPELKNRPSSES  633



>ref|XP_004308997.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
 ref|XP_011470006.1| PREDICTED: probable inactive receptor kinase At5g58300 [Fragaria 
vesca subsp. vesca]
Length=643

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 138/180 (77%), Gaps = 6/180 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF---TTIPPRSAGYRA  517
            R +AHIHS  G +  HGNIKS+NVLLT++L  CISD GLTPLM F   T++  R+ GYRA
Sbjct  459  RAIAHIHSEGGVKCIHGNIKSTNVLLTEELEACISDVGLTPLMNFPVATSMSRRATGYRA  518

Query  516  PEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEE--VVDLPKWVQSVVREEWTAE  343
            PE I+ RK + KSDVYS GV LLE+LTGK  +Q+A   +  VVDLP+WV+SVVREEWTAE
Sbjct  519  PEAIDMRKMSDKSDVYSFGVLLLEMLTGKTTLQNAGHYDDVVVDLPRWVKSVVREEWTAE  578

Query  342  VFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            VFD EL+   Q +E+EMVQ+LQ+A+ACV K+PE RPKMD+VVRM+EE RQ D   RPS E
Sbjct  579  VFDLELLK-QQGIEEEMVQMLQIALACVAKLPESRPKMDDVVRMLEEFRQSDTKTRPSSE  637



>ref|XP_009391668.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009391669.1| PREDICTED: probable inactive receptor kinase At5g58300 [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 2/176 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPR-SAGYRAPEV  508
            G+AHIHS  GA+L HGNIKSSN+LL QDL   +SD+GL  LM     P R   GYRAPE 
Sbjct  468  GIAHIHSKGGAKLAHGNIKSSNILLNQDLKPVVSDYGLMVLMNLPAKPSRIVVGYRAPET  527

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RK TQKSD+YS GV LLE+LTGKAP+QS   ++VVDLP+WVQSVVREEWTAEVFD E
Sbjct  528  IEARKITQKSDIYSFGVLLLEMLTGKAPLQSQGHDDVVDLPRWVQSVVREEWTAEVFDRE  587

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+   Q+ E+EMVQ+LQ+AMACV +VP+ RP+++EV++ IEEIRQ    +RPS ED
Sbjct  588  LMG-SQNTEEEMVQMLQIAMACVARVPDRRPRIEEVIQRIEEIRQSGSESRPSSED  642



>gb|KHG24076.1| hypothetical protein F383_10304 [Gossypium arboreum]
Length=650

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIK+SNVLL  D + CISDFGL PL G TT P R AGYRAPEV
Sbjct  453  RGLAHLH-VSG-KVVHGNIKASNVLLRPDQDACISDFGLNPLFGNTTPPSRVAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  511  LETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH S+E+EMVQLLQ+AM CV  VP+ RP M EVVRMIEE+ +
Sbjct  571  LMRYH-SIEEEMVQLLQIAMTCVSTVPDQRPSMQEVVRMIEEMNR  614



>ref|XP_010109178.1| putative inactive receptor kinase [Morus notabilis]
 gb|EXC21107.1| putative inactive receptor kinase [Morus notabilis]
Length=635

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 135/177 (76%), Gaps = 1/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +  HGNIKSSNVLL+QDL  CI+DFGL  ++ F  I  R  GYRAPE 
Sbjct  453  KGIAHIHSEGGPKCIHGNIKSSNVLLSQDLEACITDFGLAQIVNFPPIISRILGYRAPEA  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+TRK TQKSDVYS GV LLE+LTGK P++     EVVDLP+WV+SVVREEWT+EVFD E
Sbjct  513  IDTRKLTQKSDVYSFGVLLLEMLTGKIPIRYPGHNEVVDLPRWVRSVVREEWTSEVFDVE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            ++     +E+EMVQ+LQ+A+ACV KVP+ RP M+EVV+MIE++R P    RPS E +
Sbjct  573  ILR-QTYVEEEMVQMLQIALACVSKVPDSRPNMEEVVKMIEDVRPPQTKTRPSSESD  628



>gb|KJB54134.1| hypothetical protein B456_009G022300 [Gossypium raimondii]
Length=650

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIK+SNVLL  D + CISDFGL PL G +T P R AGYRAPEV
Sbjct  453  RGLAHLH-VSG-KVVHGNIKASNVLLRSDQDACISDFGLNPLFGNSTPPSRVAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  511  LETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH S+E+EMVQLLQ+AM CV  VP+ RP M EVVRMIEE+ +
Sbjct  571  LMRYH-SIEEEMVQLLQIAMTCVSTVPDQRPSMQEVVRMIEEMNR  614



>ref|XP_010921194.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=349

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 2/165 (1%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPEV  508
            G+AHIHS  G +  HGNIKSSN+LL QDLN  +SD+GL+PLM    T+     GYRAPE 
Sbjct  169  GIAHIHSEGGPKFVHGNIKSSNILLGQDLNPLVSDYGLSPLMNPPATLSQLMVGYRAPET  228

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK TQKSDVYS GV LLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAEVFD E
Sbjct  229  METRKITQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEVFDVE  288

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+  H + E+E+V++LQ+AM+CV + PE RP+M++VVRMIEEIR+
Sbjct  289  LMMDHNN-EEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRK  332



>ref|XP_008813233.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=636

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 10/177 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYR  520
            GVAHIHS  G +  HGNIKSSN+LL+QDLN  +SD+GL+PLM     PP +      GYR
Sbjct  455  GVAHIHSEGGPKFVHGNIKSSNILLSQDLNPFVSDYGLSPLMN----PPATLSQVVVGYR  510

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE +ETRK TQKSDVYS GV LLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAEV
Sbjct  511  APETVETRKVTQKSDVYSFGVLLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAEV  570

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPS  169
            FD EL+ Y Q++E+E+V++L +AM+CV + PE RP+M++V+RMIEEIR+    +RPS
Sbjct  571  FDVELMRY-QNIEEELVRMLHIAMSCVARTPEQRPRMEDVIRMIEEIRKSGSESRPS  626



>gb|KHN48152.1| Putative inactive receptor kinase [Glycine soja]
Length=250

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -3

Query  687  RGVAHIHSVP-GARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPE  511
            +G+A IH+    ++LTHGNIKSSNVL+ Q  +GCI+D GLTP+M   +   R+ GYRAPE
Sbjct  67   KGIASIHTDHMDSKLTHGNIKSSNVLINQQHDGCITDVGLTPMMSTQSTMSRANGYRAPE  126

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V E R+ TQKSDVYS GV LLELLTGKAP+     E++VDLP+WV+SVVREEWTAEVFD 
Sbjct  127  VTEYRRITQKSDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDE  186

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNR--PSXEDN  157
            EL+   Q  E+EMVQ+LQ+A+ACV KV + RP MDE VR IEEIR P+  NR   S  D+
Sbjct  187  ELLR-GQYFEEEMVQMLQIALACVAKVSDNRPTMDETVRNIEEIRLPELKNRNTSSESDS  245

Query  156  KXRSP  142
              ++P
Sbjct  246  NVQTP  250



>ref|XP_004492584.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Cicer 
arietinum]
Length=611

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 131/164 (80%), Gaps = 1/164 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  G +L HGNIKSSNVLL+ DL G ISDFGLTPL      P    GY+APEV
Sbjct  445  KGIAHIHSANGRKLVHGNIKSSNVLLSIDLQGSISDFGLTPLTSLCVSPKSPPGYQAPEV  504

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             E+RKSTQKSDVYS GV LLE+LTGK P Q +  ++VVDLPKWVQSVVREEWTAEVFD E
Sbjct  505  NESRKSTQKSDVYSFGVLLLEMLTGKTPAQYSGHDDVVDLPKWVQSVVREEWTAEVFDLE  564

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIR  196
            L+ Y  ++E+E+VQ+LQ+AMACV  +P+ RP M+EVV+MIE+IR
Sbjct  565  LMRY-PNIEEELVQMLQLAMACVAVMPDTRPSMEEVVKMIEDIR  607



>gb|EEC75189.1| hypothetical protein OsI_11426 [Oryza sativa Indica Group]
Length=495

 Score =   224 bits (572),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            RG+AHIH+  G++L HGNIK++NVLL QD N  +SD+GL+ LM F     R   GYRAPE
Sbjct  310  RGIAHIHAEGGSKLAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPE  369

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
              E+RK T KSDVYS GV L+E+LTGKAP+QS  Q++VVDLP+WV SVVREEWTAEVFD 
Sbjct  370  TFESRKFTHKSDVYSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDV  429

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            EL+ Y  ++EDE+VQ+LQ+AMAC  + PE RP M EV+RMIEE+RQ    +R S  +N  
Sbjct  430  ELMKY-LNIEDELVQMLQLAMACTSRSPERRPTMAEVIRMIEELRQSASESRDSSNENAR  488

Query  150  RS  145
             S
Sbjct  489  ES  490



>ref|XP_002281635.1| PREDICTED: probable inactive receptor kinase At2g26730 [Vitis 
vinifera]
 emb|CBI28134.3| unnamed protein product [Vitis vinifera]
Length=653

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 134/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  D + C+SDFGL PL G +T P R AGYRAPEV
Sbjct  456  RGIAHLH-VSG-KVVHGNIKSSNILLRPDHDACVSDFGLNPLFGNSTPPNRVAGYRAPEV  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  514  METRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  574  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  617



>emb|CDX88667.1| BnaA03g09820D [Brassica napus]
Length=625

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 139/178 (78%), Gaps = 15/178 (8%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +GVAH+H V G++ +HGNIKSSNV++ Q+ + C+SDFG              AGYRAPEV
Sbjct  450  KGVAHLHEVGGSKFSHGNIKSSNVIMKQENDVCVSDFG-------------GAGYRAPEV  496

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I TRK T KSDVYS GV +LE+LTGK+PVQS ++E++VDLP+WVQSVVREEWT+EVFD E
Sbjct  497  IVTRKHTHKSDVYSFGVLILEMLTGKSPVQSPSREDMVDLPRWVQSVVREEWTSEVFDVE  556

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX-NRPSXEDN  157
            L+ + Q++E+EMVQ+LQ+AMACV  VPE+RP MDEVVRMIEEIR  D    RPS +DN
Sbjct  557  LMKF-QNIEEEMVQMLQIAMACVAHVPEVRPSMDEVVRMIEEIRVSDSSETRPSSDDN  613



>gb|KHN40012.1| Putative inactive receptor kinase [Glycine soja]
Length=203

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -3

Query  687  RGVAHIHSVP-GARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPE  511
            +G+A IH+    ++LTHGNIKSSNVL+TQ  +GCI+D GLTP+M   +   R+ GYRAPE
Sbjct  20   KGIASIHTDHMDSKLTHGNIKSSNVLITQQHDGCITDVGLTPMMSTQSTMSRANGYRAPE  79

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V E R+ TQKSDVYS GV LLELLTGKAP+     E++VDLP+WV+SVVREEWTAEVFD 
Sbjct  80   VTEYRRITQKSDVYSFGVLLLELLTGKAPLGYPGYEDMVDLPRWVRSVVREEWTAEVFDE  139

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFX--NRPSXEDN  157
            EL+   Q  E+EMVQ+LQ+A+ACV K+ + RP MDE VR IEEIR P+    N  S  D+
Sbjct  140  ELLR-GQYFEEEMVQMLQIALACVAKLADNRPTMDETVRNIEEIRLPELKNPNTSSESDS  198

Query  156  KXRSP  142
              ++P
Sbjct  199  NLQTP  203



>gb|EEE64112.1| hypothetical protein OsJ_18944 [Oryza sativa Japonica Group]
Length=638

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV
Sbjct  453  RGIAHLHAEGGGKFIHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET++ TQKSDVYS GV LLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWT+EVFDA
Sbjct  513  LETKRQTQKSDVYSYGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTSEVFDA  572

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            +L+  H + EDEMVQ+LQ+AMACV  VP+ RP+M+EVVR IEEIR      R S ED
Sbjct  573  DLLR-HPNSEDEMVQMLQLAMACVAIVPDQRPRMEEVVRRIEEIRNSSSGTRLSPED  628



>ref|NP_001055854.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|AAT01376.1| putative phytosulfokine receptor kinase [Oryza sativa Japonica 
Group]
 dbj|BAF17768.1| Os05g0480400 [Oryza sativa Japonica Group]
 gb|EAY98442.1| hypothetical protein OsI_20356 [Oryza sativa Indica Group]
 dbj|BAG99879.1| unnamed protein product [Oryza sativa Japonica Group]
Length=638

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV
Sbjct  453  RGIAHLHAEGGGKFIHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET++ TQKSDVYS GV LLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWT+EVFDA
Sbjct  513  LETKRQTQKSDVYSYGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTSEVFDA  572

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            +L+  H + EDEMVQ+LQ+AMACV  VP+ RP+M+EVVR IEEIR      R S ED
Sbjct  573  DLLR-HPNSEDEMVQMLQLAMACVAIVPDQRPRMEEVVRRIEEIRNSSSGTRLSPED  628



>ref|XP_002324958.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEF03523.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=621

 Score =   226 bits (577),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  D + C+SD+GL PL G +T P R AGYRAPEV
Sbjct  424  RGLAHLHI--AGKVIHGNIKSSNILLRPDNDACVSDYGLNPLFGTSTPPSRVAGYRAPEV  481

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  482  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  541

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  542  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  585



>ref|XP_006451034.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 ref|XP_006451035.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64274.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
 gb|ESR64275.1| hypothetical protein CICLE_v10007694mg [Citrus clementina]
Length=654

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIK+SN+LL  D + C+SDFGL PL G TT P R AGYRAPEV
Sbjct  457  RGLAHLH-VSG-KIVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEV  514

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  515  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  574

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EVVRMIE++ +
Sbjct  575  LMRYH-NIEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIEDMNR  618



>ref|XP_007013302.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
 gb|EOY30921.1| Leucine-rich repeat protein kinase family protein [Theobroma 
cacao]
Length=650

 Score =   226 bits (577),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ H+H V G ++ HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPEV
Sbjct  453  RGLTHLH-VSG-KVVHGNIKSSNILLRPDHEACISDFGLNPLFGNTTPPSRVAGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  511  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  570

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH S+E+EMVQLLQ+AM CV  VP+ RP M++VVRMIE++ +
Sbjct  571  LMRYH-SIEEEMVQLLQIAMTCVSTVPDQRPAMEDVVRMIEDMNR  614



>ref|XP_006475765.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Citrus 
sinensis]
 gb|KDO80389.1| hypothetical protein CISIN_1g036334mg [Citrus sinensis]
Length=654

 Score =   226 bits (575),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIK+SN+LL  D + C+SDFGL PL G TT P R AGYRAPEV
Sbjct  457  RGLAHLH-VSG-KIVHGNIKASNILLRPDHDACVSDFGLNPLFGNTTPPTRVAGYRAPEV  514

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  515  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  574

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EVVRMIE + +
Sbjct  575  LMRYH-NIEEEMVQLLQIAMGCVSTVPDQRPAMQEVVRMIENMNR  618



>ref|XP_008343962.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  458  RGIAHLH-VSG-KVVHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  515

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  516  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  575

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  576  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  619



>ref|XP_008386031.1| PREDICTED: probable inactive receptor kinase At2g26730 [Malus 
domestica]
Length=656

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  458  RGIAHLH-VSG-KVVHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  515

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  516  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  575

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  576  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  619



>ref|XP_002529343.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
 gb|EEF33010.1| Nodulation receptor kinase precursor, putative [Ricinus communis]
Length=657

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 130/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V   ++ HGNIKSSN+LL  D +  ISDF L PL G  T P R AGYRAPEV
Sbjct  460  RGLAHLHVV--GKVVHGNIKSSNILLRPDQDAAISDFALNPLFGTATPPSRVAGYRAPEV  517

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  518  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  577

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE+I +
Sbjct  578  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDINR  621



>gb|ACZ98536.1| protein kinase [Malus domestica]
Length=655

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  457  RGIAHLH-VSG-KVVHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  514

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  515  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  574

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  575  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  618



>ref|XP_006654545.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Oryza 
brachyantha]
Length=638

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGNIKSSN+LL+Q L+ CIS+FGL  LM    IP R  GYRAPEV
Sbjct  453  RGIAHLHAEGGGKFIHGNIKSSNILLSQGLSACISEFGLAQLMAIPHIPARLIGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+++TQKSDVYS GV LLE+LTGKAP++S  +++ ++ LP+WVQSVVREEWT+EVFDA
Sbjct  513  LETKRATQKSDVYSFGVLLLEMLTGKAPLRSPGRDDSIEHLPRWVQSVVREEWTSEVFDA  572

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            +L+    S EDEMVQ+LQ+AMACV  +P+ RP+MDEVV+ IEEIR      R S ED
Sbjct  573  DLLRQPNS-EDEMVQMLQLAMACVAILPDQRPRMDEVVKRIEEIRNSSSGTRSSPED  628



>ref|XP_011009200.1| PREDICTED: probable inactive receptor kinase At2g26730 [Populus 
euphratica]
Length=653

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  + + C+SD+GL PL G +T P R AGYRAPEV
Sbjct  456  RGLAHLHI--AGKVIHGNIKSSNILLRPEHDACVSDYGLNPLFGTSTPPSRVAGYRAPEV  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  514  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M+EVVRMIE++ +
Sbjct  574  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMEEVVRMIEDMNR  617



>ref|XP_010915719.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915720.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010915721.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=640

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 135/177 (76%), Gaps = 4/177 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAP  514
            RG+AHIHS    +L HGNIKSSN  L     GCISD GLT LM    +PP  R+AGYRAP
Sbjct  448  RGIAHIHSQNNGKLVHGNIKSSNAFLNNQQYGCISDLGLTSLMN-PMVPPVSRTAGYRAP  506

Query  513  EVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFD  334
            EV++ RK+TQ SDVYS GV +LELLTGK+P+Q    +EVV L +WVQSVVREEWTAEVFD
Sbjct  507  EVVDLRKTTQASDVYSFGVLMLELLTGKSPIQITGGDEVVHLVRWVQSVVREEWTAEVFD  566

Query  333  AELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
             EL+ Y  ++E+EMV++LQ+AM CV ++PE RPKM EVVRMIE++R+ D  NRPS E
Sbjct  567  VELMRY-PNIEEEMVEMLQIAMTCVVRMPEQRPKMSEVVRMIEDVRRFDTGNRPSSE  622



>ref|NP_001050019.1| Os03g0332900 [Oryza sativa Japonica Group]
 gb|ABF95778.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95779.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11933.1| Os03g0332900 [Oryza sativa Japonica Group]
 dbj|BAG95872.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59003.1| hypothetical protein OsJ_10722 [Oryza sativa Japonica Group]
Length=634

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 2/182 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPE  511
            RG+AHIH+  G++L HGNIK++NVLL QD N  +SD+GL+ LM F     R   GYRAPE
Sbjct  449  RGIAHIHAEGGSKLAHGNIKATNVLLDQDHNPYVSDYGLSALMSFPISTSRVVVGYRAPE  508

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
              E+RK T KSDVYS GV L+E+LTGKAP+QS  Q++VVDLP+WV SVVREEWTAEVFD 
Sbjct  509  TFESRKFTHKSDVYSFGVLLMEMLTGKAPLQSQGQDDVVDLPRWVHSVVREEWTAEVFDV  568

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            EL+ Y  ++EDE+VQ+LQ+AMAC  + PE RP M EV+RMIEE+RQ    +R S  +N  
Sbjct  569  ELMKY-LNIEDELVQMLQLAMACTSRSPERRPTMAEVIRMIEELRQSASESRDSSNENAR  627

Query  150  RS  145
             S
Sbjct  628  ES  629



>ref|XP_008388375.1| PREDICTED: probable inactive receptor kinase At5g58300 [Malus 
domestica]
Length=635

 Score =   224 bits (572),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 133/175 (76%), Gaps = 2/175 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  GA+ +HGNIKS+NVLLTQ+L  CISD GL+PLM F     R+ GYRAPE 
Sbjct  455  KGLAHIHS-EGAKSSHGNIKSTNVLLTQELEACISDVGLSPLMNFPPAMSRAMGYRAPEA  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             + RK T KSDVYS GV LLE+LTGK  +Q    + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  514  TDMRKITHKSDVYSFGVLLLEMLTGKTTLQYPGYDCVVDLPRWVKSVVREEWTAEVFDLE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            L+   Q  E+EMVQ+LQ+A+ACV K+PE RP MDEVVRMIEE+RQ D   R S E
Sbjct  574  LLK-QQHSEEEMVQMLQIALACVTKLPETRPNMDEVVRMIEELRQSDTKTRQSSE  627



>ref|XP_002456542.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
 gb|EES01662.1| hypothetical protein SORBIDRAFT_03g038110 [Sorghum bicolor]
Length=635

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGNIK+SNVLL+Q+L+GC+S+FGL  +M      PR  GYRAPEV
Sbjct  451  RGIAHLHAEGGGKFIHGNIKASNVLLSQNLDGCVSEFGLAQIMTTPQTAPRLVGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+KSTQKSDVYS GV LLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD 
Sbjct  511  LETKKSTQKSDVYSFGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            +L+  H ++EDEMVQ+LQ+AMACV   PE RPKM+EV+R I EIR 
Sbjct  571  DLLR-HPNVEDEMVQMLQIAMACVAIAPEQRPKMEEVIRRITEIRN  615



>ref|XP_004167200.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At2g26730-like [Cucumis sativus]
Length=653

 Score =   224 bits (572),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  D + CISDFGL PL G  T P R AGYRAPEV
Sbjct  455  RGLAHLHLT--GKVVHGNIKSSNILLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q +  E+ +DLP+WVQSVVREEWTAEVFDAE
Sbjct  513  VETRKVTFKSDVYSYGVLLLELLTGKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  199
            L+ +H  +E+EMVQLLQ+AM+CV  VP+ RP M EVVRMIE++
Sbjct  573  LMRFHN-IEEEMVQLLQIAMSCVSTVPDQRPAMPEVVRMIEDM  614



>ref|XP_004139332.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Cucumis 
sativus]
 gb|KGN60644.1| Protein kinase [Cucumis sativus]
Length=653

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  D + CISDFGL PL G  T P R AGYRAPEV
Sbjct  455  RGLAHLHLT--GKVVHGNIKSSNILLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q +  E+ +DLP+WVQSVVREEWTAEVFDAE
Sbjct  513  VETRKVTFKSDVYSYGVLLLELLTGKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  199
            L+ +H  +E+EMVQLLQ+AM+CV  VP+ RP M EVVRMIE++
Sbjct  573  LMRFHN-IEEEMVQLLQIAMSCVSTVPDQRPAMPEVVRMIEDM  614



>gb|KHG18372.1| hypothetical protein F383_03411 [Gossypium arboreum]
Length=651

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ H+H    A+L HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPE+
Sbjct  455  RGLEHLHV--SAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEI  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ET K T +SDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  513  LETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH S+E+EMVQLLQ+AM CV  VP+ RP M EVVRMIE++ +
Sbjct  573  LMRYH-SIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNR  616



>ref|XP_004167125.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At2g26730-like [Cucumis sativus]
Length=664

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     +L HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  465  RGLAHLHL--SGKLVHGNIKSSNILLRPNHDAAVSDFGLNPLFGASTPPNRIAGYRAPEV  522

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  523  VETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  582

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIEE+ +
Sbjct  583  LMRYH-NIEEEMVQLLQIAMACVATVPDQRPSMQEVVRMIEELNR  626



>ref|XP_004149854.1| PREDICTED: probable inactive receptor kinase At2g26730-like [Cucumis 
sativus]
 gb|KGN65392.1| hypothetical protein Csa_1G407160 [Cucumis sativus]
Length=664

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     +L HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  465  RGLAHLHL--SGKLVHGNIKSSNILLRPNHDAAVSDFGLNPLFGASTPPNRIAGYRAPEV  522

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  523  VETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  582

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIEE+ +
Sbjct  583  LMRYH-NIEEEMVQLLQIAMACVATVPDQRPSMQEVVRMIEELNR  626



>ref|XP_008458016.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=652

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  D + CISDFGL PL G  T P R AGYRAPEV
Sbjct  454  RGLAHLHLT--GKVVHGNIKSSNILLRPDHDACISDFGLNPLFGTATPPNRVAGYRAPEV  511

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q +  E+ +DLP+WVQSVVREEWTAEVFDAE
Sbjct  512  VETRKVTFKSDVYSYGVLLLELLTGKAPNQQSLGEDGIDLPRWVQSVVREEWTAEVFDAE  571

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  199
            L+ +H  +E+EMVQLLQ+AM+CV  VP+ RP M EVVRMIE++
Sbjct  572  LMRFHN-IEEEMVQLLQIAMSCVSTVPDQRPAMPEVVRMIEDM  613



>gb|KJB64834.1| hypothetical protein B456_010G067400 [Gossypium raimondii]
Length=651

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ H+H    A+L HGNIKSSN+LL  D   CISDFGL PL G TT P R AGYRAPE+
Sbjct  455  RGLEHLHV--SAKLVHGNIKSSNILLRSDHKACISDFGLNPLFGNTTPPSRVAGYRAPEI  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ET K T +SDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  513  LETCKVTFESDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH S+E+EMVQLLQ+AM CV  VP+ RP M EVVRMIE++ +
Sbjct  573  LMRYH-SIEEEMVQLLQIAMTCVSTVPDQRPAMQEVVRMIEDMNR  616



>ref|XP_008463343.1| PREDICTED: probable inactive receptor kinase At2g26730 [Cucumis 
melo]
Length=665

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G +L HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  466  RGLAHLH-VSG-KLVHGNIKSSNILLRPNHDAAVSDFGLNPLFGASTPPNRIAGYRAPEV  523

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  524  VETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  583

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIEE+ +
Sbjct  584  LMRYH-NIEEEMVQLLQIAMACVATVPDQRPSMQEVVRMIEELNR  627



>gb|KDP32336.1| hypothetical protein JCGZ_13261 [Jatropha curcas]
Length=652

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V   ++ HGNIKSSN+LL  D +  +SDFGL PL G  T P R AGYRAPEV
Sbjct  455  RGLAHLHVV--GKVVHGNIKSSNILLRPDHDASVSDFGLNPLFGTATPPSRVAGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T K+DVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  513  VETRKVTFKADVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EV+RMIE+I +
Sbjct  573  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVLRMIEDINR  616



>ref|XP_009371417.1| PREDICTED: probable inactive receptor kinase At2g26730 [Pyrus 
x bretschneideri]
Length=655

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  457  RGIAHLH-VSG-KVVHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  514

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  515  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  574

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRM+E++ +
Sbjct  575  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMMEDMNR  618



>ref|XP_008810859.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Phoenix dactylifera]
Length=644

 Score =   224 bits (570),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 135/180 (75%), Gaps = 10/180 (6%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGY  523
             G+AHIHS  G +  HGNIKSSNVLL  DLN  +SD+GL+PLM     PP +      GY
Sbjct  459  HGIAHIHSEGGPKFVHGNIKSSNVLLNHDLNPFVSDYGLSPLMN----PPANLSRVVVGY  514

Query  522  RAPEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAE  343
            RAPE IETRK TQKSDVYS GV LLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAE
Sbjct  515  RAPETIETRKITQKSDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAE  574

Query  342  VFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            VFD EL+ Y Q++E+++VQ+LQ+AM+CV + PE RP+M+EV+ MI EI+Q     RPS E
Sbjct  575  VFDVELLRY-QNIEEQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLE  633



>ref|XP_004970381.1| PREDICTED: probable inactive receptor kinase At5g58300-like [Setaria 
italica]
Length=635

 Score =   223 bits (569),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 134/166 (81%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGNIK+SNVLL+Q+ +GC+S+FGL  LM      PR  GYRAPEV
Sbjct  451  RGIAHLHAEGGGKFIHGNIKASNVLLSQNQDGCVSEFGLAQLMTTPQAAPRLVGYRAPEV  510

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+KSTQKSDVYS GV LLE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD 
Sbjct  511  LETKKSTQKSDVYSFGVLLLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDV  570

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            +L+  H ++EDEMVQ+LQ+AMACV  VP+ RPKM+EV+R I EIR 
Sbjct  571  DLLR-HPNVEDEMVQMLQIAMACVAAVPDQRPKMEEVIRRITEIRN  615



>ref|XP_004287382.1| PREDICTED: probable inactive receptor kinase At2g26730 [Fragaria 
vesca subsp. vesca]
Length=654

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H     ++ HGNIKSSN+LL  D +  ISDFGL PL G +T P R AGYRAPEV
Sbjct  456  RGLAHLHVA--GKVVHGNIKSSNILLRPDHDATISDFGLNPLFGTSTPPNRVAGYRAPEV  513

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  514  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  573

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ Y Q++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  574  LMRY-QNIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  617



>ref|XP_009362770.1| PREDICTED: probable inactive receptor kinase At5g58300 [Pyrus 
x bretschneideri]
Length=654

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  GA+ +HGNIKS+NVLLTQ+L  CISD GL+PLM F     R+ GYRAPE 
Sbjct  474  KGLAHIHS-EGAKSSHGNIKSTNVLLTQELEACISDVGLSPLMNFPPAMSRAMGYRAPEA  532

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+ RK T KSDVYS GV LLE+LTGK  +Q  + + VVDLP+WV+SVVREEWTAE FD E
Sbjct  533  IDMRKITHKSDVYSFGVLLLEMLTGKITLQYPSYDCVVDLPRWVKSVVREEWTAEAFDLE  592

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            L+   Q  E+EMVQ+LQ+A+ACV K+PE RP M+EVVRMIEE+RQ D   R S E 
Sbjct  593  LLK-QQHSEEEMVQMLQIALACVTKLPETRPNMEEVVRMIEELRQSDTKTRQSSES  647



>ref|XP_004511532.1| PREDICTED: probable inactive receptor kinase At4g23740-like isoform 
X2 [Cicer arietinum]
Length=356

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPE  511
            RG+AHIHS  G +L HGN+KSSN+ L     GC+SD GL  +M   T P  R+AGYRAPE
Sbjct  160  RGLAHIHSENGGKLIHGNVKSSNIFLNTKQYGCVSDLGLATIMSSVTQPVSRAAGYRAPE  219

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V +TRK+TQ SDVYS GV LLELLTGK+P+ +   +E++ L +WV SVVREEWTAEVFD 
Sbjct  220  VTDTRKATQASDVYSFGVVLLELLTGKSPIHTTRGDEIIHLVRWVHSVVREEWTAEVFDL  279

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            EL+    ++E+EMV++LQ+AM+CV ++ + RPKM E+V MIE +RQ D  NRPS E+
Sbjct  280  ELMRC-PNIEEEMVEMLQIAMSCVVRMHDQRPKMSEIVSMIENVRQIDIENRPSSEN  335



>ref|XP_007204237.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
 gb|EMJ05436.1| hypothetical protein PRUPE_ppa002548mg [Prunus persica]
Length=659

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  461  RGIAHLH-VSG-KVVHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  518

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  519  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  578

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  579  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  622



>gb|ACN57540.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57544.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   210 bits (534),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 9/183 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H    A+L HGNIK+SN+LL  + + CISD+GL  L   ++ P R AGY APEV
Sbjct  2    RGLAHLHV--SAKLVHGNIKASNILLXPNQDTCISDYGLNQLFSNSSPPNRLAGYHAPEV  59

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WV SVVREEWTAEVFD E
Sbjct  60   LETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVE  119

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EV+RMIE++      NR    D+  R
Sbjct  120  LMRYH-NIEEEMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDV------NRSETTDDGLR  172

Query  147  SPS  139
              S
Sbjct  173  QSS  175



>ref|XP_008242698.1| PREDICTED: probable inactive receptor kinase At2g26730 [Prunus 
mume]
Length=659

 Score =   223 bits (567),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIKSSN+LL  + +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  461  RGIAHLH-VSG-KVVHGNIKSSNILLRPEHDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  518

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  519  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  578

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  579  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  622



>ref|XP_008810858.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Phoenix dactylifera]
Length=685

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 135/179 (75%), Gaps = 10/179 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYR  520
            G+AHIHS  G +  HGNIKSSNVLL  DLN  +SD+GL+PLM     PP +      GYR
Sbjct  501  GIAHIHSEGGPKFVHGNIKSSNVLLNHDLNPFVSDYGLSPLMN----PPANLSRVVVGYR  556

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE IETRK TQKSDVYS GV LLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEV
Sbjct  557  APETIETRKITQKSDVYSFGVLLLEMLTGKAPLQGQGHDDVADLPRWVQSVVREEWTAEV  616

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            FD EL+ Y Q++E+++VQ+LQ+AM+CV + PE RP+M+EV+ MI EI+Q     RPS E
Sbjct  617  FDVELLRY-QNIEEQLVQMLQIAMSCVARTPEQRPRMEEVITMIGEIQQFGSKGRPSLE  674



>gb|EMT17815.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=634

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/166 (64%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+    +  HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV
Sbjct  453  RGLAHLHAEGSGKFIHGNLKSSNILLSQNLDGCVSEFGLAQLMTTLPAPARLIGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+K TQKSDVYS GV LLE+LTGKAP++S  +E+ V+ LP+WVQSVVREEWTAEVFD 
Sbjct  513  LETKKPTQKSDVYSFGVLLLEMLTGKAPLRSPGREDSVEHLPRWVQSVVREEWTAEVFDV  572

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            +L+  H ++EDEMVQLLQVAMACV   P+ RPKMDEV+R I EIR 
Sbjct  573  DLLR-HPNIEDEMVQLLQVAMACVAVAPDQRPKMDEVIRRIAEIRN  617



>gb|ACN57533.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57535.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57537.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57538.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57541.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57542.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57543.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57545.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57546.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57548.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 133/183 (73%), Gaps = 9/183 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H    A+L HGNIK+SN+LL  + + CISD+GL  L   ++ P R AGY APEV
Sbjct  2    RGLAHLHV--SAKLVHGNIKASNILLHPNQDTCISDYGLNQLFSNSSPPNRLAGYHAPEV  59

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WV SVVREEWTAEVFD E
Sbjct  60   LETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVE  119

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EV+RMIE++      NR    D+  R
Sbjct  120  LMRYH-NIEEEMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDV------NRSETTDDGLR  172

Query  147  SPS  139
              S
Sbjct  173  QSS  175



>dbj|BAB62593.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAB93368.1| putative receptor-like protein kinase [Oryza sativa Japonica 
Group]
 gb|EAY76289.1| hypothetical protein OsI_04221 [Oryza sativa Indica Group]
Length=637

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 139/183 (76%), Gaps = 3/183 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+  G +  HGN+KSSN+LL+Q+L+GC+S+FGL  LM     P R  GYRAPEV
Sbjct  453  RGIAHLHAEGGGKFIHGNLKSSNILLSQNLDGCVSEFGLAQLMTIPPAPARLVGYRAPEV  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFDA  331
            +ET+K TQKSDVYS GV +LE+LTGKAP++S  +E+ ++ LP+WVQSVVREEWTAEVFD 
Sbjct  513  LETKKPTQKSDVYSFGVLVLEMLTGKAPLRSPGREDSIEHLPRWVQSVVREEWTAEVFDV  572

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNR-PSXEDNK  154
            +L+  H ++EDEMVQ+LQVAMACV   P+ RPKMDEV+R I EIR     +R P  E  K
Sbjct  573  DLLR-HPNIEDEMVQMLQVAMACVAAPPDQRPKMDEVIRRIVEIRNSYSGSRTPPEEKQK  631

Query  153  XRS  145
              S
Sbjct  632  DES  634



>ref|XP_010047774.1| PREDICTED: probable inactive receptor kinase At2g26730 [Eucalyptus 
grandis]
 gb|KCW79754.1| hypothetical protein EUGRSUZ_C01100 [Eucalyptus grandis]
Length=663

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 131/165 (79%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+    ++ HGNIKSSNVLL  D N C+SDFGL PL G  T P R AGYRAPEV
Sbjct  466  RGLAHLHAA--GKVVHGNIKSSNVLLRPDHNACVSDFGLNPLFGTATPPNRVAGYRAPEV  523

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETR+ T +SDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  524  VETRRVTFQSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  583

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ Y Q++E+EMVQLLQ+AM+CV   P+ RP M EVVRM+EE+ +
Sbjct  584  LMRY-QNIEEEMVQLLQIAMSCVAVAPDQRPPMVEVVRMMEEMNR  627



>ref|XP_010249925.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo 
nucifera]
Length=649

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 132/165 (80%), Gaps = 3/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H V G ++ HGNIK+SN+LL  DL  CI+DFGL P+ G +T P R AGYRAPEV
Sbjct  452  RGLAHLH-VSG-KIVHGNIKASNILLRSDLGACIADFGLNPVFGGSTPPNRVAGYRAPEV  509

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  510  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASFGEEGIDLPRWVQSVVREEWTAEVFDVE  569

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L  Y Q++E+EMVQLLQ+AMACV  VP+ RP +  VVRM+E+I +
Sbjct  570  LTRY-QNIEEEMVQLLQIAMACVSTVPDQRPDIQVVVRMMEDINR  613



>ref|XP_002960794.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
 ref|XP_002983874.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ14886.1| hypothetical protein SELMODRAFT_119396 [Selaginella moellendorffii]
 gb|EFJ38333.1| hypothetical protein SELMODRAFT_74002 [Selaginella moellendorffii]
Length=649

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 134/183 (73%), Gaps = 8/183 (4%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+ ++H   G+   HGNIKSSN+LL ++ +  +SDFGL  L   ++   R  GYRAPEV
Sbjct  433  RGITYLHEQGGSNFVHGNIKSSNILLKKNYDAAVSDFGLAQLFNSSSAASRIVGYRAPEV  492

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             ETRKSTQ+SDVYS GV LLELLTGKAP Q++  +E +DLP+WVQSVVREEWTAEVFD E
Sbjct  493  AETRKSTQRSDVYSFGVLLLELLTGKAPTQASLNDEGIDLPRWVQSVVREEWTAEVFDLE  552

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ Y Q++E+EMVQLLQVAMACV   P+ RPKM +VVRMIE+IR  D        D+  R
Sbjct  553  LMRY-QNIEEEMVQLLQVAMACVATSPDQRPKMKDVVRMIEDIRAVD-------TDDGSR  604

Query  147  SPS  139
             PS
Sbjct  605  LPS  607



>gb|KHN25793.1| Putative inactive receptor kinase [Glycine soja]
Length=642

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 133/170 (78%), Gaps = 1/170 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A IHS  G +  HGNIKS+NVL+TQ+L+GCISD GL PLM       R+ GYRAPEV
Sbjct  457  KGIAFIHSEGGPKFAHGNIKSTNVLITQELDGCISDVGLPPLMNTPATMSRANGYRAPEV  516

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             +++K T KSDVYS GV LLE+LTGK P++    E+VVDLP+WV+SVVREEWTAEVFD E
Sbjct  517  TDSKKITHKSDVYSFGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEE  576

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXN  178
            L+   Q +E+EMVQ+LQ+A+ACV K P+ RP+MD+VVRM+EEI+ P+  N
Sbjct  577  LLR-GQYVEEEMVQMLQIALACVAKGPDQRPRMDQVVRMLEEIKHPELKN  625



>gb|EMT09037.1| Putative inactive receptor kinase [Aegilops tauschii]
Length=637

 Score =   221 bits (564),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 138/187 (74%), Gaps = 3/187 (2%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-GYRAPEV  508
            G+AHIHS  GA+LTHGNIKS+NVL+ QD N  +SD+GL+ LM       R   GYRAPE 
Sbjct  453  GIAHIHSEGGAKLTHGNIKSTNVLVGQDQNAYVSDYGLSSLMNAPVSASRVVVGYRAPET  512

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            IE RKSTQKSDVY  GV L+E+LTGKAP+QS   ++VVDLP+WV SVVREEWTAEVFD E
Sbjct  513  IENRKSTQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEVFDIE  572

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+  HQ++E+E+VQ+LQVAMAC    PE RP M+EV+RMIE +R     +R S  D + R
Sbjct  573  LMK-HQNIEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLRHSASESRAS-SDERFR  630

Query  147  SPSSXAV  127
             P+  +V
Sbjct  631  EPNPPSV  637



>ref|XP_010921193.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=634

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 133/170 (78%), Gaps = 10/170 (6%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGY  523
             G+AHIHS  G +  HGNIKSSN+LL QDLN  +SD+GL+PLM     PP +      GY
Sbjct  453  HGIAHIHSEGGPKFVHGNIKSSNILLGQDLNPLVSDYGLSPLMN----PPATLSQLMVGY  508

Query  522  RAPEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAE  343
            RAPE +ETRK TQKSDVYS GV LLE+LTGKAP+QS   ++V DLP+WVQSVVREEWTAE
Sbjct  509  RAPETMETRKITQKSDVYSFGVVLLEMLTGKAPLQSQGHDDVADLPRWVQSVVREEWTAE  568

Query  342  VFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            VFD EL+  H + E+E+V++LQ+AM+CV + PE RP+M++VVRMIEEIR+
Sbjct  569  VFDVELMMDHNN-EEELVRMLQIAMSCVARTPEQRPRMEDVVRMIEEIRK  617



>gb|ACN57520.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57521.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57522.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57523.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57524.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57525.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57526.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57527.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57528.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57529.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57530.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57531.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57532.1| At2g26730-like protein, partial [Capsella rubella]
 gb|ACN57534.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57536.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57539.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 133/183 (73%), Gaps = 9/183 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H    A+L HGNIK+SN+LL  + + C+SD+GL  L   ++ P R AGY APEV
Sbjct  2    RGLAHLHV--SAKLVHGNIKASNILLHPNQDTCVSDYGLNQLFSNSSPPNRLAGYHAPEV  59

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WV SVVREEWTAEVFD E
Sbjct  60   LETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVE  119

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EV+RMIE++      NR    D+  R
Sbjct  120  LMRYH-NIEEEMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDV------NRSETTDDGLR  172

Query  147  SPS  139
              S
Sbjct  173  QSS  175



>gb|EYU35188.1| hypothetical protein MIMGU_mgv1a002709mg [Erythranthe guttata]
Length=645

 Score =   221 bits (563),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 144/192 (75%), Gaps = 12/192 (6%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP---RSAGYRA  517
            RG+AHIHS  GA+ THGNIKSSN+LL + L+ CISDFGL  L   TT P    R AGYRA
Sbjct  455  RGLAHIHSDGGAKHTHGNIKSSNILLNESLDACISDFGLNSLSN-TTAPAVKYRVAGYRA  513

Query  516  PEVI-ETR---KSTQKSDVYSLGVXLLELLTGKAPVQSAAQEE-VVDLPKWVQSVVREEW  352
            PEVI E+R    +TQKSDVYS GV LLE+LTGK+P+Q    +E VVDLP+WV+SVVREEW
Sbjct  514  PEVIAESRVKASATQKSDVYSFGVVLLEMLTGKSPIQYLGYDEVVVDLPRWVRSVVREEW  573

Query  351  TAEVFDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRP  172
            TAEVFD EL+ Y +++E+EMVQLLQ+ ++CV K  + RP MDEVVRMIE+IR   +  R 
Sbjct  574  TAEVFDVELMQY-RNIEEEMVQLLQIGLSCVAKAADARPSMDEVVRMIEDIRADKY--RT  630

Query  171  SXEDNKXRSPSS  136
            S EDN+ +  ++
Sbjct  631  SSEDNRSKDSTA  642



>ref|XP_010925785.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
 ref|XP_010925786.1| PREDICTED: probable inactive receptor kinase At4g23740 [Elaeis 
guineensis]
Length=641

 Score =   221 bits (562),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 136/178 (76%), Gaps = 5/178 (3%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPP--RSAGYRAP  514
            RG+AHIH+    +L HGNIKSSNV L     GC+SD GLT LM   TIPP  R+AGYRAP
Sbjct  448  RGIAHIHTGNNGKLVHGNIKSSNVFLNNRQYGCVSDLGLTSLMN-PTIPPVSRTAGYRAP  506

Query  513  EVIETRKSTQKSDVYSLGVXLLELLTGKAPVQ-SAAQEEVVDLPKWVQSVVREEWTAEVF  337
            EV++ RK+TQ SDVYS GV +LELLTGK+P+Q     +EV+ L +WV SVVREEWTAEVF
Sbjct  507  EVVDLRKATQASDVYSFGVLMLELLTGKSPIQIKGGGDEVIHLVRWVHSVVREEWTAEVF  566

Query  336  DAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            D EL+ Y  ++E+EMV++LQ+AM CV ++PE RP+M EVVRMIE++R+ D  NRPS E
Sbjct  567  DLELMRY-PNIEEEMVEMLQIAMTCVARMPEQRPRMTEVVRMIEDVRRFDTGNRPSSE  623



>ref|XP_009374078.1| PREDICTED: probable inactive receptor kinase At2g26730 [Pyrus 
x bretschneideri]
Length=594

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/165 (65%), Positives = 130/165 (79%), Gaps = 4/165 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+A +H     ++ HGNIKSSN+LL  D +  +SDFGL PL G +T P R AGYRAPEV
Sbjct  397  RGIARLHV---CKVIHGNIKSSNILLRPDNDASVSDFGLNPLFGTSTPPNRVAGYRAPEV  453

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  454  VETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  513

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+ +H ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++ +
Sbjct  514  LMRFH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDMNR  557



>ref|XP_011084098.1| PREDICTED: probable inactive receptor kinase At2g26730 [Sesamum 
indicum]
Length=672

 Score =   221 bits (563),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 135/170 (79%), Gaps = 6/170 (4%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQD-LNGCISDFGLTPLMGFTTIPP--RSAGYRA  517
            RG+AH+H V G+ + HGNIKSSNVLL QD LN C+SD+GL PL   +T PP  R  GYRA
Sbjct  471  RGLAHLH-VSGS-VVHGNIKSSNVLLKQDNLNACVSDYGLNPLFLNSTTPPNHRIMGYRA  528

Query  516  PEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVF  337
            PEV+ETRK T KSDVYS GV LLELLTGKAP Q++  EE +DLP+WVQSVVREEWTAEVF
Sbjct  529  PEVLETRKVTFKSDVYSFGVLLLELLTGKAPNQASLGEEGIDLPRWVQSVVREEWTAEVF  588

Query  336  DAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPD  187
            D EL+ YH ++E+EMVQLLQ+ MACV  VP+ RP M EV+RMIE++ + D
Sbjct  589  DVELMRYH-NVEEEMVQLLQIGMACVATVPDQRPTMQEVLRMIEDMNRGD  637



>ref|XP_010938046.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X2 [Elaeis guineensis]
Length=641

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 135/179 (75%), Gaps = 10/179 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYR  520
            G+AHIHS  G +  HGNIKSSN+LL QD N  +SD+GL+PLM     PP +      GYR
Sbjct  457  GIAHIHSKGGPKFVHGNIKSSNILLNQDRNPFVSDYGLSPLMN----PPANLSRVVVGYR  512

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE +ETRK TQKSDVYS GV LLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEV
Sbjct  513  APETMETRKITQKSDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEV  572

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            FD EL+ Y Q++E+++VQ+LQ+AM+CV + PE RP M+EV+RMIEEI+Q    + P  E
Sbjct  573  FDVELMRY-QNIEEQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQQSTSKSGPFLE  630



>dbj|BAK07296.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   221 bits (562),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 136/180 (76%), Gaps = 10/180 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-----GYR  520
            G+AHIHS  GA+LTHGNIKS+NVL+ QD N  +SD+GL+ LM     PP SA     GYR
Sbjct  453  GIAHIHSEGGAKLTHGNIKSTNVLVDQDHNPYVSDYGLSSLMS----PPVSASRVVVGYR  508

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE IE RKSTQKSDVY  GV L+E+LTGKAP+QS   ++VVDLP+WV SVVREEWTAEV
Sbjct  509  APETIENRKSTQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEV  568

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            FD EL+  HQ++E+E+VQ+LQVAMAC    PE RP M+EV+RMIE +R     +R S ++
Sbjct  569  FDIELMK-HQNIEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLRHSASESRASSDE  627



>dbj|BAJ93317.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=637

 Score =   220 bits (561),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 136/180 (76%), Gaps = 10/180 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA-----GYR  520
            G+AHIHS  GA+LTHGNIKS+NVL+ QD N  +SD+GL+ LM     PP SA     GYR
Sbjct  453  GIAHIHSEGGAKLTHGNIKSTNVLVDQDHNPYVSDYGLSSLMS----PPVSASRVVVGYR  508

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE IE RKSTQKSDVY  GV L+E+LTGKAP+QS   ++VVDLP+WV SVVREEWTAEV
Sbjct  509  APETIENRKSTQKSDVYCFGVLLMEMLTGKAPLQSQGNDDVVDLPRWVHSVVREEWTAEV  568

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXED  160
            FD EL+  HQ++E+E+VQ+LQVAMAC    PE RP M+EV+RMIE +R     +R S ++
Sbjct  569  FDIELMK-HQNIEEELVQMLQVAMACTSGPPERRPAMEEVIRMIEGLRHSASESRASSDE  627



>ref|XP_010533192.1| PREDICTED: probable inactive receptor kinase At2g26730 [Tarenaya 
hassleriana]
Length=660

 Score =   221 bits (562),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AHIH    A+L HGNIK+SN+LL  +    ISDFGL  L G T  P R AGYRAPEV
Sbjct  462  RGLAHIHV--SAKLVHGNIKASNILLQPNHEARISDFGLNSLFGNTNPPNRLAGYRAPEV  519

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK+T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  520  LETRKATSKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  579

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEI  199
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EVVRMIE++
Sbjct  580  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVVRMIEDV  621



>ref|NP_001169737.1| uncharacterized LOC100383618 precursor [Zea mays]
 gb|ACN34721.1| unknown [Zea mays]
 tpg|DAA64145.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=636

 Score =   220 bits (561),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 143/188 (76%), Gaps = 9/188 (5%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSA----GYRA  517
            G+AHIHS  GA+LTHGN+KS+NVL+ QD N  +SD+GL+ L   T++P  ++    GYRA
Sbjct  452  GIAHIHSEGGAKLTHGNVKSTNVLVDQDHNPSVSDYGLSAL---TSVPVNASRVVVGYRA  508

Query  516  PEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVF  337
            PE++E RK TQKSDVYS GV L+E+LTGKAP+Q+   ++VVDLP+WV SVVREEWTAEVF
Sbjct  509  PEIVENRKITQKSDVYSFGVLLMEMLTGKAPLQTQGNDDVVDLPRWVHSVVREEWTAEVF  568

Query  336  DAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSX-ED  160
            D EL+  HQ++E+E+VQ+LQ+AM C  K P+ RP M+EV+RMIE +RQ    +R S  E 
Sbjct  569  DVELMK-HQNIEEELVQMLQIAMVCTAKSPDRRPTMEEVIRMIEGLRQSTSESRASSDEK  627

Query  159  NKXRSPSS  136
            +K  +P S
Sbjct  628  SKESNPPS  635



>ref|XP_003526789.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX1 
[Glycine max]
 ref|XP_003526790.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoformX2 
[Glycine max]
 ref|XP_006581706.1| PREDICTED: probable inactive receptor kinase At5g58300-like isoform 
X3 [Glycine max]
Length=642

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/170 (61%), Positives = 132/170 (78%), Gaps = 1/170 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+A IHS  G +  HGNIKS+NVL+ Q+L+GCISD GL PLM       R+ GYRAPEV
Sbjct  457  KGIAFIHSEGGPKFAHGNIKSTNVLINQELDGCISDVGLPPLMNTPATMSRANGYRAPEV  516

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             +++K T KSDVYS GV LLE+LTGK P++    E+VVDLP+WV+SVVREEWTAEVFD E
Sbjct  517  TDSKKITHKSDVYSFGVLLLEMLTGKTPLRYPGYEDVVDLPRWVRSVVREEWTAEVFDEE  576

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXN  178
            L+   Q +E+EMVQ+LQ+A+ACV K P+ RP+MD+VVRM+EEI+ P+  N
Sbjct  577  LLR-GQYVEEEMVQMLQIALACVAKGPDQRPRMDQVVRMLEEIKHPELKN  625



>ref|XP_010938045.1| PREDICTED: probable inactive receptor kinase At5g58300 isoform 
X1 [Elaeis guineensis]
Length=682

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 135/179 (75%), Gaps = 10/179 (6%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-----AGYR  520
            G+AHIHS  G +  HGNIKSSN+LL QD N  +SD+GL+PLM     PP +      GYR
Sbjct  498  GIAHIHSKGGPKFVHGNIKSSNILLNQDRNPFVSDYGLSPLMN----PPANLSRVVVGYR  553

Query  519  APEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEV  340
            APE +ETRK TQKSDVYS GV LLE+LTGKAP+Q    ++V DLP+WVQSVVREEWTAEV
Sbjct  554  APETMETRKITQKSDVYSFGVLLLEMLTGKAPLQCQGHDDVADLPRWVQSVVREEWTAEV  613

Query  339  FDAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXE  163
            FD EL+ Y Q++E+++VQ+LQ+AM+CV + PE RP M+EV+RMIEEI+Q    + P  E
Sbjct  614  FDVELMRY-QNIEEQLVQMLQIAMSCVARTPEQRPGMEEVIRMIEEIQQSTSKSGPFLE  671



>gb|ACN57547.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57549.1| At2g26730-like protein, partial [Capsella grandiflora]
 gb|ACN57551.1| At2g26730-like protein, partial [Capsella grandiflora]
Length=187

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 132/183 (72%), Gaps = 9/183 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H    A+L HGNIK+SN+LL  + + C SD+GL  L   ++ P R AGY APEV
Sbjct  2    RGLAHLHV--SAKLVHGNIKASNILLHPNQDTCXSDYGLNQLFSNSSPPNRLAGYHAPEV  59

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +ETRK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WV SVVREEWTAEVFD E
Sbjct  60   LETRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVLSVVREEWTAEVFDVE  119

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ YH ++E+EMVQLLQ+AM CV  VP+ RP M EV+RMIE++      NR    D+  R
Sbjct  120  LMRYH-NIEEEMVQLLQIAMTCVSTVPDQRPVMQEVLRMIEDV------NRSETTDDGLR  172

Query  147  SPS  139
              S
Sbjct  173  QSS  175



>ref|XP_003557981.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=640

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRS-AGYRAPEV  508
            G+AHIH+  G ++ HGNIKS+NVLL QD N  +SD+G++ LM       R  AGYRAPE 
Sbjct  456  GIAHIHAEGGPKIAHGNIKSTNVLLDQDHNTYVSDYGMSTLMSLPISTSRVVAGYRAPET  515

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
             E+RK T KSDVYS GV L+E+LTGKAP+QS  QE+V+DLP+WV SVVREEWTAEVFD  
Sbjct  516  YESRKFTHKSDVYSFGVLLMEMLTGKAPLQSQGQEDVIDLPRWVHSVVREEWTAEVFDVA  575

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN-KX  151
            L+ YH ++EDE+VQ+LQ+AMAC  + PE RP M EV+RM EE+RQ    +R S  +  K 
Sbjct  576  LMKYH-NIEDELVQMLQIAMACTSRFPERRPTMAEVIRMTEELRQSGSESRTSSNEYLKD  634

Query  150  RSPSS  136
             SP S
Sbjct  635  SSPPS  639



>ref|XP_010557581.1| PREDICTED: probable inactive receptor kinase At2g26730 [Tarenaya 
hassleriana]
Length=660

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 134/183 (73%), Gaps = 9/183 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H    A+L HGNIK+SNVLL  + + C++DFGL PL   T  P R AGYRAPEV
Sbjct  462  RGLAHLHV--SAKLVHGNIKASNVLLHPNHDACVTDFGLNPLFSNTNPPNRLAGYRAPEV  519

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            +E RK T KSDVYS GV LLELLTGK+P Q++  EE +DLP+WVQSVVREEWTAEVFD E
Sbjct  520  LENRKVTFKSDVYSFGVLLLELLTGKSPNQASLGEEGIDLPRWVQSVVREEWTAEVFDVE  579

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKXR  148
            L+ YH ++E+EMVQLLQ+AMACV  VP+ RP M EV+RMIE++      NR    D   R
Sbjct  580  LMRYH-NIEEEMVQLLQIAMACVSTVPDQRPAMQEVLRMIEDV------NRSETTDEGLR  632

Query  147  SPS  139
              S
Sbjct  633  QSS  635



>ref|XP_003564492.1| PREDICTED: probable inactive receptor kinase At5g58300 [Brachypodium 
distachyon]
Length=633

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            RG+AH+H+    + THGN+KSSN+LL+Q+L+GC S+FGL  LM     P R  GYRAPEV
Sbjct  452  RGIAHLHAEGSGKFTHGNLKSSNILLSQNLDGCASEFGLAQLMSNVPAPARLIGYRAPEV  511

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVV-DLPKWVQSVVREEWTAEVFDA  331
            +ET+K TQKSDVYS GV LLE+LTGKAP++S  +++ V DLP+WVQSVVREEWTAEVFD 
Sbjct  512  METKKPTQKSDVYSFGVLLLEMLTGKAPLRSPGRDDSVGDLPRWVQSVVREEWTAEVFDV  571

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            +L+  H ++EDEMVQLLQVAMACV   PE RPKM+EVV  I EIR 
Sbjct  572  DLLR-HPNIEDEMVQLLQVAMACVAIPPEQRPKMEEVVGRITEIRN  616



>gb|KEH35437.1| receptor-like kinase [Medicago truncatula]
Length=347

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 131/180 (73%), Gaps = 9/180 (5%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP---PRSAGYRA  517
            RG+AHIH+  G +L HGNIK+SN+ L     GC+SD GL  LM  ++IP    R+ GYRA
Sbjct  165  RGIAHIHTQQGGKLVHGNIKASNIFLNSQGYGCVSDIGLVTLM--SSIPSQGARATGYRA  222

Query  516  PEVIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVF  337
            PEVI+TRK+T  SDVYS GV LLELLTGK PV S   E+ V L +WV+SVVREEWTAEVF
Sbjct  223  PEVIDTRKATHSSDVYSFGVLLLELLTGKPPVYSTEGEQAVHLVRWVKSVVREEWTAEVF  282

Query  336  DAELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDN  157
            D EL+ Y  S+E+EMV++LQ+ MAC  ++P+ RPKM EVVRM+E IR     NRPS  ++
Sbjct  283  DTELLRY-SSIEEEMVEMLQIGMACAARMPDQRPKMAEVVRMMEGIRHE---NRPSSTES  338



>ref|NP_001130388.1| uncharacterized LOC100191484 precursor [Zea mays]
 gb|ACF78585.1| unknown [Zea mays]
 gb|AFW84760.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=637

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = -3

Query  684  GVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEVI  505
            G+AH+H+  G +  HGNIK+SNVLL+Q+L+GC+S+FGL  +M     PPR  GYRAPEV+
Sbjct  452  GIAHLHTEGGGKFIHGNIKASNVLLSQNLDGCVSEFGLAQIMTTPQTPPRPVGYRAPEVL  511

Query  504  ETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEE--VVDLPKWVQSVVREEWTAEVFDA  331
            E +KSTQ+SDVYS GV LLE+LTGKAP++S  +E+  V  LP+WVQSVVREEWTAEVFD 
Sbjct  512  ENKKSTQQSDVYSFGVLLLEMLTGKAPLRSPGREDPSVEHLPRWVQSVVREEWTAEVFDV  571

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            +L+  H ++EDEMVQ+LQVAMACV   PE RPKM+EV+R + E+R 
Sbjct  572  DLLR-HPNVEDEMVQMLQVAMACVAAHPEERPKMEEVIRRVTEVRN  616



>ref|XP_009362808.1| PREDICTED: LOW QUALITY PROTEIN: probable inactive receptor kinase 
At3g08680 [Pyrus x bretschneideri]
Length=530

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 129/165 (78%), Gaps = 2/165 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPEV  508
            +G+AHIHS  GA+ +H NIKS+NVLLTQ+L  CISD GL+PLM F     R+ GYRAPE 
Sbjct  357  KGLAHIHS-EGAKSSHDNIKSTNVLLTQELEACISDVGLSPLMNFPPAMSRAMGYRAPEA  415

Query  507  IETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDAE  328
            I+ RK T KSDVYS GV LLE+LTGK  +Q  + + VVDLP+WV+SVVREEWTAEVFD E
Sbjct  416  IDMRKITHKSDVYSFGVLLLEMLTGKTTLQYPSYDCVVDLPRWVKSVVREEWTAEVFDLE  475

Query  327  LINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
            L+   Q  E+EMVQ++Q+A+ACV K+PE RP MD VVRMIEE+RQ
Sbjct  476  LLK-QQHSEEEMVQMVQIALACVTKLPETRPNMDAVVRMIEELRQ  519



>ref|XP_007141331.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 ref|XP_007141332.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13325.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
 gb|ESW13326.1| hypothetical protein PHAVU_008G186900g [Phaseolus vulgaris]
Length=644

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 138/179 (77%), Gaps = 2/179 (1%)
 Frame = -3

Query  687  RGVAHIHSVP-GARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIPPRSAGYRAPE  511
            +G+A IH+    ++LTHGNIKSSNVL+TQ+ +GCI+D GLTP+M   +   ++ GYRAPE
Sbjct  461  KGIASIHTDHMDSKLTHGNIKSSNVLITQEHDGCITDVGLTPVMTTQSTMSKTNGYRAPE  520

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V E R+ TQKSDVYS GV LLE+LTGKAP+  +  E++VDLP+WV+SVVREEWTAEVFD 
Sbjct  521  VTEYRRITQKSDVYSFGVLLLEMLTGKAPMGYSGYEDMVDLPRWVRSVVREEWTAEVFDE  580

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNK  154
            EL+   Q  E+EMVQ+LQ+A+ACV KV + RP MDE VR IEEIR PD  NR +  +++
Sbjct  581  ELLR-GQYFEEEMVQMLQIALACVAKVADNRPTMDETVRNIEEIRLPDLNNRNTSSESE  638



>ref|XP_010662595.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662596.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662597.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
 ref|XP_010662598.1| PREDICTED: probable inactive receptor kinase At4g23740 [Vitis 
vinifera]
Length=628

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 136/185 (74%), Gaps = 2/185 (1%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGFTTIP-PRSAGYRAPE  511
            RG+AHIH+  G +L HGNIK+SN+ L     GC+SD GL  LM  T +P  R+AGYRAPE
Sbjct  429  RGIAHIHTENGGKLVHGNIKASNIFLNSRRYGCVSDLGLGTLMTPTPMPMTRAAGYRAPE  488

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVDLPKWVQSVVREEWTAEVFDA  331
            V +TRK++Q SDVYS GV LLELLTGK+P+ +   +EV+ L +WV SVVREEWTAEVFD 
Sbjct  489  VTDTRKASQASDVYSFGVLLLELLTGKSPIHNTGGDEVIHLVRWVNSVVREEWTAEVFDV  548

Query  330  ELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQPDFXNRPSXEDNKX  151
            EL+ Y  ++E+EMV++LQ+ M CV K+PE RPKM EVV+M+E I+Q +  NRPS E    
Sbjct  549  ELLRY-PNIEEEMVEMLQIGMNCVVKMPEQRPKMAEVVKMMESIQQVNTGNRPSSETKSE  607

Query  150  RSPSS  136
             S S+
Sbjct  608  VSSST  612



>ref|NP_001168214.1| uncharacterized protein LOC100381972 [Zea mays]
 gb|ACN27473.1| unknown [Zea mays]
Length=254

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = -3

Query  687  RGVAHIHSVPGARLTHGNIKSSNVLLTQDLNGCISDFGLTPLMGF-TTIPPRSAGYRAPE  511
            RG+AH+H+  G +  HGNIK+SNVLL+Q+L+G +S+FGL  +M    T  P+  GYRAPE
Sbjct  67   RGIAHLHAEGGGKFIHGNIKASNVLLSQNLDGRVSEFGLAQIMTTPQTSLPQLVGYRAPE  126

Query  510  VIETRKSTQKSDVYSLGVXLLELLTGKAPVQSAAQEEVVD-LPKWVQSVVREEWTAEVFD  334
            V+ET+K+ QKSDVYS GV LLE+LTGKAP++S  +++ V+ LPKWV+SVVREEWTAE+FD
Sbjct  127  VLETKKTIQKSDVYSFGVLLLEMLTGKAPLRSPGRKDSVEHLPKWVRSVVREEWTAEIFD  186

Query  333  AELINYHQSMEDEMVQLLQVAMACVGKVPEMRPKMDEVVRMIEEIRQ  193
             +L+  H ++EDEMVQ+LQ+AMACV   PE RP+MDEV+R I EIR 
Sbjct  187  VDLLR-HPNVEDEMVQMLQIAMACVAADPEQRPRMDEVIRRITEIRN  232



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1144913349700