BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF033A20

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EPS66777.1|  hypothetical protein M569_07999                         286   5e-94   Genlisea aurea
dbj|BAH57176.1|  AT5G11200                                              284   9e-94   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93957.1|  DEAD BOX RNA helicase RH15 - like protein              284   2e-93   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25391.1|  hypothetical protein AALP_AA8G108300                    282   3e-93   Arabis alpina [alpine rockcress]
ref|XP_011070543.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   8e-93   Sesamum indicum [beniseed]
ref|XP_008806610.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   8e-93   Phoenix dactylifera
ref|XP_011081571.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   9e-93   
gb|KJB54997.1|  hypothetical protein B456_009G057600                    287   9e-93   Gossypium raimondii
gb|KHG04361.1|  DEAD-box ATP-dependent RNA helicase 56                  287   1e-92   Gossypium arboreum [tree cotton]
emb|CDP13502.1|  unnamed protein product                                288   2e-92   Coffea canephora [robusta coffee]
gb|KJB27349.1|  hypothetical protein B456_004G292500                    286   2e-92   Gossypium raimondii
gb|KHG15649.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    288   3e-92   Gossypium arboreum [tree cotton]
gb|KHG04362.1|  DEAD-box ATP-dependent RNA helicase 56                  284   4e-92   Gossypium arboreum [tree cotton]
gb|KJB54998.1|  hypothetical protein B456_009G057600                    287   4e-92   Gossypium raimondii
ref|XP_010324988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   5e-92   Solanum lycopersicum
ref|XP_008797872.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   5e-92   Phoenix dactylifera
gb|KJB70604.1|  hypothetical protein B456_011G082500                    285   6e-92   Gossypium raimondii
ref|XP_010254382.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    288   8e-92   Nelumbo nucifera [Indian lotus]
ref|XP_010250100.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    288   8e-92   
ref|XP_010924921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    288   8e-92   Elaeis guineensis
gb|KDP33603.1|  hypothetical protein JCGZ_07174                         287   9e-92   Jatropha curcas
ref|XP_008806594.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   1e-91   Phoenix dactylifera
ref|XP_010555770.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   1e-91   Tarenaya hassleriana [spider flower]
ref|XP_010519945.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   1e-91   
gb|KJB82814.1|  hypothetical protein B456_013G215200                    287   1e-91   Gossypium raimondii
ref|XP_011081570.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   1e-91   Sesamum indicum [beniseed]
ref|XP_011070464.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    287   1e-91   Sesamum indicum [beniseed]
ref|XP_007011879.1|  DEAD/DEAH box RNA helicase family protein is...    287   2e-91   Theobroma cacao [chocolate]
gb|KJB65811.1|  hypothetical protein B456_010G114300                    287   2e-91   Gossypium raimondii
gb|KJB54999.1|  hypothetical protein B456_009G057600                    286   2e-91   Gossypium raimondii
ref|XP_010267037.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   2e-91   Nelumbo nucifera [Indian lotus]
ref|XP_008654597.1|  PREDICTED: uncharacterized protein LOC100273...    283   3e-91   Zea mays [maize]
ref|XP_009783372.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   3e-91   Nicotiana sylvestris
gb|KJB27350.1|  hypothetical protein B456_004G292500                    286   3e-91   Gossypium raimondii
ref|XP_010048210.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   3e-91   Eucalyptus grandis [rose gum]
ref|NP_850807.2|  DEAD-box ATP-dependent RNA helicase 15                283   3e-91   
ref|XP_009606367.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   4e-91   
ref|XP_006346267.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   4e-91   Solanum tuberosum [potatoes]
ref|XP_002285072.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    286   5e-91   Vitis vinifera
ref|XP_010912069.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   5e-91   Elaeis guineensis
ref|XP_008797870.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   6e-91   Phoenix dactylifera
ref|XP_002324856.1|  hypothetical protein POPTR_0018s01620g             285   6e-91   Populus trichocarpa [western balsam poplar]
ref|XP_002309623.1|  hypothetical protein POPTR_0006s26940g             285   7e-91   Populus trichocarpa [western balsam poplar]
ref|XP_007011878.1|  DEAD/DEAH box RNA helicase family protein is...    287   7e-91   
ref|XP_004138728.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   7e-91   
gb|KJB70602.1|  hypothetical protein B456_011G082500                    285   9e-91   Gossypium raimondii
ref|XP_006853982.1|  hypothetical protein AMTR_s00036p00225190          285   1e-90   Amborella trichopoda
ref|XP_006361727.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   1e-90   Solanum tuberosum [potatoes]
ref|XP_004245029.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    285   1e-90   Solanum lycopersicum
gb|KDP37097.1|  hypothetical protein JCGZ_06153                         285   1e-90   Jatropha curcas
ref|XP_001770294.1|  predicted protein                                  284   1e-90   
gb|KDO61716.1|  hypothetical protein CISIN_1g014314mg                   282   1e-90   Citrus sinensis [apfelsine]
ref|XP_009412247.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    281   1e-90   
gb|EYU32343.1|  hypothetical protein MIMGU_mgv1a006879mg                284   2e-90   Erythranthe guttata [common monkey flower]
ref|XP_007023163.1|  DEAD/DEAH box RNA helicase family protein is...    284   2e-90   Theobroma cacao [chocolate]
ref|XP_010519944.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    284   2e-90   Tarenaya hassleriana [spider flower]
ref|XP_006287808.1|  hypothetical protein CARUB_v10001023mg             284   2e-90   Capsella rubella
ref|XP_009595644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    284   3e-90   Nicotiana tomentosiformis
ref|XP_009758663.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   3e-90   Nicotiana sylvestris
gb|ADE76139.1|  unknown                                                 283   3e-90   Picea sitchensis
ref|XP_009624283.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   4e-90   Nicotiana tomentosiformis
gb|ABK93079.1|  unknown                                                 283   4e-90   Populus trichocarpa [western balsam poplar]
ref|XP_009392979.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   5e-90   
ref|XP_010048208.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   5e-90   Eucalyptus grandis [rose gum]
ref|XP_010696055.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   5e-90   
ref|XP_009606356.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   6e-90   Nicotiana tomentosiformis
ref|XP_002969825.1|  hypothetical protein SELMODRAFT_146823             283   6e-90   Selaginella moellendorffii
ref|XP_010048977.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   6e-90   Eucalyptus grandis [rose gum]
ref|XP_009771911.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   7e-90   Nicotiana sylvestris
gb|AFW81342.1|  spliceosome RNA helicase BAT1 isoform 1                 283   7e-90   
ref|XP_004960988.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   7e-90   
ref|XP_006346265.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    283   8e-90   Solanum tuberosum [potatoes]
gb|KDO61715.1|  hypothetical protein CISIN_1g014314mg                   282   8e-90   Citrus sinensis [apfelsine]
ref|XP_002268833.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   9e-90   Vitis vinifera
ref|NP_568245.1|  DEAD-box ATP-dependent RNA helicase 56                282   1e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871462.1|  hypothetical protein ARALYDRAFT_487950             282   1e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_010419674.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_007011880.1|  DEAD/DEAH box RNA helicase family protein is...    282   1e-89   
ref|XP_006483351.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   1e-89   Citrus sinensis [apfelsine]
ref|XP_010491834.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006450448.1|  hypothetical protein CICLE_v10008383mg             282   1e-89   Citrus clementina [clementine]
gb|KJB70605.1|  hypothetical protein B456_011G082500                    280   1e-89   Gossypium raimondii
ref|XP_004968948.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   1e-89   
ref|XP_004171175.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    282   2e-89   
ref|XP_010453161.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    281   2e-89   Camelina sativa [gold-of-pleasure]
gb|EYU24648.1|  hypothetical protein MIMGU_mgv1a006871mg                281   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_002517619.1|  dead box ATP-dependent RNA helicase, putative      281   2e-89   Ricinus communis
ref|XP_009412246.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    281   2e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002873498.1|  hypothetical protein ARALYDRAFT_909079             281   2e-89   Arabidopsis lyrata subsp. lyrata
ref|XP_010231905.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   3e-89   Brachypodium distachyon [annual false brome]
ref|XP_004241774.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    281   4e-89   Solanum lycopersicum
ref|NP_001154706.1|  DEAD-box ATP-dependent RNA helicase 56             283   4e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006353691.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    281   4e-89   Solanum tuberosum [potatoes]
ref|XP_010231902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    278   5e-89   Brachypodium distachyon [annual false brome]
ref|NP_001141599.1|  uncharacterized protein LOC100273717               280   5e-89   
ref|XP_010231903.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    278   5e-89   Brachypodium distachyon [annual false brome]
ref|NP_001154707.1|  DEAD-box ATP-dependent RNA helicase 56             281   6e-89   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392978.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   8e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG21287.1|  DEAD-box ATP-dependent RNA helicase 56 -like protein    281   8e-89   Gossypium arboreum [tree cotton]
ref|XP_010419673.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   1e-88   Camelina sativa [gold-of-pleasure]
gb|KCW81407.1|  hypothetical protein EUGRSUZ_C02784                     283   1e-88   Eucalyptus grandis [rose gum]
ref|XP_010696045.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    280   1e-88   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU23716.1|  unknown                                                 273   1e-88   Glycine max [soybeans]
ref|XP_009121984.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   1e-88   
gb|EEC70860.1|  hypothetical protein OsI_02372                          276   2e-88   Oryza sativa Indica Group [Indian rice]
ref|XP_006409182.1|  hypothetical protein EUTSA_v10022698mg             279   2e-88   Eutrema salsugineum [saltwater cress]
ref|XP_003569186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    279   2e-88   Brachypodium distachyon [annual false brome]
ref|XP_004960989.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   2e-88   
ref|XP_010453157.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    278   3e-88   Camelina sativa [gold-of-pleasure]
dbj|BAJ53224.1|  JHL06P13.3                                             279   4e-88   Jatropha curcas
ref|XP_003569187.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   7e-88   Brachypodium distachyon [annual false brome]
ref|XP_010231899.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   8e-88   Brachypodium distachyon [annual false brome]
ref|XP_009121980.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-87   Brassica rapa
ref|XP_010419672.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-87   Camelina sativa [gold-of-pleasure]
ref|XP_006644281.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-87   Oryza brachyantha
ref|XP_006644282.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   2e-87   Oryza brachyantha
ref|XP_003588758.1|  DEAD-box ATP-dependent RNA helicase                273   2e-87   
ref|NP_001170610.1|  uncharacterized protein LOC100384654               276   3e-87   Zea mays [maize]
ref|XP_009121982.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   3e-87   Brassica rapa
ref|XP_009121981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   3e-87   Brassica rapa
ref|NP_001043298.1|  Os01g0550000                                       276   3e-87   
ref|XP_006399618.1|  hypothetical protein EUTSA_v10013628mg             276   3e-87   Eutrema salsugineum [saltwater cress]
gb|KCW80390.1|  hypothetical protein EUGRSUZ_C01749                     276   3e-87   Eucalyptus grandis [rose gum]
gb|AFW82994.1|  hypothetical protein ZEAMMB73_566534                    276   3e-87   
ref|XP_008378410.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   4e-87   
ref|XP_006583127.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   4e-87   
ref|XP_009121985.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   4e-87   Brassica rapa
sp|Q0JM17.2|RH56_ORYSJ  RecName: Full=DEAD-box ATP-dependent RNA ...    276   4e-87   Oryza sativa Japonica Group [Japonica rice]
emb|CAB96655.1|  DEAD BOX RNA helicase RH15                             275   4e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222437.1|  hypothetical protein PRUPE_ppa006122mg             275   4e-87   Prunus persica
emb|CDX70383.1|  BnaC03g04670D                                          276   5e-87   
ref|XP_004960987.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    276   6e-87   
gb|EEE54779.1|  hypothetical protein OsJ_02176                          275   6e-87   Oryza sativa Japonica Group [Japonica rice]
emb|CAB96652.1|  DEAD BOX RNA helicase RH15-like protein                275   7e-87   Arabidopsis thaliana [mouse-ear cress]
emb|CBI21031.3|  unnamed protein product                                278   7e-87   Vitis vinifera
ref|XP_009131197.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    276   8e-87   Brassica rapa
ref|XP_006578149.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   8e-87   
ref|XP_009125794.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    275   9e-87   Brassica rapa
ref|XP_002985161.1|  hypothetical protein SELMODRAFT_446187             276   9e-87   
ref|XP_007135742.1|  hypothetical protein PHAVU_010G154700g             275   1e-86   Phaseolus vulgaris [French bean]
ref|XP_001781775.1|  predicted protein                                  275   1e-86   
ref|NP_001043297.1|  Os01g0549700                                       276   2e-86   
emb|CAA09205.1|  RNA helicase                                           275   2e-86   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008394071.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   2e-86   Malus domestica [apple tree]
ref|XP_011459186.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    274   2e-86   Fragaria vesca subsp. vesca
emb|CDX78412.1|  BnaA03g03240D                                          275   3e-86   
emb|CDX69778.1|  BnaA10g21270D                                          275   4e-86   
gb|EMT19211.1|  DEAD-box ATP-dependent RNA helicase 56                  276   4e-86   
gb|AFV30230.1|  ATP-dependent RNA helicase                              273   5e-86   Medicago sativa [alfalfa]
emb|CDX69777.1|  BnaA10g21260D                                          275   5e-86   
gb|AFK41905.1|  unknown                                                 273   5e-86   Medicago truncatula
ref|XP_003588757.1|  DEAD-box ATP-dependent RNA helicase                273   5e-86   Medicago truncatula
ref|XP_003528338.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   6e-86   Glycine max [soybeans]
ref|XP_003531708.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   6e-86   Glycine max [soybeans]
ref|XP_009376926.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    272   7e-86   Pyrus x bretschneideri [bai li]
ref|XP_011459188.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    273   9e-86   Fragaria vesca subsp. vesca
ref|XP_007137031.1|  hypothetical protein PHAVU_009G093800g             272   1e-85   Phaseolus vulgaris [French bean]
gb|KEH28678.1|  DEAD-box ATP-dependent RNA helicase-like protein        274   1e-85   Medicago truncatula
ref|XP_003522620.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-85   Glycine max [soybeans]
ref|XP_003526412.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   1e-85   Glycine max [soybeans]
gb|AGV54745.1|  DEAD-box ATP-dependent RNA helicase 56-like protein     271   1e-85   Phaseolus vulgaris [French bean]
gb|AGV54235.1|  DEAD-box ATP-dependent RNA helicase 56                  271   1e-85   Phaseolus vulgaris [French bean]
emb|CDY71952.1|  BnaAnng39360D                                          271   2e-85   Brassica napus [oilseed rape]
ref|XP_004498731.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    271   2e-85   Cicer arietinum [garbanzo]
gb|KHN01339.1|  DEAD-box ATP-dependent RNA helicase 56                  272   3e-85   Glycine soja [wild soybean]
ref|XP_004506913.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   4e-85   
gb|EMS64048.1|  DEAD-box ATP-dependent RNA helicase 56                  270   8e-85   Triticum urartu
ref|XP_003603412.1|  DEAD-box ATP-dependent RNA helicase                269   1e-84   Medicago truncatula
emb|CDY51112.1|  BnaCnng20150D                                          269   1e-84   Brassica napus [oilseed rape]
emb|CDX85726.1|  BnaA02g00870D                                          271   1e-84   
emb|CDX85725.1|  BnaA02g00880D                                          269   2e-84   
gb|EMS68248.1|  DEAD-box ATP-dependent RNA helicase 56                  275   2e-84   Triticum urartu
ref|XP_009334643.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    266   2e-84   Pyrus x bretschneideri [bai li]
ref|XP_009125790.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   3e-84   Brassica rapa
ref|XP_004506912.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    268   4e-84   
ref|XP_010101269.1|  DEAD-box ATP-dependent RNA helicase 56             270   8e-84   
ref|XP_006585632.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   1e-83   
ref|XP_004968947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    267   2e-83   
ref|XP_008362058.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   2e-83   
ref|XP_007161216.1|  hypothetical protein PHAVU_001G051700g             266   2e-83   Phaseolus vulgaris [French bean]
gb|KHN47769.1|  DEAD-box ATP-dependent RNA helicase 56                  266   2e-83   Glycine soja [wild soybean]
ref|XP_004501320.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   3e-83   
ref|XP_008243728.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   4e-83   Prunus mume [ume]
ref|XP_009334641.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   4e-83   Pyrus x bretschneideri [bai li]
ref|XP_004303319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   4e-83   Fragaria vesca subsp. vesca
ref|XP_007215422.1|  hypothetical protein PRUPE_ppa006077mg             265   4e-83   Prunus persica
ref|XP_004498732.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    265   4e-83   
ref|XP_003604414.1|  DEAD-box ATP-dependent RNA helicase                256   5e-83   
ref|XP_009365409.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   1e-82   Pyrus x bretschneideri [bai li]
ref|XP_008362046.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    263   2e-82   Malus domestica [apple tree]
ref|XP_004498730.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    264   7e-82   
ref|XP_004501319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    261   2e-81   Cicer arietinum [garbanzo]
ref|XP_010097240.1|  DEAD-box ATP-dependent RNA helicase 56             260   5e-80   
ref|XP_004501321.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    254   1e-79   
ref|XP_004501318.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    254   2e-78   
emb|CDY51111.1|  BnaCnng20140D                                          247   3e-78   Brassica napus [oilseed rape]
ref|XP_003063800.1|  predicted protein                                  252   4e-78   Micromonas pusilla CCMP1545
gb|EMT33323.1|  DEAD-box ATP-dependent RNA helicase 56                  247   4e-75   
ref|XP_010519138.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    244   4e-75   
ref|XP_005643776.1|  nuclear RNA helicase-like protein Bat1             243   2e-74   Coccomyxa subellipsoidea C-169
ref|XP_002505759.1|  predicted protein                                  242   4e-74   Micromonas commoda
gb|KGG51664.1|  ATP-dependent RNA helicase Uap56                        237   4e-72   Mitosporidium daphniae
ref|XP_006450446.1|  hypothetical protein CICLE_v10008383mg             236   6e-72   
ref|XP_001422523.1|  predicted protein                                  234   9e-72   Ostreococcus lucimarinus CCE9901
emb|CCJ29387.1|  unnamed protein product                                223   3e-69   Pneumocystis jirovecii
gb|EPY52787.1|  ATP-dependent RNA helicase Uap56                        228   2e-68   Schizosaccharomyces cryophilus OY26
dbj|BAA13931.1|  unnamed protein product                                224   2e-68   Schizosaccharomyces pombe
ref|XP_007509762.1|  ATP-dependent RNA helicase DDX39                   227   3e-68   Bathycoccus prasinos
gb|EPX72634.1|  ATP-dependent RNA helicase Uap56                        226   8e-68   Schizosaccharomyces octosporus yFS286
ref|XP_002949774.1|  hypothetical protein VOLCADRAFT_80795              226   9e-68   Volvox carteri f. nagariensis
emb|CDJ45114.1|  hypothetical protein ETH_00023440                      218   9e-68   Eimeria tenella
gb|ACF86701.1|  unknown                                                 215   1e-67   Zea mays [maize]
ref|XP_006675142.1|  hypothetical protein BATDEDRAFT_15696              226   1e-67   Batrachochytrium dendrobatidis JAM81
emb|CEG02049.1|  Helicase, C-terminal                                   226   2e-67   Ostreococcus tauri
ref|NP_594261.1|  ATP-dependent RNA helicase Uap56                      225   2e-67   Schizosaccharomyces pombe
gb|EIE79315.1|  ATP-dependent RNA helicase uap56                        224   3e-67   Rhizopus delemar RA 99-880
gb|EPB87931.1|  ATP-dependent RNA helicase uap56                        224   3e-67   Mucor circinelloides f. circinelloides 1006PhL
emb|CDO70925.1|  hypothetical protein BN946_scf184829.g33               217   3e-67   Trametes cinnabarina
emb|CEP12723.1|  hypothetical protein                                   224   3e-67   Parasitella parasitica
ref|XP_001703776.1|  subunit of exon junction complex                   224   3e-67   Chlamydomonas reinhardtii
emb|CEL52175.1|  ATP-dependent RNA helicase UAP56/SUB2                  224   5e-67   Rhizoctonia solani AG-1 IB
dbj|GAN02806.1|  ATP-dependent RNA helicase Uap56                       223   7e-67   Mucor ambiguus
gb|EUC67291.1|  ATP-dependent RNA helicase uap56/SUB2                   224   7e-67   Rhizoctonia solani AG-3 Rhs1AP
gb|KJA29314.1|  hypothetical protein HYPSUDRAFT_32712                   216   8e-67   Hypholoma sublateritium FD-334 SS-4
gb|EXX60912.1|  Sub2p                                                   223   8e-67   Rhizophagus irregularis DAOM 197198w
gb|EIE91029.1|  ATP-dependent RNA helicase uap56                        223   1e-66   Rhizopus delemar RA 99-880
gb|EIE84435.1|  ATP-dependent RNA helicase uap56                        223   1e-66   Rhizopus delemar RA 99-880
ref|XP_005710441.1|  Putative ATP-dependent RNA helicase, Uap56         223   2e-66   Chondrus crispus [carageen]
dbj|GAC71428.1|  ATP-dependent RNA helicase                             214   2e-66   Moesziomyces antarcticus T-34
emb|CEI88988.1|  Putative ATP-dependent RNA helicase                    222   2e-66   Rhizopus microsporus
ref|XP_007336576.1|  P-loop containing nucleoside triphosphate hy...    222   2e-66   
ref|XP_002141999.1|  ATP-dependent RNA helicae DDX39                    221   3e-66   Cryptosporidium muris RN66
ref|XP_002175680.1|  ATP-dependent RNA helicase Uap56                   222   3e-66   Schizosaccharomyces japonicus yFS275
emb|CDS12473.1|  Putative ATP-dependent RNA helicase uap56              222   3e-66   Lichtheimia ramosa
emb|CEG73345.1|  Putative ATP-dependent RNA helicase SUB2               219   4e-66   Rhizopus microsporus
ref|XP_668053.1|  helicase                                              221   4e-66   Cryptosporidium hominis TU502
ref|XP_627282.1|  Sub2p like superfamily II helicase involved in ...    221   5e-66   Cryptosporidium parvum Iowa II
ref|XP_007872375.1|  hypothetical protein PNEG_00489                    221   5e-66   Pneumocystis murina B123
emb|CEI95093.1|  Putative ATP dependent RNA helicase                    221   8e-66   Rhizopus microsporus
emb|CDH58367.1|  atp-dependent rna helicase uap56                       221   8e-66   Lichtheimia corymbifera JMRC:FSU:9682
gb|KDD77120.1|  DEAD/DEAH box helicase                                  220   9e-66   Helicosporidium sp. ATCC 50920
gb|KFH69832.1|  ATP-dependent RNA helicase SUB2                         221   9e-66   Mortierella verticillata NRRL 6337
emb|CDS11016.1|  Putative ATP-dependent RNA helicase uap56              221   1e-65   Lichtheimia ramosa
emb|CDH51210.1|  atp-dependent rna helicase uap56                       220   1e-65   Lichtheimia corymbifera JMRC:FSU:9682
gb|EPZ34119.1|  Glycine cleavage system P protein, homodimeric do...    230   2e-65   Rozella allomycis CSF55
emb|CEI95092.1|  Putative ATP-dependent RNA helicase SUB2               221   2e-65   Rhizopus microsporus
ref|XP_004364885.1|  nuclear RNA helicase                               219   3e-65   Capsaspora owczarzaki ATCC 30864
emb|CEG73344.1|  Putative ATP dependent RNA helicase                    219   3e-65   Rhizopus microsporus
gb|ESA07313.1|  hypothetical protein GLOINDRAFT_349525                  219   4e-65   
emb|CDY56825.1|  BnaC05g37790D                                          213   4e-65   Brassica napus [oilseed rape]
ref|XP_002185552.1|  predicted protein                                  218   5e-65   Phaeodactylum tricornutum CCAP 1055/1
dbj|BAC40637.1|  unnamed protein product                                211   6e-65   Mus musculus [mouse]
ref|XP_002370994.1|  ATP-dependent RNA helicase, putative               218   6e-65   Toxoplasma gondii ME49
ref|XP_003885548.1|  hypothetical protein NCLIV_059450                  218   7e-65   Neospora caninum Liverpool
ref|XP_008886424.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide DDX39       218   7e-65   
ref|XP_002535684.1|  dead box ATP-dependent RNA helicase, putative      207   1e-64   
emb|CEG73343.1|  Putative ATP-dependent RNA helicase SUB2               219   1e-64   Rhizopus microsporus
ref|XP_005470058.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    211   1e-64   
gb|KIK70395.1|  hypothetical protein GYMLUDRAFT_183976                  217   2e-64   Gymnopus luxurians FD-317 M1
emb|CCM01304.1|  predicted protein                                      217   2e-64   Fibroporia radiculosa
gb|EJU00944.1|  ATP-dependent RNA helicase SUB2                         217   2e-64   Dacryopinax primogenitus
ref|XP_011246796.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   3e-64   
ref|XP_007390175.1|  hypothetical protein PHACADRAFT_246819             217   3e-64   Phanerochaete carnosa HHB-10118-sp
ref|XP_009691516.1|  DEAD-box family helicase                           217   3e-64   Theileria orientalis strain Shintoku
gb|EJK56348.1|  hypothetical protein THAOC_23784                        216   3e-64   Thalassiosira oceanica
ref|XP_006722669.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   3e-64   Homo sapiens [man]
gb|KIO07369.1|  hypothetical protein M404DRAFT_409348                   216   3e-64   Pisolithus tinctorius Marx 270
ref|XP_007265855.1|  ATP-dependent RNA helicase SUB2                    216   4e-64   Fomitiporia mediterranea MF3/22
ref|XP_007368822.1|  P-loop containing nucleoside triphosphate hy...    216   4e-64   Dichomitus squalens LYAD-421 SS1
emb|CDI78494.1|  ATP-dependent RNA helicase, putative                   217   5e-64   Eimeria acervulina
emb|CCO26277.1|  ATP-dependent RNA helicase UAP56/SUB2                  222   6e-64   Rhizoctonia solani AG-1 IB
gb|KIY67510.1|  P-loop containing nucleoside triphosphate hydrola...    216   6e-64   Cylindrobasidium torrendii FP15055 ss-10
gb|KIJ45095.1|  hypothetical protein M422DRAFT_59910                    216   6e-64   Sphaerobolus stellatus SS14
ref|XP_008033242.1|  P-loop containing nucleoside triphosphate hy...    216   8e-64   Trametes versicolor FP-101664 SS1
ref|XP_010785186.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    207   8e-64   Notothenia coriiceps [yellowbelly rockcod]
emb|CDJ59021.1|  ATP-dependent RNA helicase, putative                   217   9e-64   Eimeria maxima
gb|EST09229.1|  putative ATP-dependent RNA helicase                     214   9e-64   Kalmanozyma brasiliensis GHG001
gb|KIK47876.1|  hypothetical protein CY34DRAFT_146598                   215   1e-63   Suillus luteus UH-Slu-Lm8-n1
gb|EMD41523.1|  hypothetical protein CERSUDRAFT_110074                  215   1e-63   Gelatoporia subvermispora B
ref|XP_009230540.1|  hypothetical protein GGTG_14349                    209   1e-63   
ref|XP_002296387.1|  dead box family RNA helicase                       215   1e-63   
dbj|GAC95940.1|  hypothetical protein PHSY_003518                       213   1e-63   
gb|KIO30627.1|  hypothetical protein M407DRAFT_20347                    215   1e-63   
gb|KIJ68768.1|  hypothetical protein HYDPIDRAFT_147338                  215   1e-63   
gb|KIM47933.1|  hypothetical protein M413DRAFT_439630                   215   2e-63   
ref|NP_001149406.1|  spliceosome RNA helicase BAT1                      214   2e-63   
emb|CDJ49958.1|  ATP-dependent RNA helicase, putative                   217   2e-63   
gb|KIP05668.1|  hypothetical protein PHLGIDRAFT_36329                   217   2e-63   
ref|XP_001873918.1|  predicted protein                                  214   2e-63   
ref|XP_007762751.1|  P-loop containing nucleoside triphosphate hy...    215   2e-63   
gb|KII94403.1|  hypothetical protein PLICRDRAFT_133106                  214   2e-63   
ref|XP_007307600.1|  P-loop containing nucleoside triphosphate hy...    214   2e-63   
gb|KIJ21446.1|  hypothetical protein PAXINDRAFT_164948                  214   3e-63   
ref|XP_006956118.1|  P-loop containing nucleoside triphosphate hy...    214   3e-63   
emb|CCG84331.1|  protein of unknown function                            214   3e-63   
gb|EDL83555.1|  HLA-B-associated transcript 1A, isoform CRA_b           206   3e-63   
ref|XP_955059.1|  DEAD-box family helicase                              214   3e-63   
pdb|1T5I|A  Chain A, Crystal Structure Of The C-Terminal Domain O...    206   3e-63   
emb|CAH10601.1|  hypothetical protein                                   206   4e-63   
gb|KIK99894.1|  hypothetical protein PAXRUDRAFT_30211                   214   4e-63   
gb|KIM21098.1|  hypothetical protein M408DRAFT_29817                    213   4e-63   
ref|XP_763393.1|  ATP-dependent RNA helicase                            214   5e-63   
gb|KIY45224.1|  P-loop containing nucleoside triphosphate hydrola...    214   5e-63   
ref|XP_008102811.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    211   5e-63   
ref|XP_009033759.1|  hypothetical protein AURANDRAFT_52520              214   5e-63   
emb|CDI55477.1|  probable SUB2-mRNA export protein, member of the...    213   5e-63   
dbj|GAK68412.1|  p-loop containing nucleoside triphosphate hydrol...    214   6e-63   
gb|ELU44467.1|  ATP-dependent RNA helicase SUB2                         224   6e-63   
gb|AFK43621.1|  unknown                                                 202   7e-63   
ref|NP_956015.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 39Aa           210   8e-63   
gb|ADD24298.1|  Spliceosome RNA helicase BAT1                           213   8e-63   
ref|XP_007304346.1|  P-loop containing nucleoside triphosphate hy...    205   8e-63   
ref|XP_005107606.1|  PREDICTED: spliceosome RNA helicase Ddx39b-like    209   1e-62   
emb|CDJ35688.1|  ATP-dependent RNA helicase, putative                   219   1e-62   
gb|KDQ20461.1|  hypothetical protein BOTBODRAFT_26472                   213   1e-62   
gb|KDR85276.1|  hypothetical protein GALMADRAFT_260980                  213   1e-62   
ref|XP_002788127.1|  helicase, putative                                 214   1e-62   
ref|XP_740824.1|  helicase                                              209   1e-62   
emb|CBQ69357.1|  probable ATP-dependent RNA helicase                    212   1e-62   
ref|XP_007314666.1|  hypothetical protein SERLADRAFT_458898             212   1e-62   
gb|EFN77596.1|  ATP-dependent RNA helicase WM6                          207   1e-62   
gb|KDQ54898.1|  hypothetical protein JAAARDRAFT_160192                  212   1e-62   
ref|XP_003038997.1|  hypothetical protein SCHCODRAFT_65145              212   1e-62   
gb|EPY89758.1|  ATP-dependent RNA helicase DDX39A                       210   2e-62   
ref|XP_008613771.1|  DEAD-box ATP-dependent RNA helicase 15             212   2e-62   
gb|KIK16265.1|  hypothetical protein PISMIDRAFT_270557                  212   2e-62   
gb|KIK47166.1|  hypothetical protein CY34DRAFT_799702                   212   2e-62   
ref|XP_006900875.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       206   2e-62   
emb|CCF50093.1|  probable ATP-dependent RNA helicase                    212   2e-62   
ref|XP_002619114.1|  conserved hypothetical protein                     207   2e-62   
gb|ACO10850.1|  ATP-dependent RNA helicase DDX39                        211   2e-62   
ref|XP_001828976.1|  ATP-dependent RNA helicase SUB2                    212   2e-62   
ref|XP_002769569.1|  helicase, putative                                 212   2e-62   
ref|XP_009541563.1|  hypothetical protein HETIRDRAFT_438078             212   2e-62   
gb|KIZ07356.1|  hypothetical protein MNEG_0605                          214   2e-62   
gb|AFK39888.1|  unknown                                                 201   3e-62   
ref|XP_007861373.1|  P-loop containing nucleoside triphosphate hy...    211   3e-62   
ref|XP_001729648.1|  hypothetical protein MGL_3192                      211   3e-62   
gb|KIL70560.1|  hypothetical protein M378DRAFT_194873                   212   3e-62   
emb|CCI50269.1|  unnamed protein product                                209   3e-62   
gb|EYC23926.1|  hypothetical protein Y032_0014g2221                     204   3e-62   
ref|XP_004832332.1|  DEAD box ATP-dependent RNA helicase family m...    212   3e-62   
ref|XP_005995920.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   3e-62   
ref|XP_003660119.1|  hypothetical protein MYCTH_2298018                 211   4e-62   
ref|XP_001609440.1|  eIF-4A-like DEAD family RNA helicase               212   4e-62   
ref|XP_007851730.1|  atp-dependent rna helicase sub2                    211   4e-62   
dbj|BAN65741.1|  eIF-4A-like DEAD family RNA helicase, putative         211   5e-62   
ref|XP_011391382.1|  putative ATP-dependent RNA helicase SUB2           211   5e-62   
ref|XP_010768566.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       207   5e-62   
ref|XP_003217350.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    211   5e-62   
gb|ETW27977.1|  hypothetical protein PFFCH_04535                        209   5e-62   
ref|XP_006085397.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    211   5e-62   
ref|NP_998142.1|  ATP-dependent RNA helicase DDX39                      211   5e-62   
ref|XP_003326361.1|  ATP-dependent RNA helicase uap56                   211   6e-62   
gb|AFR92871.1|  ATP-dependent RNA helicase SUB2                         211   6e-62   
emb|CCV00098.1|  unnamed protein product                                211   6e-62   
gb|KDQ30396.1|  hypothetical protein PLEOSDRAFT_1053605                 211   7e-62   
ref|XP_567038.1|  ATP dependent RNA helicase                            210   7e-62   
ref|XP_002424581.1|  ATP-dependent RNA helicase WM6, putative           207   8e-62   
emb|CCA73713.1|  probable SUB2-mRNA export protein, member of the...    211   8e-62   
ref|XP_007378277.1|  ATP-dependent RNA helicase SUB2                    210   9e-62   
ref|XP_008508630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   9e-62   
ref|XP_008508631.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   9e-62   
ref|XP_005160298.1|  PREDICTED: DEAD (Asp-Glu-Ala-Asp) box polype...    210   9e-62   
ref|XP_004539320.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   9e-62   
ref|XP_567037.1|  ATP dependent RNA helicase                            210   1e-61   
ref|XP_004635679.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
gb|KIR45278.1|  ATP-dependent RNA helicase SUB2                         210   1e-61   
ref|XP_009827129.1|  DEAD-box ATP-dependent RNA helicase 15             209   1e-61   
ref|XP_004748290.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
gb|EPS99597.1|  hypothetical protein FOMPIDRAFT_160980                  210   1e-61   
ref|XP_004688293.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
ref|XP_002921018.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
ref|XP_005632846.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
ref|XP_010611745.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
ref|XP_008903595.1|  ATP-dependent RNA helicase uap56, variant          207   1e-61   
ref|XP_005661286.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
ref|XP_006918833.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
ref|XP_006454572.1|  hypothetical protein AGABI2DRAFT_189825            210   1e-61   
emb|CDQ03227.1|  Protein BM-HEL-1, isoform b                            202   1e-61   
ref|XP_007436162.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
gb|KGB75353.1|  ATP-dependent RNA helicase SUB2                         210   1e-61   
ref|XP_007129491.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
ref|XP_006100393.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   1e-61   
ref|XP_004389822.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   1e-61   
ref|XP_005661287.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   1e-61   
ref|XP_533895.2|  PREDICTED: ATP-dependent RNA helicase DDX39A is...    209   1e-61   
ref|XP_004673033.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_004616874.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
gb|AAC63046.1|  DEAD-box protein                                        206   1e-61   
ref|XP_008508629.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   1e-61   
ref|XP_007182118.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   1e-61   
ref|XP_004277466.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
gb|KIK04346.1|  hypothetical protein K443DRAFT_93606                    210   1e-61   
ref|XP_008054817.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_007907581.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_004999904.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   1e-61   
ref|XP_006161075.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
gb|EFB28644.1|  hypothetical protein PANDA_009904                       209   1e-61   
gb|KIR30768.1|  ATP-dependent RNA helicase SUB2                         210   1e-61   
gb|AAB94615.1|  BAT1                                                    205   1e-61   
ref|XP_006173093.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_008564250.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_008314982.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   1e-61   
ref|XP_003760703.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_003413378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_005381156.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
ref|XP_713375.1|  hypothetical protein CaO19.13092                      205   2e-61   
ref|XP_011414939.1|  PREDICTED: spliceosome RNA helicase DDX39B         209   2e-61   
emb|CDR96034.1|  eIF-4A-like DEAD family RNA helicase, putative         212   2e-61   
ref|XP_003275725.2|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_010871251.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_007229864.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
ref|XP_007004343.1|  hypothetical protein TREMEDRAFT_73647              209   2e-61   
ref|XP_008868859.1|  DEAD-box ATP-dependent RNA helicase 56             209   2e-61   
emb|CCI50270.1|  unnamed protein product                                208   2e-61   
emb|CDQ82873.1|  unnamed protein product                                209   2e-61   
ref|XP_001366378.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
ref|XP_010899336.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
gb|KIM52346.1|  hypothetical protein SCLCIDRAFT_1223828                 209   2e-61   
gb|ACO09679.1|  ATP-dependent RNA helicase DDX39                        209   2e-61   
ref|XP_007878578.1|  hypothetical protein PFL1_02874                    210   2e-61   
ref|XP_006631613.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
ref|XP_003461865.2|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   2e-61   
gb|EHB14439.1|  ATP-dependent RNA helicase DDX39                        209   2e-61   
ref|XP_007532506.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_010611744.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   2e-61   
gb|ACM09195.1|  ATP-dependent RNA helicase DDX39                        209   2e-61   
ref|XP_008985661.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    209   2e-61   
dbj|BAE43010.1|  unnamed protein product                                209   2e-61   
dbj|BAE37719.1|  unnamed protein product                                209   2e-61   
gb|ACN58701.1|  ATP-dependent RNA helicase DDX39                        209   2e-61   
ref|XP_006100392.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
emb|CDQ66513.1|  unnamed protein product                                209   2e-61   
ref|XP_004442630.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|XP_010611743.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    210   2e-61   
emb|CDQ90161.1|  unnamed protein product                                209   2e-61   
ref|NP_932099.2|  ATP-dependent RNA helicase DDX39A                     209   2e-61   
dbj|BAE39902.1|  unnamed protein product                                209   2e-61   
ref|NP_005795.2|  ATP-dependent RNA helicase DDX39A                     209   2e-61   
ref|XP_004008522.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
ref|NP_001134851.1|  ATP-dependent RNA helicase DDX39                   209   2e-61   
ref|XP_006993135.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   2e-61   
ref|NP_001029924.1|  ATP-dependent RNA helicase DDX39A                  209   2e-61   
dbj|BAE31182.1|  unnamed protein product                                209   2e-61   
ref|NP_001133080.1|  ATP-dependent RNA helicase DDX39                   209   2e-61   
ref|XP_006104711.1|  PREDICTED: spliceosome RNA helicase Ddx39b         206   2e-61   
ref|XP_008289807.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   2e-61   
gb|AAC16391.1|  nuclear RNA helicase                                    209   2e-61   
ref|XP_008853627.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   3e-61   
ref|XP_006779616.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD (Asp-Gl...    209   3e-61   
ref|NP_446015.2|  ATP-dependent RNA helicase DDX39A                     209   3e-61   
gb|ETE73559.1|  ATP-dependent RNA helicase DDX39A                       209   3e-61   
ref|XP_008709919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       210   3e-61   
ref|XP_002545348.1|  ATP-dependent RNA helicase SUB2                    205   3e-61   
ref|XP_003651446.1|  hypothetical protein THITE_2111758                 209   3e-61   
gb|AAY86975.1|  DEAD box protein                                        203   3e-61   
gb|EAX03405.1|  hCG2005638, isoform CRA_b                               206   3e-61   
ref|XP_001968815.1|  GG24297                                            208   3e-61   
ref|XP_001961799.1|  GF14747                                            208   3e-61   
ref|XP_002600114.1|  hypothetical protein BRAFLDRAFT_118235             204   3e-61   
ref|XP_005995919.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    208   3e-61   
ref|XP_004390787.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   3e-61   
ref|XP_006874383.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       208   3e-61   
ref|XP_678826.1|  helicase                                              209   3e-61   
ref|NP_723089.1|  helicase at 25E, isoform A                            208   3e-61   
ref|XP_003191688.1|  ATP dependent RNA helicase                         209   4e-61   
gb|ETB57114.1|  hypothetical protein YYC_04948                          209   4e-61   
ref|XP_003123418.3|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   4e-61   
ref|XP_007949570.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   4e-61   
emb|CDR10968.1|  ATP-dependent RNA helicase UAP56, putative             209   4e-61   
gb|ADB44901.1|  DEAD(Asp-Glu-Ala-Asp) box polypeptide 39                208   4e-61   
ref|XP_003501931.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       208   4e-61   
ref|XP_005708850.1|  ATP-dependent RNA helicase                         209   4e-61   
gb|EMS20830.1|  ATP-dependent rna helicase sub2                         209   4e-61   
ref|XP_008328948.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       208   4e-61   
ref|XP_007410654.1|  hypothetical protein MELLADRAFT_48571              208   4e-61   
ref|XP_004872547.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   4e-61   
ref|XP_004043684.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   4e-61   
gb|EHH29721.1|  ATP-dependent RNA helicase DDX39                        209   4e-61   
ref|XP_006066605.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   4e-61   
gb|EGW00654.1|  ATP-dependent RNA helicase DDX39                        208   5e-61   
ref|XP_005865907.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    208   5e-61   
ref|XP_004286666.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   5e-61   
gb|KDN51393.1|  putative ATP-dependent RNA helicase                     207   5e-61   
ref|XP_003941746.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    208   5e-61   
ref|XP_010853738.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    209   5e-61   
gb|ELK06762.1|  ATP-dependent RNA helicase DDX39                        209   5e-61   
ref|XP_004424437.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   6e-61   
dbj|BAB15509.1|  unnamed protein product                                209   6e-61   
ref|XP_009433171.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   6e-61   
gb|KIN04369.1|  hypothetical protein OIDMADRAFT_156268                  208   6e-61   
ref|XP_005289374.1|  PREDICTED: spliceosome RNA helicase DDX39B         204   6e-61   
ref|XP_003972140.1|  PREDICTED: ATP-dependent RNA helicase DDX39A...    208   6e-61   
gb|AAH71505.1|  Ddx39a protein                                          208   6e-61   
ref|XP_006691791.1|  hypothetical protein CTHT_0012740                  208   7e-61   
ref|XP_004902967.1|  PREDICTED: ATP-dependent RNA helicase DDX39A       209   7e-61   
dbj|BAE23239.1|  unnamed protein product                                207   7e-61   
ref|XP_004621321.1|  PREDICTED: spliceosome RNA helicase DDX39B i...    206   7e-61   
gb|ERE79092.1|  ATP-dependent RNA helicase DDX39A                       208   7e-61   



>gb|EPS66777.1| hypothetical protein M569_07999 [Genlisea aurea]
Length=220

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  81   FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  140

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  141  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  200

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  201  FEVDIKELPEQIDTATYMPS  220



>dbj|BAH57176.1| AT5G11200 [Arabidopsis thaliana]
Length=180

 Score =   284 bits (726),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  41   FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  100

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  101  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  160

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  161  FEVDIKELPEQIDTSTYMPS  180



>dbj|BAD93957.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana]
Length=208

 Score =   284 bits (726),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  69   FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  128

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  129  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  188

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  189  FEVDIKELPEQIDTSTYMPS  208



>gb|KFK25391.1| hypothetical protein AALP_AA8G108300 [Arabis alpina]
Length=180

 Score =   282 bits (722),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  41   FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  100

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VLNQVQER
Sbjct  101  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSGVLNQVQER  160

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  161  FEVDIKELPEQIDTSTYMPS  180



>ref|XP_011070543.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Sesamum indicum]
Length=344

 Score =   287 bits (735),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_008806610.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Phoenix dactylifera]
Length=344

 Score =   287 bits (735),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_011081571.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Sesamum indicum]
Length=344

 Score =   287 bits (735),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KJB54997.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=344

 Score =   287 bits (735),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KHG04361.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum]
 gb|KJB65813.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=344

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>emb|CDP13502.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  237  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  296

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  297  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  356

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  357  FEVDIKELPEQIDTSTYMPS  376



>gb|KJB27349.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=344

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KHG15649.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=401

 Score =   288 bits (736),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  262  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  321

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  322  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  381

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  382  FEVDIKELPEQIDTSTYMPS  401



>gb|KHG04362.1| DEAD-box ATP-dependent RNA helicase 56 [Gossypium arboreum]
Length=301

 Score =   284 bits (727),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 141/157 (90%), Positives = 143/157 (91%), Gaps = 2/157 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  88   FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  147

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  148  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  207

Query  296  FEVDIKELPEQIDTSTYMPS*RSWLASSPIAPQGFLE  186
            FEVDIKELPEQIDTSTY  S + W      A  GF E
Sbjct  208  FEVDIKELPEQIDTSTYTYSRQYWSQRPKFA--GFPE  242



>gb|KJB54998.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=379

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  240  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  299

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  300  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  359

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  360  FEVDIKELPEQIDTSTYMPS  379



>ref|XP_010324988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Solanum lycopersicum]
Length=344

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_008797872.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Phoenix dactylifera]
Length=344

 Score =   285 bits (730),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KJB70604.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=344

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_010254382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nelumbo nucifera]
Length=428

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010250100.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
 ref|XP_010250101.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010924921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
 ref|XP_010924922.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Elaeis guineensis]
Length=428

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KDP33603.1| hypothetical protein JCGZ_07174 [Jatropha curcas]
Length=428

 Score =   287 bits (735),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_008806594.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
 ref|XP_008806602.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Phoenix dactylifera]
Length=428

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010555770.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like, partial 
[Tarenaya hassleriana]
Length=292

 Score =   283 bits (723),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  153  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  212

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQ+ ER
Sbjct  213  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQLYER  272

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  273  FEVDIKELPEQIDTSTYMPS  292



>ref|XP_010519945.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Tarenaya hassleriana]
Length=344

 Score =   285 bits (728),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAGELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KJB82814.1| hypothetical protein B456_013G215200 [Gossypium raimondii]
Length=428

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_011081570.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Sesamum indicum]
Length=428

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_011070464.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Sesamum indicum]
Length=428

 Score =   287 bits (735),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_007011879.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY29498.1| DEAD/DEAH box RNA helicase family protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KJB65811.1| hypothetical protein B456_010G114300 [Gossypium raimondii]
Length=428

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KJB54999.1| hypothetical protein B456_009G057600 [Gossypium raimondii]
Length=428

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010267037.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nelumbo 
nucifera]
Length=428

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_008654597.1| PREDICTED: uncharacterized protein LOC100273717 isoform X1 [Zea 
mays]
 gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays]
Length=344

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_009783372.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
 ref|XP_009783373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Nicotiana 
sylvestris]
Length=428

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KJB27350.1| hypothetical protein B456_004G292500 [Gossypium raimondii]
Length=428

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010048210.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Eucalyptus grandis]
Length=343

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  204  FNQVVIFVKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  263

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  264  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  323

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  324  FEVDIKELPEQIDTSTYMPS  343



>ref|NP_850807.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91641.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
Length=344

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_009606367.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Nicotiana tomentosiformis]
Length=344

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_006346267.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X3 [Solanum tuberosum]
Length=344

 Score =   283 bits (724),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLV+CNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVDCNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVIN+DMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ+R
Sbjct  265  VGRGIDIERVNIVINFDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQR  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_002285072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
Length=428

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGM QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMPQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010912069.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
 ref|XP_010912075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Elaeis 
guineensis]
Length=428

 Score =   285 bits (730),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_008797870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008797871.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Phoenix dactylifera]
Length=428

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_002324856.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
 gb|EEF03421.1| hypothetical protein POPTR_0018s01620g [Populus trichocarpa]
Length=428

 Score =   285 bits (730),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_002309623.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
 ref|XP_011039701.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Populus euphratica]
 gb|EEE93146.1| hypothetical protein POPTR_0006s26940g [Populus trichocarpa]
Length=428

 Score =   285 bits (730),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_007011878.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY29497.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=485

 Score =   287 bits (734),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/140 (99%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  346  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  405

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  406  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  465

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  466  FEVDIKELPEQIDTSTYMPS  485



>ref|XP_004138728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Cucumis 
sativus]
Length=344

 Score =   282 bits (722),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAEL+KLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELDKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNNVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KJB70602.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=427

 Score =   285 bits (729),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_006853982.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
 gb|ERN15449.1| hypothetical protein AMTR_s00036p00225190 [Amborella trichopoda]
Length=428

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_006361727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=427

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_004245029.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
 ref|XP_010324987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Solanum lycopersicum]
Length=427

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>gb|KDP37097.1| hypothetical protein JCGZ_06153 [Jatropha curcas]
Length=428

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQAR  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_001770294.1| predicted protein [Physcomitrella patens]
 gb|EDQ64969.1| predicted protein [Physcomitrella patens]
Length=425

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  286  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  345

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S SDSDVLNQVQER
Sbjct  346  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASPSDSDVLNQVQER  405

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  406  FEVDIKELPEQIDTTTYMPS  425



>gb|KDO61716.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=356

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDL
Sbjct  217  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDL  276

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  277  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  336

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  337  FEVDIKELPEQIDTSTYMPS  356



>ref|XP_009412247.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=344

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|EYU32343.1| hypothetical protein MIMGU_mgv1a006879mg [Erythranthe guttata]
Length=428

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_007023163.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY25785.1| DEAD/DEAH box RNA helicase family protein isoform 1 [Theobroma 
cacao]
Length=427

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/140 (98%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010519944.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Tarenaya hassleriana]
Length=428

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAGELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_006287808.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 ref|XP_006289730.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
 gb|EOA20706.1| hypothetical protein CARUB_v10001023mg [Capsella rubella]
 gb|EOA22628.1| hypothetical protein CARUB_v10003298mg [Capsella rubella]
Length=427

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_009595644.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
 ref|XP_009595645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFP+ICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPAICIHSGMTQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDFLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_009758663.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Nicotiana sylvestris]
Length=428

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|ADE76139.1| unknown [Picea sitchensis]
Length=427

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  348  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELP QIDTSTYMPS
Sbjct  408  FEVDIKELPAQIDTSTYMPS  427



>ref|XP_009624283.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
tomentosiformis]
Length=428

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAA+L+KLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAQLDKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|ABK93079.1| unknown [Populus trichocarpa]
Length=428

 Score =   283 bits (725),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLMRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERV+IVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVDIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_009392979.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=344

 Score =   280 bits (717),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_010048208.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 ref|XP_010048209.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Eucalyptus grandis]
 gb|KCW80388.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
 gb|KCW80389.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=427

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010696055.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=344

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFK+G +RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLARYKGFKDGKQRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_009606356.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009606362.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Nicotiana tomentosiformis]
Length=428

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAA+LNKLLVECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAQLNKLLVECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_002969825.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
 gb|EFJ28949.1| hypothetical protein SELMODRAFT_146823 [Selaginella moellendorffii]
Length=428

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+SS+DS+VLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASSTDSNVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010048977.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Eucalyptus 
grandis]
Length=427

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDTLNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_009771911.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
 ref|XP_009771912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Nicotiana 
sylvestris]
Length=428

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAA+L+KLLVECNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAQLDKLLVECNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays]
 gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays]
 gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays]
Length=429

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>ref|XP_004960988.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Setaria italica]
Length=429

 Score =   283 bits (723),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>ref|XP_006346265.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006346266.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Solanum tuberosum]
Length=428

 Score =   283 bits (723),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 140/140 (100%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLV+CNFPSICIHSGM+QEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVDCNFPSICIHSGMTQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVIN+DMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ+R
Sbjct  349  VGRGIDIERVNIVINFDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQQR  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KDO61715.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=418

 Score =   282 bits (722),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDL
Sbjct  279  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDL  338

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  339  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  398

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  399  FEVDIKELPEQIDTSTYMPS  418



>ref|XP_002268833.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Vitis vinifera]
 emb|CBI36308.3| unnamed protein product [Vitis vinifera]
Length=428

 Score =   282 bits (722),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGM QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMPQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|NP_568245.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 ref|NP_568244.2| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 sp|Q9LFN6.2|RH56_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 56; AltName: 
Full=UAP56 homolog B [Arabidopsis thaliana]
 sp|Q56XG6.3|RH15_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 15; AltName: 
Full=UAP56 homolog A [Arabidopsis thaliana]
 gb|AAK55671.1|AF378868_1 AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAK96496.1| AT5g11170/F2I11_60 [Arabidopsis thaliana]
 gb|AAL15393.1| AT5g11200/F2I11_90 [Arabidopsis thaliana]
 gb|AAN46806.1| At5g11170/F2I11_60 [Arabidopsis thaliana]
 dbj|BAE98572.1| DEAD BOX RNA helicase RH15 - like protein [Arabidopsis thaliana]
 gb|AED91642.1| DEAD-box ATP-dependent RNA helicase 15 [Arabidopsis thaliana]
 gb|AED91645.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=427

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_002871462.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47721.1| hypothetical protein ARALYDRAFT_487950 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010419674.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_007011880.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY29499.1| DEAD/DEAH box RNA helicase family protein isoform 3 [Theobroma 
cacao]
Length=429

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/141 (98%), Positives = 139/141 (99%), Gaps = 1/141 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN-QVQE  300
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN QVQE
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQQVQE  408

Query  299  RFEVDIKELPEQIDTSTYMPS  237
            RFEVDIKELPEQIDTSTYMPS
Sbjct  409  RFEVDIKELPEQIDTSTYMPS  429



>ref|XP_006483351.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Citrus 
sinensis]
Length=427

 Score =   282 bits (722),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010491834.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
 ref|XP_010491835.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=427

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_006450448.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63688.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61714.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=427

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>gb|KJB70605.1| hypothetical protein B456_011G082500 [Gossypium raimondii]
Length=363

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 142/151 (94%), Gaps = 3/151 (2%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTSDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTY---MPS*RSWLASS  213
            FEVDIKELPEQIDTSTY   +P+ + ++  +
Sbjct  325  FEVDIKELPEQIDTSTYSKKLPTMQCYMTEA  355



>ref|XP_004968948.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Setaria italica]
Length=429

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>ref|XP_004171175.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Cucumis 
sativus]
 ref|XP_008445205.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 ref|XP_008445206.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Cucumis melo]
 gb|KGN62946.1| hypothetical protein Csa_2G381720 [Cucumis sativus]
Length=427

 Score =   282 bits (721),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAEL+KLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAAELDKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNNVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010453161.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Camelina sativa]
Length=427

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+SSSDS+VLNQVQ+R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASSSDSEVLNQVQDR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>gb|EYU24648.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
 gb|EYU24649.1| hypothetical protein MIMGU_mgv1a006871mg [Erythranthe guttata]
Length=428

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG KRILVATDL
Sbjct  289  FNQIVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGLKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  409  FEVDIKELPEQIDTATYMPS  428



>ref|XP_002517619.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF44783.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=427

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLT+YK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTKYKNFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_009412246.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=428

 Score =   281 bits (720),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/140 (97%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_002873498.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49757.1| hypothetical protein ARALYDRAFT_909079 [Arabidopsis lyrata subsp. 
lyrata]
Length=427

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSTVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_010231905.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X2 
[Brachypodium distachyon]
Length=377

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELNKLL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  238  FNQIVIFVKSVGRASELNKLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  297

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  298  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  357

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  358  FEVDIKELPEQIDTSTYMPS  377



>ref|XP_004241774.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Solanum lycopersicum]
Length=428

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLAECNFPSICIHSGMTQEERLTRYKAFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|NP_001154706.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91646.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=486

 Score =   283 bits (723),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  347  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  406

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  407  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  466

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  467  FEVDIKELPEQIDTSTYMPS  486



>ref|XP_006353691.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Solanum 
tuberosum]
Length=428

 Score =   281 bits (718),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLAECNFPSICIHSGMTQEERLTRYKSFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010231902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Brachypodium distachyon]
Length=344

 Score =   278 bits (710),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|NP_001141599.1| uncharacterized protein LOC100273717 [Zea mays]
 gb|ACN35192.1| unknown [Zea mays]
Length=429

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLT YK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTSYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>ref|XP_010231903.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X2 [Brachypodium distachyon]
Length=344

 Score =   278 bits (710),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|NP_001154707.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
 gb|AED91647.1| DEAD-box ATP-dependent RNA helicase 56 [Arabidopsis thaliana]
Length=468

 Score =   281 bits (720),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  329  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  388

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  389  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  448

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  449  FEVDIKELPEQIDTSTYMPS  468



>ref|XP_009392978.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=428

 Score =   280 bits (716),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEG KRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKNFKEGLKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|KHG21287.1| DEAD-box ATP-dependent RNA helicase 56 -like protein [Gossypium 
arboreum]
Length=461

 Score =   281 bits (718),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 134/137 (98%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL+ECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  235  FNQVVIFVKSVSRAAELNKLLMECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  294

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  295  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  354

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  355  FEVDIKELPEQIDTSTY  371



>ref|XP_010419673.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Camelina sativa]
Length=344

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+ +SDS VL QVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVALASDSGVLKQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>gb|KCW81407.1| hypothetical protein EUGRSUZ_C02784 [Eucalyptus grandis]
Length=543

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  404  FNQVVIFVKSVSRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  463

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD LNQVQ R
Sbjct  464  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDTLNQVQAR  523

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  524  FEVDIKELPEQIDTSTYMPS  543



>ref|XP_010696045.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=428

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFK+G +RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLARYKGFKDGKQRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>gb|ACU23716.1| unknown [Glycine max]
Length=226

 Score =   273 bits (697),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  87   FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  146

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  147  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  206

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  207  FEVDIKQLPEQIDTSTYMPS  226



>ref|XP_009121984.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=325

 Score =   276 bits (705),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  186  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  245

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  246  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  305

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  306  FEVDIKELPEQIDTSTYMPS  325



>gb|EEC70860.1| hypothetical protein OsI_02372 [Oryza sativa Indica Group]
 gb|EEE54782.1| hypothetical protein OsJ_02179 [Oryza sativa Japonica Group]
Length=344

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  325  FEVDIKELPEQIDTSTYMPS  344



>ref|XP_006409182.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
 gb|ESQ50635.1| hypothetical protein EUTSA_v10022698mg [Eutrema salsugineum]
Length=427

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLLVECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAKELNKLLVECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSDVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQ+DTSTYMPS
Sbjct  408  FEVDIKELPEQLDTSTYMPS  427



>ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
 ref|XP_010231904.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15 isoform X1 
[Brachypodium distachyon]
Length=429

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELNKLL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQIVIFVKSVGRASELNKLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>ref|XP_004960989.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Setaria italica]
Length=371

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS*RSWLAS  216
            FEVDIKELPEQIDTSTY       LAS
Sbjct  325  FEVDIKELPEQIDTSTYSKCCHLDLAS  351



>ref|XP_010453157.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Camelina 
sativa]
Length=427

 Score =   278 bits (712),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 138/140 (99%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VL+QVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSGVLDQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE+DIKELPEQIDTSTYMPS
Sbjct  408  FEIDIKELPEQIDTSTYMPS  427



>dbj|BAJ53224.1| JHL06P13.3 [Jatropha curcas]
Length=455

 Score =   279 bits (713),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 2/142 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQAR  408

Query  296  FEVDIKELPEQIDTSTY--MPS  237
            FEVDIKELPEQIDTSTY  MPS
Sbjct  409  FEVDIKELPEQIDTSTYSKMPS  430



>ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   277 bits (709),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_010231899.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
 ref|XP_010231901.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Brachypodium distachyon]
Length=428

 Score =   277 bits (709),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  409  FEVDIKELPEQIDTSTYMPS  428



>ref|XP_009121980.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  269  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  328

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  329  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  388

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  389  FEVDIKELPEQIDTSTYMPS  408



>ref|XP_010419672.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Camelina sativa]
Length=427

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+ +SDS VL QVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVALASDSGVLKQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_006644281.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  294  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  354  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  414  FEVDIKELPEQIDTSTYMPS  433



>ref|XP_006644282.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like [Oryza 
brachyantha]
Length=433

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  294  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  354  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  414  FEVDIKELPEQIDTSTYMPS  433



>ref|XP_003588758.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=344

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  325  FEVDIKQLPEQIDTSTYMPS  344



>ref|NP_001170610.1| uncharacterized protein LOC100384654 [Zea mays]
 ref|XP_008655336.1| PREDICTED: uncharacterized protein LOC100384654 isoform X1 [Zea 
mays]
 gb|ACR34212.1| unknown [Zea mays]
 gb|AFW82992.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
 gb|AFW82993.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=427

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 1/140 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFV SSSDSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFV-SSSDSDVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_009121982.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
 ref|XP_009121983.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Brassica rapa]
Length=408

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  269  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  328

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  329  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  388

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  389  FEVDIKELPEQIDTSTYMPS  408



>ref|XP_009121981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Brassica rapa]
Length=430

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  291  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  350

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  351  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  410

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  411  FEVDIKELPEQIDTSTYMPS  430



>ref|NP_001043298.1| Os01g0550000 [Oryza sativa Japonica Group]
 sp|Q5JK84.1|RH15_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 15 [Oryza sativa 
Japonica Group]
 dbj|BAD88055.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAD88115.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAF05212.1| Os01g0550000 [Oryza sativa Japonica Group]
 dbj|BAH00768.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70861.1| hypothetical protein OsI_02373 [Oryza sativa Indica Group]
Length=432

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  293  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  352

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  353  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  412

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  413  FEVDIKELPEQIDTSTYMPS  432



>ref|XP_006399618.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
 gb|ESQ41071.1| hypothetical protein EUTSA_v10013628mg [Eutrema salsugineum]
Length=427

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLLVECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAKELNKLLVECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASTSDSGVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>gb|KCW80390.1| hypothetical protein EUGRSUZ_C01749 [Eucalyptus grandis]
Length=430

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLV+CNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVNRAAELNKLLVDCNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVQAR  407

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  408  FEVDIKELPEQIDTSTY  424



>gb|AFW82994.1| hypothetical protein ZEAMMB73_566534 [Zea mays]
Length=446

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/140 (96%), Positives = 137/140 (98%), Gaps = 1/140 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  308  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  367

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIV+NYDMPDSADTYLHRVGRAGRFGTKGLAITFV SSSDSDVLNQVQER
Sbjct  368  VGRGIDIERVNIVVNYDMPDSADTYLHRVGRAGRFGTKGLAITFV-SSSDSDVLNQVQER  426

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  427  FEVDIKELPEQIDTSTYMPS  446



>ref|XP_008378410.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Malus 
domestica]
Length=344

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQER  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  325  FEVDIKELPEQIDTATYMPS  344



>ref|XP_006583127.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Glycine max]
Length=344

 Score =   273 bits (698),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  325  FEVDIKELPEQIDTSTYMPN  344



>ref|XP_009121985.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Brassica rapa]
Length=430

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  291  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  350

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  351  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  410

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  411  FEVDIKELPEQIDTSTYMPS  430



>sp|Q0JM17.2|RH56_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 56 [Oryza sativa 
Japonica Group]
 dbj|BAD88053.1| putative HLA-B associated transcript 1 [Oryza sativa Japonica 
Group]
 dbj|BAG90417.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ACV83946.1| DExD box helicase protein HLA-B associated transcript 1 [Oryza 
sativa Japonica Group]
Length=432

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  293  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  352

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  353  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  412

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  413  FEVDIKELPEQIDTSTYMPS  432



>emb|CAB96655.1| DEAD BOX RNA helicase RH15 [Arabidopsis thaliana]
Length=427

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  408  FEVDIKELPEQIDTSTY  424



>ref|XP_007222437.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222438.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_007222439.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 ref|XP_008219486.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Prunus mume]
 gb|EMJ23636.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23637.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
 gb|EMJ23638.1| hypothetical protein PRUPE_ppa006122mg [Prunus persica]
Length=426

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEGH RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGHNRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQER  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  407  FEVDIKELPEQIDTATYMPS  426



>emb|CDX70383.1| BnaC03g04670D [Brassica napus]
Length=447

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  308  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  367

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  368  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  427

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  428  FEVDIKELPEQIDTSTYMPS  447



>ref|XP_004960987.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Setaria italica]
Length=456

 Score =   276 bits (706),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/147 (92%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS*RSWLAS  216
            FEVDIKELPEQIDTSTY       LAS
Sbjct  410  FEVDIKELPEQIDTSTYSKCCHLDLAS  436



>gb|EEE54779.1| hypothetical protein OsJ_02176 [Oryza sativa Japonica Group]
Length=429

 Score =   275 bits (703),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  350  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  410  FEVDIKELPEQIDTSTYMPS  429



>emb|CAB96652.1| DEAD BOX RNA helicase RH15-like protein [Arabidopsis thaliana]
Length=435

 Score =   275 bits (704),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  407

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  408  FEVDIKELPEQIDTSTY  424



>emb|CBI21031.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/137 (98%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGM QEERLTRYKGFKEGHKRILVATDL
Sbjct  353  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMPQEERLTRYKGFKEGHKRILVATDL  412

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  413  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  472

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  473  FEVDIKELPEQIDTSTY  489



>ref|XP_009131197.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
56-like [Brassica rapa]
Length=458

 Score =   276 bits (705),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  319  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  378

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  379  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  438

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  439  FEVDIKELPEQIDTSTYMPS  458



>ref|XP_006578149.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Glycine max]
Length=344

 Score =   272 bits (695),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  324

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  325  FEVDIKQLPEQIDTSTYMPS  344



>ref|XP_009125794.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   275 bits (702),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FN+VVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  288  FNKVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  408  FEVDIKELPEQIDTSTYMPS  427



>ref|XP_002985161.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
 gb|EFJ13655.1| hypothetical protein SELMODRAFT_446187 [Selaginella moellendorffii]
Length=473

 Score =   276 bits (706),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVNRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMP+SADTYLHRVGRAGRFGTKGLAITFV+SS+DS+VLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPESADTYLHRVGRAGRFGTKGLAITFVASSTDSNVLNQVQER  408

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  409  FEVDIKELPEQIDTSTY  425



>ref|XP_007135742.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
 gb|ESW07736.1| hypothetical protein PHAVU_010G154700g [Phaseolus vulgaris]
Length=425

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDL
Sbjct  286  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDL  345

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  346  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  405

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  406  FEVDIKELPEQIDTSTYMPN  425



>ref|XP_001781775.1| predicted protein [Physcomitrella patens]
 gb|EDQ53423.1| predicted protein [Physcomitrella patens]
Length=432

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/137 (96%), Positives = 136/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  286  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  345

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+ DS+VLNQVQER
Sbjct  346  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASAPDSNVLNQVQER  405

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDT+TY
Sbjct  406  FEVDIKELPEQIDTTTY  422



>ref|NP_001043297.1| Os01g0549700 [Oryza sativa Japonica Group]
 dbj|BAF05211.1| Os01g0549700, partial [Oryza sativa Japonica Group]
Length=495

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFP+I IHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  356  FNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDL  415

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  416  VGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  475

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  476  FEVDIKELPEQIDTSTYMPS  495



>emb|CAA09205.1| RNA helicase [Arabidopsis thaliana]
Length=451

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLLV C+FPSICIHSGMSQEERLTRYK FKEGHKRILVATDL
Sbjct  312  FNQVVIFVKSVSRADELNKLLVGCHFPSICIHSGMSQEERLTRYKSFKEGHKRILVATDL  371

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQER
Sbjct  372  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQER  431

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  432  FEVDIKELPEQIDTSTYMPS  451



>ref|XP_008394071.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_008394072.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Malus domestica]
 ref|XP_009355726.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355727.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
 ref|XP_009355728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 [Pyrus x bretschneideri]
Length=426

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGMSQEERL RYKGFKEG  RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMSQEERLKRYKGFKEGQNRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQER  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  407  FEVDIKELPEQIDTATYMPS  426



>ref|XP_011459186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011459187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Fragaria vesca subsp. vesca]
Length=426

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN VQER
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNDVQER  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  407  FEVDIKELPEQIDTATYMPS  426



>emb|CDX78412.1| BnaA03g03240D [Brassica napus]
Length=497

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  358  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  417

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  418  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  477

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  478  FEVDIKELPEQIDTSTYMPS  497



>emb|CDX69778.1| BnaA10g21270D [Brassica napus]
Length=495

 Score =   275 bits (703),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  356  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  415

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  416  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  475

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  476  FEVDIKELPEQIDTSTYMPS  495



>gb|EMT19211.1| DEAD-box ATP-dependent RNA helicase 56 [Aegilops tauschii]
Length=551

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  254  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  313

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  314  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  373

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  374  FEVDIKELPEQIDTSTY  390



>gb|AFV30230.1| ATP-dependent RNA helicase [Medicago sativa]
Length=427

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>emb|CDX69777.1| BnaA10g21260D [Brassica napus]
Length=523

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  384  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  443

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  444  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  503

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMPS
Sbjct  504  FEVDIKELPEQIDTSTYMPS  523



>gb|AFK41905.1| unknown [Medicago truncatula]
Length=427

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>ref|XP_003588757.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES59008.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>ref|XP_003528338.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
Length=426

 Score =   273 bits (697),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  407  FEVDIKELPEQIDTSTYMPN  426



>ref|XP_003531708.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X1 
[Glycine max]
Length=426

 Score =   272 bits (696),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  407  FEVDIKELPEQIDTSTYMPN  426



>ref|XP_009376926.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009376927.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=426

 Score =   272 bits (696),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQER  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  407  FEVDIKELPEQIDTATYMPS  426



>ref|XP_011459188.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Fragaria vesca subsp. vesca]
Length=462

 Score =   273 bits (698),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERL RYKGFKEG  RILVATDL
Sbjct  323  FNQVVIFVKSVSRAAELNKLLSECNFPSICIHSGMNQEERLKRYKGFKEGQNRILVATDL  382

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLN VQER
Sbjct  383  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNDVQER  442

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDT+TYMPS
Sbjct  443  FEVDIKELPEQIDTATYMPS  462



>ref|XP_007137031.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
 gb|ESW09025.1| hypothetical protein PHAVU_009G093800g [Phaseolus vulgaris]
Length=427

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>gb|KEH28678.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=504

 Score =   274 bits (700),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDL
Sbjct  365  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDL  424

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ R
Sbjct  425  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSR  484

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  485  FEVDIKELPEQIDTSTYMPN  504



>ref|XP_003522620.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Glycine max]
 gb|KHN08125.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>ref|XP_003526412.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX1 [Glycine 
max]
 ref|XP_003526413.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoformX2 [Glycine 
max]
 ref|XP_006581360.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X3 
[Glycine max]
 gb|KHN07085.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=427

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>gb|AGV54745.1| DEAD-box ATP-dependent RNA helicase 56-like protein [Phaseolus 
vulgaris]
Length=427

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>gb|AGV54235.1| DEAD-box ATP-dependent RNA helicase 56 [Phaseolus vulgaris]
Length=427

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>emb|CDY71952.1| BnaAnng39360D, partial [Brassica napus]
Length=417

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  254  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  313

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  314  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  373

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTY+ S
Sbjct  374  FEVDIKELPEQIDTSTYIAS  393



>ref|XP_004498731.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDTSTYMPS
Sbjct  408  FEVDIKQLPEQIDTSTYMPS  427



>gb|KHN01339.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=473

 Score =   272 bits (696),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/140 (93%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  334  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  393

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  394  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  453

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIKELPEQIDTSTYMP+
Sbjct  454  FEVDIKELPEQIDTSTYMPN  473



>ref|XP_004506913.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=353

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSR  324

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  325  FEVDIKELPEQIDTSTY  341



>gb|EMS64048.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=456

 Score =   270 bits (691),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 2/159 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  287  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERLTRYKNFKEGHKRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQER
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQER  406

Query  296  FEVDIKELPEQIDTSTYMPS*RSWLASSPIAPQGFLE*C  180
            FEVDIKELPEQIDTSTY+   R  +   P+   G    C
Sbjct  407  FEVDIKELPEQIDTSTYIL--RLMVVKEPVGNVGVHHVC  443



>ref|XP_003603412.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES73663.1| DEAD-box ATP-dependent RNA helicase-like protein [Medicago truncatula]
Length=427

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL++LL+ECNFPSICIHSGMSQEERL RY+GFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDRLLIECNFPSICIHSGMSQEERLKRYRGFKEGHSRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE+DIK+LPEQIDTSTYMPS
Sbjct  408  FEIDIKQLPEQIDTSTYMPS  427



>emb|CDY51112.1| BnaCnng20150D [Brassica napus]
Length=440

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  294  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  354  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  413

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  414  FEVDIKELPEQIDTSTY  430



>emb|CDX85726.1| BnaA02g00870D [Brassica napus]
Length=490

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/140 (92%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  351  FNQVVIFVKSVSRARELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  410

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  411  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  470

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPE IDTSTYMPS
Sbjct  471  FEVDIKQLPENIDTSTYMPS  490



>emb|CDX85725.1| BnaA02g00880D [Brassica napus]
Length=442

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVATDL
Sbjct  292  FNQVVIFVKSVSRAGELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVATDL  351

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ+R
Sbjct  352  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQDR  411

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  412  FEVDIKELPEQIDTSTY  428



>gb|EMS68248.1| DEAD-box ATP-dependent RNA helicase 56 [Triticum urartu]
Length=657

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/137 (96%), Positives = 135/137 (99%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  344  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  403

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQER
Sbjct  404  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQER  463

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  464  FEVDIKELPEQIDTSTY  480



>ref|XP_009334643.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Pyrus x bretschneideri]
Length=344

 Score =   266 bits (679),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  324

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  325  FEVDIKELPEQIDTSTYM  342



>ref|XP_009125790.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
 ref|XP_009125791.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brassica 
rapa]
Length=427

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL+ECNFPSICIHSGMSQEERLT YK FKEG KRILVATDL
Sbjct  288  FNQVVIFVKSVSRARELNKLLIECNFPSICIHSGMSQEERLTHYKSFKEGQKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQAR  407

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPE IDTSTYMPS
Sbjct  408  FEVDIKQLPENIDTSTYMPS  427



>ref|XP_004506912.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=435

 Score =   268 bits (685),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/137 (94%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSR  406

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  407  FEVDIKELPEQIDTSTY  423



>ref|XP_010101269.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB88204.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=518

 Score =   270 bits (689),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 136/147 (93%), Gaps = 1/147 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGMSQEERL RYKGFKEG  RILVATDL
Sbjct  336  FNQVVIFVKSVSRAAELNKLLAECNFPSICIHSGMSQEERLKRYKGFKEGQNRILVATDL  395

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLN VQER
Sbjct  396  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNDVQER  455

Query  296  FEVDIKELPEQIDTSTYMPS*RSWLAS  216
            FEVDIKELPEQIDTSTY  +   W AS
Sbjct  456  FEVDIKELPEQIDTSTYSDA-SPWKAS  481



>ref|XP_006585632.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56 isoform X2 
[Glycine max]
Length=440

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  406

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  407  FEVDIKELPEQIDTSTY  423



>ref|XP_004968947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 15-like isoform 
X1 [Setaria italica]
Length=457

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 138/168 (82%), Gaps = 28/168 (17%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL ECNFPSICIHSGM+QEERLTRYK FKEGHKRILVATDL
Sbjct  290  FNQVVIFVKSVSRAAELNKLLCECNFPSICIHSGMTQEERLTRYKNFKEGHKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHR----------------------------VGRA  381
            VGRGIDIERVNIV+NYDMPDSADTYLHR                            VGRA
Sbjct  350  VGRGIDIERVNIVVNYDMPDSADTYLHRVIVAPPLLQAVGSFYLFYYLLLMHSPLQVGRA  409

Query  380  GRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  237
            GRFGTKGLAITFVSS+SDSDVLNQVQERFEVDIKELPEQIDTSTYMPS
Sbjct  410  GRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  457



>ref|XP_008362058.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Malus domestica]
 ref|XP_008362062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Malus domestica]
Length=344

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELN LL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELNNLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  324

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  325  FEVDIKELPEQIDTSTYM  342



>ref|XP_007161216.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
 gb|ESW33210.1| hypothetical protein PHAVU_001G051700g [Phaseolus vulgaris]
Length=426

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQ+VIFVKSV+RAAEL+KLL ECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  287  FNQIVIFVKSVSRAAELDKLLRECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS S+D DVLN VQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSTDVDVLNNVQSR  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEVDIK+LPEQIDT++YMPS
Sbjct  407  FEVDIKQLPEQIDTASYMPS  426



>gb|KHN47769.1| DEAD-box ATP-dependent RNA helicase 56 [Glycine soja]
Length=450

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHS MSQEERL RYKGFKEG +RILVATDL
Sbjct  287  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSAMSQEERLKRYKGFKEGKQRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DS+VLNQVQ R
Sbjct  347  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSTADSEVLNQVQSR  406

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIKELPEQIDTSTY
Sbjct  407  FEVDIKELPEQIDTSTY  423



>ref|XP_004501320.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=431

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/137 (93%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIK+LPEQIDTSTY
Sbjct  408  FEVDIKQLPEQIDTSTY  424



>ref|XP_008243728.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Prunus 
mume]
Length=428

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_009334641.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Pyrus x bretschneideri]
Length=428

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_004303319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSS+DSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSADSDVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_007215422.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
 gb|EMJ16621.1| hypothetical protein PRUPE_ppa006077mg [Prunus persica]
Length=428

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/138 (93%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_004498732.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X3 [Cicer arietinum]
Length=404

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  265  VGRGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  324

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIK+LPEQIDTSTY
Sbjct  325  FEVDIKQLPEQIDTSTY  341



>ref|XP_003604414.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=161

 Score =   256 bits (653),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/132 (92%), Positives = 128/132 (97%), Gaps = 0/132 (0%)
 Frame = -3

Query  632  KSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDLVGRGIDIE  453
            ++V+RAAELNKLLVECNFPSICIHSGMSQEERL RYKGFKEG +RILVATDLVGRGIDIE
Sbjct  30   RNVSRAAELNKLLVECNFPSICIHSGMSQEERLKRYKGFKEGKQRILVATDLVGRGIDIE  89

Query  452  RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKEL  273
            RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+ DS+VLNQVQ RFEVDIKEL
Sbjct  90   RVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAGDSEVLNQVQSRFEVDIKEL  149

Query  272  PEQIDTSTYMPS  237
            PEQIDTSTYMP+
Sbjct  150  PEQIDTSTYMPN  161



>ref|XP_009365409.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
 ref|XP_009348326.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Pyrus 
x bretschneideri]
Length=428

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_008362046.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Malus domestica]
Length=428

 Score =   263 bits (673),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELN LL +CNFPSICIHSGM QEERL RYK FKEG  RILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNNLLADCNFPSICIHSGMPQEERLKRYKNFKEGLSRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSDVLNQVQ R
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQSR  408

Query  296  FEVDIKELPEQIDTSTYM  243
            FEVDIKELPEQIDTSTYM
Sbjct  409  FEVDIKELPEQIDTSTYM  426



>ref|XP_004498730.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=487

 Score =   264 bits (674),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/137 (93%), Positives = 130/137 (95%), Gaps = 0/137 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN VQ R
Sbjct  348  VGRGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVQSR  407

Query  296  FEVDIKELPEQIDTSTY  246
            FEVDIK+LPEQIDTSTY
Sbjct  408  FEVDIKQLPEQIDTSTY  424



>ref|XP_004501319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X2 [Cicer arietinum]
Length=451

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 135/164 (82%), Gaps = 24/164 (15%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN-----  312
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN     
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTY  407

Query  311  -------------------QVQERFEVDIKELPEQIDTSTYMPS  237
                               QVQ RFEVDIK+LPEQIDTSTYMPS
Sbjct  408  FVVLILLSISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTYMPS  451



>ref|XP_010097240.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
 gb|EXB67307.1| DEAD-box ATP-dependent RNA helicase 56 [Morus notabilis]
Length=525

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RAAELNKLL + NFPSICIHSGMSQEERL RYK FKEGH RILVATDL
Sbjct  323  FNQVVIFVKSVNRAAELNKLLADSNFPSICIHSGMSQEERLKRYKNFKEGHSRILVATDL  382

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDS+VLNQVQ R
Sbjct  383  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSEVLNQVQSR  442

Query  296  FEVDIKELPEQIDTST  249
            FEVDIKELPEQIDTST
Sbjct  443  FEVDIKELPEQIDTST  458



>ref|XP_004501321.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X4 [Cicer arietinum]
Length=372

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 132/161 (82%), Gaps = 24/161 (15%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  205  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  264

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN-----  312
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN     
Sbjct  265  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTY  324

Query  311  -------------------QVQERFEVDIKELPEQIDTSTY  246
                               QVQ RFEVDIK+LPEQIDTSTY
Sbjct  325  FVVLILLSISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTY  365



>ref|XP_004501318.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like isoform 
X1 [Cicer arietinum]
Length=455

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 132/161 (82%), Gaps = 24/161 (15%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAEL+KLLVECNFPSICIHSGMSQEERL RYKGFKEGH RILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELDKLLVECNFPSICIHSGMSQEERLKRYKGFKEGHTRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLN-----  312
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVS SSD DVLN     
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSCSSDVDVLNNVGTY  407

Query  311  -------------------QVQERFEVDIKELPEQIDTSTY  246
                               QVQ RFEVDIK+LPEQIDTSTY
Sbjct  408  FVVLILLSISVSNYVWCDFQVQSRFEVDIKQLPEQIDTSTY  448



>emb|CDY51111.1| BnaCnng20140D [Brassica napus]
Length=249

 Score =   247 bits (630),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 127/139 (91%), Gaps = 2/139 (1%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNK--LLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVAT  483
            FNQVVIFVKSV+    L    LL+ECNFPSICIHSGMSQEERLT YK FKEGHKRILVAT
Sbjct  92   FNQVVIFVKSVSSVNLLPTACLLIECNFPSICIHSGMSQEERLTHYKSFKEGHKRILVAT  151

Query  482  DLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQ  303
            DLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDS+VLNQVQ
Sbjct  152  DLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSEVLNQVQ  211

Query  302  ERFEVDIKELPEQIDTSTY  246
             RFEVDIK+LPE IDTSTY
Sbjct  212  ARFEVDIKQLPENIDTSTY  230



>ref|XP_003063800.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52173.1| predicted protein [Micromonas pusilla CCMP1545]
Length=425

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV R   L+KLL ECNFPSI IH GMSQEERL RYK FKEGHKRILVATDL
Sbjct  286  FNQVVIFVKSVQRCTYLDKLLTECNFPSIAIHRGMSQEERLARYKSFKEGHKRILVATDL  345

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            V RGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITF++S  DS VLNQV ER
Sbjct  346  VARGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFIASDEDSGVLNQVHER  405

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+IKELPEQIDTSTYMP+
Sbjct  406  FEVEIKELPEQIDTSTYMPA  425



>gb|EMT33323.1| DEAD-box ATP-dependent RNA helicase 56 [Aegilops tauschii]
Length=501

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 134/183 (73%), Gaps = 46/183 (25%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEER--------------------  537
            FNQ+VIFVKSV RA+ELN+LL ECNFP+ICIHSGM+QEER                    
Sbjct  282  FNQIVIFVKSVGRASELNRLLCECNFPAICIHSGMTQEERWYFRRIPFDIWGLCLQKDDE  341

Query  536  --------------------------LTRYKGFKEGHKRILVATDLVGRGIDIERVNIVI  435
                                      LTRYK FKEGHKRILVATDLVGRGIDIERVNIVI
Sbjct  342  IDEESANVGRQASGVLCEKRVPQKLGLTRYKNFKEGHKRILVATDLVGRGIDIERVNIVI  401

Query  434  NYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDT  255
            NYDMPDSADTYLHRVGRAGRFGTKGLAITFV+S+SDSDVLNQVQERFEVDIKELPEQIDT
Sbjct  402  NYDMPDSADTYLHRVGRAGRFGTKGLAITFVASASDSDVLNQVQERFEVDIKELPEQIDT  461

Query  254  STY  246
            STY
Sbjct  462  STY  464



>ref|XP_010519138.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Tarenaya 
hassleriana]
Length=415

 Score =   244 bits (623),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL
Sbjct  289  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS++DSDVLNQVQER
Sbjct  349  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSAADSDVLNQVQER  408



>ref|XP_005643776.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19232.1| nuclear RNA helicase-like protein Bat1 [Coccomyxa subellipsoidea 
C-169]
Length=435

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 125/145 (86%), Gaps = 7/145 (5%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLLVECNFPSICIHS   QEERL  YK FKEG KRILVATDL
Sbjct  288  FNQVVIFVKSVMRAKELNKLLVECNFPSICIHSAQKQEERLKVYKAFKEGQKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDS-------ADTYLHRVGRAGRFGTKGLAITFVSSSSDSDV  318
            VGRGIDIERVNIVINYDMP++       ADTYLHRVGRAGRFGTKGLAITFV+S  DS V
Sbjct  348  VGRGIDIERVNIVINYDMPETDERHGNGADTYLHRVGRAGRFGTKGLAITFVASEQDSAV  407

Query  317  LNQVQERFEVDIKELPEQIDTSTYM  243
            LNQVQERF+VDIK LP+QIDTSTYM
Sbjct  408  LNQVQERFDVDIKPLPDQIDTSTYM  432



>ref|XP_002505759.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67017.1| predicted protein [Micromonas sp. RCC299]
Length=426

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV R   L+KLL ECNFPSI IH GMSQEERL RYK FKEG+KRILVATDL
Sbjct  287  FNQVVIFVKSVQRCTYLDKLLTECNFPSIAIHRGMSQEERLARYKSFKEGNKRILVATDL  346

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            V RGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGLAITF+SS  D+ VL+ V  R
Sbjct  347  VARGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLAITFLSSDEDTAVLDAVHAR  406

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+IKELPEQIDTSTYMP+
Sbjct  407  FEVEIKELPEQIDTSTYMPA  426



>gb|KGG51664.1| ATP-dependent RNA helicase Uap56 [Microsporidia sp. UGP3]
Length=440

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 4/145 (3%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLLVECNFPSICIHSGM+Q+ER+ RYK FK   KRI+VATD+
Sbjct  299  FNQVVIFVKSVARANELNKLLVECNFPSICIHSGMAQDERIARYKSFKNFEKRIMVATDI  358

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIV NYDMPD  D YLHRVGRAGRFGTKGLAI+FVS+S+D+D+LNQVQER
Sbjct  359  FGRGIDIERVNIVFNYDMPDGVDAYLHRVGRAGRFGTKGLAISFVSTSADTDILNQVQER  418

Query  296  FEVDIKELPEQIDTSTYMPS*RSWL  222
            FEV+I ELP +I+TS+Y     +WL
Sbjct  419  FEVNISELPAEIETSSY----SNWL  439



>ref|XP_006450446.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|ESR63686.1| hypothetical protein CICLE_v10008383mg [Citrus clementina]
 gb|KDO61717.1| hypothetical protein CISIN_1g014314mg [Citrus sinensis]
Length=423

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/119 (95%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEG+KRILVATDL
Sbjct  288  FNQVVIFVKSVSRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGNKRILVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQE  300
            VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSS+SDSD+LNQV +
Sbjct  348  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDILNQVSK  406



>ref|XP_001422523.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABP00840.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=358

 Score =   234 bits (596),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFV SV R   L+KLL ECNFPSI IH  M QEERL RYK FK+G KRILVATDL
Sbjct  219  FNQVVIFVSSVQRCKALDKLLQECNFPSIAIHGSMGQEERLARYKSFKDGDKRILVATDL  278

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            V RGIDIERVNIVINYDMP SADTYLHRVGRAGRFGTKGLA+TFV+SS D++VL+ V ER
Sbjct  279  VARGIDIERVNIVINYDMPSSADTYLHRVGRAGRFGTKGLAVTFVASSEDTEVLSSVHER  338

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+IKELP++ID STYMPS
Sbjct  339  FEVEIKELPDEIDQSTYMPS  358



>emb|CCJ29387.1| unnamed protein product [Pneumocystis jirovecii]
Length=220

 Score =   223 bits (568),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA+EL++LL ECNFPSICIH  + QEER++RYK FK  +KRI VATD+
Sbjct  81   FNQVVIFVKSVQRASELDRLLRECNFPSICIHGALPQEERISRYKLFKNFNKRICVATDV  140

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVN+V NYD P  ADTYLHRVGRAGRFGT+GL+ITFVSSS D+++L+++QER
Sbjct  141  FGRGIDIERVNVVFNYDTPGDADTYLHRVGRAGRFGTRGLSITFVSSSGDAEILDKIQER  200

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELPEQID STYM S
Sbjct  201  FEVNITELPEQIDVSTYMNS  220



>gb|EPY52787.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces cryophilus 
OY26]
Length=434

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KR+ VATD+
Sbjct  295  FNQVVIFVKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRLCVATDV  354

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS DTYLHRVGRAGRFGTKGLAITF SS  DS +L+++QER
Sbjct  355  FGRGIDIERVNIVINYDMPDSPDTYLHRVGRAGRFGTKGLAITFASSDEDSQILDKIQER  414

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I ELP++ID S+YM
Sbjct  415  FEVNITELPDEIDVSSYM  432



>dbj|BAA13931.1| unnamed protein product [Schizosaccharomyces pombe]
Length=339

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KRI VATD+
Sbjct  200  FNQVVIFVKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRICVATDV  259

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITF SS  DS +L+++QER
Sbjct  260  FGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQER  319

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I ELP++ID  +YM
Sbjct  320  FEVNITELPDEIDVGSYM  337



>ref|XP_007509762.1| ATP-dependent RNA helicase DDX39 [Bathycoccus prasinos]
 emb|CCO18877.1| ATP-dependent RNA helicase DDX39 [Bathycoccus prasinos]
Length=429

 Score =   227 bits (578),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFV SV R   L+KL+ ECNFPSI I   MSQEERL RY+ FK+G+KRILVATDL
Sbjct  290  FNQVVIFVSSVARCTALDKLMQECNFPSIAISRAMSQEERLLRYQSFKDGNKRILVATDL  349

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            V RGIDIERVNIVINYDMP  ADTYLHRVGRAGRFGTKGLAI+FVSSS DSDVL++V ER
Sbjct  350  VARGIDIERVNIVINYDMPGDADTYLHRVGRAGRFGTKGLAISFVSSSEDSDVLSKVHER  409

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV I  LP++IDTS+YMPS
Sbjct  410  FEVSIDGLPDEIDTSSYMPS  429



>gb|EPX72634.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces octosporus 
yFS286]
Length=434

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KR+ VATD+
Sbjct  295  FNQVVIFVKSVSRANELDRLLRECNFPSICIHGGLPQEERINRYKAFKDFDKRLCVATDV  354

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS DTYLHRVGRAGRFGTKGLAITF  S  DS +L+++QER
Sbjct  355  FGRGIDIERVNIVINYDMPDSPDTYLHRVGRAGRFGTKGLAITFAGSDEDSQILDKIQER  414

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I ELP++ID S+YM
Sbjct  415  FEVNITELPDEIDVSSYM  432



>ref|XP_002949774.1| hypothetical protein VOLCADRAFT_80795 [Volvox carteri f. nagariensis]
 gb|EFJ49326.1| hypothetical protein VOLCADRAFT_80795 [Volvox carteri f. nagariensis]
Length=435

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 121/151 (80%), Gaps = 13/151 (9%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA  LN+LL ECNFPS+CI+ GM QEER+  YK FKEG  RILVATDL
Sbjct  282  FNQVVIFVKSVARAKMLNQLLNECNFPSVCIYGGMEQEERIKVYKNFKEGKHRILVATDL  341

Query  476  VGRGIDIERVNIVINYDMPDS-------------ADTYLHRVGRAGRFGTKGLAITFVSS  336
            VGRGIDIERVNIVINYDMP+S             ADTYLHRVGRAGRFGTKGLAITFVSS
Sbjct  342  VGRGIDIERVNIVINYDMPESDDKAKGESKHGNGADTYLHRVGRAGRFGTKGLAITFVSS  401

Query  335  SSDSDVLNQVQERFEVDIKELPEQIDTSTYM  243
              DS VLN VQ+RF+VDIK LPE+ID STYM
Sbjct  402  QEDSAVLNAVQDRFDVDIKPLPEKIDASTYM  432



>emb|CDJ45114.1| hypothetical protein ETH_00023440 [Eimeria tenella]
 emb|CDJ64711.1| ATP-dependent RNA helicase, putative [Eimeria necatrix]
Length=202

 Score =   218 bits (556),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV+IFVKSV+RA  LNKLL ECNFPSI IH+G+ QEER+ RY+ FK   KRI+VATDL
Sbjct  63   FNQVIIFVKSVSRAQALNKLLTECNFPSIAIHAGLDQEERINRYQQFKNFEKRIMVATDL  122

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIV+NYDMP+S+D+YLHRVGRAGRFGTKGLA+TFV+S  D++VLN VQ R
Sbjct  123  FGRGIDIERVNIVVNYDMPESSDSYLHRVGRAGRFGTKGLAVTFVASQEDTNVLNDVQTR  182

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV I E+P  ID S Y+
Sbjct  183  FEVHIPEMPATIDASQYI  200



>gb|ACF86701.1| unknown [Zea mays]
Length=106

 Score =   215 bits (547),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/106 (97%), Positives = 105/106 (99%), Gaps = 0/106 (0%)
 Frame = -3

Query  554  MSQEERLTRYKGFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR  375
            M+QEERLTRYK FKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR
Sbjct  1    MTQEERLTRYKNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADTYLHRVGRAGR  60

Query  374  FGTKGLAITFVSSSSDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  237
            FGTKGLAITFVSS+SDSDVLNQVQERFEVDIKELPEQIDTSTYMPS
Sbjct  61   FGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS  106



>ref|XP_006675142.1| hypothetical protein BATDEDRAFT_15696 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83557.1| hypothetical protein BATDEDRAFT_15696 [Batrachochytrium dendrobatidis 
JAM81]
Length=443

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFVKSV RA EL++LLV+C FPSICIHS + QEER+ RYK FK+  KRI+VATD+
Sbjct  304  FNQVCIFVKSVQRAVELDRLLVKCGFPSICIHSQLQQEERIARYKSFKDFEKRIMVATDI  363

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIVINYDM DS D YLHRVGRAGRFGTKGLAITFVSS  D++VLNQVQ R
Sbjct  364  FGRGIDVERVNIVINYDMSDSPDAYLHRVGRAGRFGTKGLAITFVSSDEDTEVLNQVQGR  423

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELPE ID STYM S
Sbjct  424  FEVNITELPETIDVSTYMAS  443



>emb|CEG02049.1| Helicase, C-terminal [Ostreococcus tauri]
Length=486

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFV SV+R   L++LL ECNFPSI IH  M QEERL  YK FK+G KRILVATDL
Sbjct  347  FNQVVIFVSSVSRCKALDRLLRECNFPSIGIHGDMKQEERLACYKSFKDGDKRILVATDL  406

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            V RGIDIERVNIVINYDMP SADTYLHRVGRAGRFGTKGLA+TFV+SS D+DVL  V ER
Sbjct  407  VARGIDIERVNIVINYDMPSSADTYLHRVGRAGRFGTKGLAVTFVASSEDTDVLASVHER  466

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV I+ELP++ID STYMPS
Sbjct  467  FEVKIEELPDEIDQSTYMPS  486



>ref|NP_594261.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces pombe 972h-]
 sp|O13792.3|SUB2_SCHPO RecName: Full=ATP-dependent RNA helicase uap56 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB16225.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces pombe]
Length=434

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA EL++LL ECNFPSICIH G+ QEER+ RYK FK+  KRI VATD+
Sbjct  295  FNQVVIFVKSVSRANELDRLLRECNFPSICIHGGLPQEERIKRYKAFKDFDKRICVATDV  354

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITF SS  DS +L+++QER
Sbjct  355  FGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFSSSEEDSQILDKIQER  414

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I ELP++ID  +YM
Sbjct  415  FEVNITELPDEIDVGSYM  432



>gb|EIE79315.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=434

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+
Sbjct  295  FNQVCIFVRSVSRANELNRILSDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDI  354

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  355  FGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTQVLNDVQSR  414

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE ID +TYM S
Sbjct  415  FEVNISPLPEDIDINTYMTS  434



>gb|EPB87931.1| ATP-dependent RNA helicase uap56 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=437

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+
Sbjct  298  FNQVCIFVRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDI  357

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ R
Sbjct  358  FGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSR  417

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE++D +TYM S
Sbjct  418  FEVNISPLPEEVDLNTYMTS  437



>emb|CDO70925.1| hypothetical protein BN946_scf184829.g33 [Trametes cinnabarina]
Length=202

 Score =   217 bits (553),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA EL+KLLV CNFPSI IHSG++QEER++RY  FK   KRILVATD+
Sbjct  63   FNQVVIFVKSVARAIELDKLLVSCNFPSIAIHSGLAQEERISRYTAFKAFEKRILVATDI  122

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIVINYD P  AD+YLHRVGRAGRFGTKGLAITFVSS SD  V+  +Q R
Sbjct  123  FGRGIDVERVNIVINYDCPPDADSYLHRVGRAGRFGTKGLAITFVSSESDQQVMAAIQSR  182

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + ELP+ ID ++YM S
Sbjct  183  FEVAVPELPDHIDPASYMTS  202



>emb|CEP12723.1| hypothetical protein [Parasitella parasitica]
Length=437

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+
Sbjct  298  FNQVCIFVRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDI  357

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ R
Sbjct  358  FGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSR  417

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE++D +TYM S
Sbjct  418  FEVNISPLPEEVDLNTYMTS  437



>ref|XP_001703776.1| subunit of exon junction complex [Chlamydomonas reinhardtii]
 gb|EDO96302.1| subunit of exon junction complex [Chlamydomonas reinhardtii]
Length=435

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 120/151 (79%), Gaps = 13/151 (9%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA  LN LL ECNFPS+CI+ GM QEER+  YK FKEG  RILVATDL
Sbjct  282  FNQVVIFVKSVARAKMLNTLLNECNFPSVCIYGGMDQEERIKVYKHFKEGKHRILVATDL  341

Query  476  VGRGIDIERVNIVINYDMPDS-------------ADTYLHRVGRAGRFGTKGLAITFVSS  336
            VGRGIDIERVNIVINYDMP+S             ADTYLHRVGRAGRFGTKGLAITFVSS
Sbjct  342  VGRGIDIERVNIVINYDMPESDDKSKGESKHGNGADTYLHRVGRAGRFGTKGLAITFVSS  401

Query  335  SSDSDVLNQVQERFEVDIKELPEQIDTSTYM  243
              DS VLN VQ+RF+VDIK LPE+ID STYM
Sbjct  402  QEDSAVLNAVQDRFDVDIKPLPEKIDASTYM  432



>emb|CEL52175.1| ATP-dependent RNA helicase UAP56/SUB2 [Rhizoctonia solani AG-1 
IB]
Length=433

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSVTRA ELNKLL  CNFPSICIHSG++QEER+ RY+ FK   KRILVATD+
Sbjct  294  FNQVVIFVKSVTRANELNKLLNTCNFPSICIHSGLNQEERINRYQSFKNFEKRILVATDI  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIV+NYD P  AD+YLHRVGRAGRFGTKGLAITFVSS +D++VL Q+Q R
Sbjct  354  FGRGIDVERVNIVVNYDAPSEADSYLHRVGRAGRFGTKGLAITFVSSPADTEVLQQIQGR  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + +LP+ ID STYM S
Sbjct  414  FEVKVTDLPDTIDPSTYMTS  433



>dbj|GAN02806.1| ATP-dependent RNA helicase Uap56 [Mucor ambiguus]
Length=437

 Score =   223 bits (569),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS MSQ+ER+ RYK FK+  KRI+VATD+
Sbjct  298  FNQVCIFVRSVSRANELNRILSDCNFPSICIHSQMSQDERIKRYKSFKDFEKRIMVATDI  357

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS   D+ VLN VQ R
Sbjct  358  FGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSDEKDTAVLNDVQSR  417

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE +D +TYM S
Sbjct  418  FEVNITPLPEDVDLNTYMTS  437



>gb|EUC67291.1| ATP-dependent RNA helicase uap56/SUB2, partial [Rhizoctonia solani 
AG-3 Rhs1AP]
 gb|KEP54716.1| ATP-dependent RNA helicase uap56/SUB2 [Rhizoctonia solani 123E]
Length=474

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA ELNKLL  CNFPSICIHSG+SQEER+ RY+ FK   KRILVATD+
Sbjct  335  FNQVVIFVKSVSRANELNKLLNTCNFPSICIHSGLSQEERINRYQSFKSFEKRILVATDI  394

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIV+NYD P  AD+YLHRVGRAGRFGTKGLAITFVSS +D++VL Q+Q R
Sbjct  395  FGRGIDVERVNIVVNYDAPSEADSYLHRVGRAGRFGTKGLAITFVSSPADTEVLQQIQGR  454

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + ELP+ ID STYM S
Sbjct  455  FEVKVTELPDTIDPSTYMTS  474



>gb|KJA29314.1| hypothetical protein HYPSUDRAFT_32712, partial [Hypholoma sublateritium 
FD-334 SS-4]
Length=220

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA EL+KLLV CNFPSI IHSG++QEER++RY  FK   KRILVATD+
Sbjct  81   FNQVVIFVKSVARAIELDKLLVSCNFPSISIHSGLTQEERISRYTAFKAFEKRILVATDI  140

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIVINYD P  AD+YLHRVGRAGRFGTKGLAITFVSS SD  V+  +Q R
Sbjct  141  FGRGIDVERVNIVINYDCPTDADSYLHRVGRAGRFGTKGLAITFVSSESDQQVMAAIQSR  200

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + ELP+ ID ++YM S
Sbjct  201  FEVAVPELPDAIDPASYMTS  220



>gb|EXX60912.1| Sub2p [Rhizophagus irregularis DAOM 197198w]
Length=433

 Score =   223 bits (569),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFVKSV RA ELNKLL +CNFPSICIH  M QEER+ +YK FK+  KRI+VATD+
Sbjct  294  FNQVCIFVKSVQRANELNKLLCDCNFPSICIHGAMKQEERIAKYKSFKDFQKRIMVATDV  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD  DTYLHRVGRAGRFGTKGLAITFV++  D+D LN+VQER
Sbjct  354  FGRGIDIERVNIVINYDMPDGPDTYLHRVGRAGRFGTKGLAITFVANQEDADTLNKVQER  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELP +++ + YM S
Sbjct  414  FEVNITELPTELEINDYMAS  433



>gb|EIE91029.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=433

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+
Sbjct  294  FNQVCIFVRSVSRANELNRILTDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDI  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  354  FGRGIDIERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTQVLNDVQSR  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE ID +TYM S
Sbjct  414  FEVNISPLPEDIDINTYMTS  433



>gb|EIE84435.1| ATP-dependent RNA helicase uap56 [Rhizopus delemar RA 99-880]
Length=435

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV+RA ELN++L +CNFPSICIHS M+Q+ER+ RYK FKE  KRI+VATD+
Sbjct  296  FNQVCIFVRSVSRANELNRILSDCNFPSICIHSQMTQDERIKRYKSFKEFEKRIMVATDI  355

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D++VLN VQ R
Sbjct  356  FGRGIDIERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTEVLNDVQSR  415

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE ID +TYM S
Sbjct  416  FEVNISPLPEDIDINTYMTS  435



>ref|XP_005710441.1| Putative ATP-dependent RNA helicase, Uap56 [Chondrus crispus]
 emb|CDF40147.1| Putative ATP-dependent RNA helicase, Uap56 [Chondrus crispus]
Length=430

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLL+ECNFPSI IHSG+ QEER+ RYK FK+  KRILVATD+
Sbjct  291  FNQVVIFVKSVPRAIELNKLLIECNFPSIDIHSGIRQEERIKRYKAFKDFQKRILVATDI  350

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMP S D+YLHRVGRAGRFGTKGLAI+FVSS  DS+VL  VQ R
Sbjct  351  FGRGIDIERVNIVINYDMPSSPDSYLHRVGRAGRFGTKGLAISFVSSEPDSEVLQGVQSR  410

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV I ELP ++D ++YM
Sbjct  411  FEVAISELPNEVDQASYM  428



>dbj|GAC71428.1| ATP-dependent RNA helicase [Pseudozyma antarctica T-34]
Length=184

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV+IFVKS++RA EL+KLL ECNFPSICIH G++QEER+ RY+ FK   KRILVATD+
Sbjct  45   FNQVIIFVKSISRANELDKLLRECNFPSICIHGGLAQEERIKRYQQFKNFEKRILVATDI  104

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVN+ I+YD P  AD+YLHRVGRAGRFGTKGLAI FVSS  D++VL Q+Q R
Sbjct  105  FGRGIDVERVNVSISYDTPTDADSYLHRVGRAGRFGTKGLAIMFVSSDEDAEVLKQIQSR  164

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + ELPE I+ STYM +
Sbjct  165  FEVAVPELPETIEASTYMSA  184



>emb|CEI88988.1| Putative ATP-dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+
Sbjct  296  FNQVCIFVRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDI  355

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  356  FGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSR  415

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE +D + YM S
Sbjct  416  FEVNIAPLPEDVDINAYMTS  435



>ref|XP_007336576.1| P-loop containing nucleoside triphosphate hydrolase protein [Auricularia 
delicata TFB-10046 SS5]
 gb|EJD55246.1| P-loop containing nucleoside triphosphate hydrolase protein [Auricularia 
delicata TFB-10046 SS5]
Length=440

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA EL+KLL EC+FPSICIHSG+ QEER+TRY+ FK   KRILVATD+
Sbjct  301  FNQVVIFVKSVARANELDKLLKECHFPSICIHSGLPQEERITRYQQFKSFEKRILVATDI  360

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGID+ERVNIV+NYD P  AD+YLHRVGRAGRFGTKGLAITF+SS +D DV+NQ+Q R
Sbjct  361  FGRGIDVERVNIVVNYDCPGDADSYLHRVGRAGRFGTKGLAITFISSETDQDVMNQIQSR  420

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV + ELP  ID  +YM S
Sbjct  421  FEVAVSELPAHIDPKSYMTS  440



>ref|XP_002141999.1| ATP-dependent RNA helicae DDX39 [Cryptosporidium muris RN66]
 gb|EEA07650.1| ATP-dependent RNA helicae DDX39, putative [Cryptosporidium muris 
RN66]
Length=427

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV+IFVKSV+RA  L+ LL EC+FPSICIH+G+SQ+ER++RY+ FK   KRI+VATDL
Sbjct  288  FNQVIIFVKSVSRAQALHNLLTECSFPSICIHAGLSQQERISRYQQFKNFEKRIMVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMP++ D+YLHRVGRAGRFGTKGLAIT V+S +DS +LN VQ R
Sbjct  348  FGRGIDIERVNIVINYDMPENTDSYLHRVGRAGRFGTKGLAITLVASQTDSQILNDVQSR  407

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I E+P QIDTSTY+
Sbjct  408  FEVNIAEMPSQIDTSTYI  425



>ref|XP_002175680.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB09387.1| ATP-dependent RNA helicase Uap56 [Schizosaccharomyces japonicus 
yFS275]
Length=434

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV+RA  L++LL EC+FPSICIH G+ Q+ER+ RYK FK+  KRI VATD+
Sbjct  295  FNQVVIFVKSVSRANALDRLLRECSFPSICIHGGLPQDERIKRYKAFKDFDKRICVATDV  354

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS D+YLHRVGRAGRFGTKGLAITFV++  DS VL+++QER
Sbjct  355  FGRGIDIERVNIVINYDMPDSPDSYLHRVGRAGRFGTKGLAITFVTTDEDSQVLDKIQER  414

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I ELP++ID S+YM
Sbjct  415  FEVNITELPDEIDVSSYM  432



>emb|CDS12473.1| Putative ATP-dependent RNA helicase uap56 [Absidia idahoensis 
var. thermophila]
Length=442

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L  CNFPSICIHS M+QEER+ RYK FK+  KRI+VATD+
Sbjct  303  FNQVCIFVRSVPRAIELNRILTSCNFPSICIHSQMTQEERIKRYKSFKDFEKRIMVATDI  362

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ R
Sbjct  363  FGRGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSR  422

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE++I  LPE +D +TYM +
Sbjct  423  FEINITPLPEDVDVNTYMAA  442



>emb|CEG73345.1| Putative ATP-dependent RNA helicase SUB2 [Rhizopus microsporus]
Length=346

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+
Sbjct  207  FNQVCIFVRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDI  266

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  267  FGRGIDIERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSR  326

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE  D + YM S
Sbjct  327  FEVNIAPLPEDADINAYMTS  346



>ref|XP_668053.1| helicase [Cryptosporidium hominis TU502]
Length=427

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV+IFVKSV+RA  L+KLL EC+FPSICIH+ +SQ+ER++RY+ FK   KRI+VATDL
Sbjct  288  FNQVIIFVKSVSRAQALHKLLTECSFPSICIHAALSQQERISRYQQFKNFEKRIMVATDL  347

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMP++ D+YLHRVGRAGRFGTKGLAIT VSS +DS VLN VQ R
Sbjct  348  FGRGIDIERVNIVINYDMPENTDSYLHRVGRAGRFGTKGLAITMVSSQTDSQVLNDVQSR  407

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I E+P QIDTS+Y+
Sbjct  408  FEVNIAEMPNQIDTSSYI  425



>ref|XP_627282.1| Sub2p like superfamily II helicase involved in snRNP biogenesis 
[Cryptosporidium parvum Iowa II]
 gb|EAK89721.1| Sub2p like superfamily II helicase involved in snRNP biogenesis 
[Cryptosporidium parvum Iowa II]
Length=430

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV+IFVKSV+RA  L+KLL EC+FPSICIH+ +SQ+ER++RY+ FK   KRI+VATDL
Sbjct  291  FNQVIIFVKSVSRAQALHKLLTECSFPSICIHAALSQQERISRYQQFKNFEKRIMVATDL  350

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMP++ D+YLHRVGRAGRFGTKGLAIT VSS +DS VLN VQ R
Sbjct  351  FGRGIDIERVNIVINYDMPENTDSYLHRVGRAGRFGTKGLAITMVSSQTDSQVLNDVQSR  410

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV+I E+P QIDTS+Y+
Sbjct  411  FEVNIAEMPNQIDTSSYI  428



>ref|XP_007872375.1| hypothetical protein PNEG_00489 [Pneumocystis murina B123]
 gb|EMR11474.1| hypothetical protein PNEG_00489 [Pneumocystis murina B123]
Length=432

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKS+ RA+EL++LL ECNFPSICIH G+ QE+R+ RYK FK+ +KRI VATD+
Sbjct  293  FNQVVIFVKSIQRASELDRLLRECNFPSICIHGGLPQEDRIARYKSFKDFNKRICVATDV  352

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVN+V NYD P  ADTYLHRVGRAGRFGT+GL+ITFVSSS+D+++L+++QER
Sbjct  353  FGRGIDIERVNVVFNYDTPADADTYLHRVGRAGRFGTRGLSITFVSSSTDAEILDKIQER  412

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELPE ID S+YM S
Sbjct  413  FEVNITELPEHIDVSSYMNS  432



>emb|CEI95093.1| Putative ATP dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+
Sbjct  296  FNQVCIFVRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDI  355

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  356  FGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSR  415

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE  D + YM S
Sbjct  416  FEVNIAPLPEDADINAYMTS  435



>emb|CDH58367.1| atp-dependent rna helicase uap56 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=442

 Score =   221 bits (562),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L  CNFPSICIHS M+QEER+ RYK FK+  KRI+VATD+
Sbjct  303  FNQVCIFVRSVPRAIELNRILTSCNFPSICIHSQMTQEERIKRYKSFKDFEKRIMVATDI  362

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD ADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ R
Sbjct  363  FGRGIDIERVNIVINYDMPDGADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSR  422

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE++I  LPE +D ++YM +
Sbjct  423  FEINITPLPEDVDVNSYMAA  442



>gb|KDD77120.1| DEAD/DEAH box helicase [Helicosporidium sp. ATCC 50920]
Length=426

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 122/145 (84%), Gaps = 7/145 (5%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELN+LL +CNFPS  I+S M Q+ERL  YK FKEG KRILVATDL
Sbjct  279  FNQVVIFVKSVPRAKELNRLLNDCNFPSTSINSAMKQDERLKVYKEFKEGQKRILVATDL  338

Query  476  VGRGIDIERVNIVINYDMPDS-------ADTYLHRVGRAGRFGTKGLAITFVSSSSDSDV  318
            VGRGID+ERVNIVINYDMP++       ADTYLHRVGRAGRFGTKGLA+TFV+S+ DS+V
Sbjct  339  VGRGIDVERVNIVINYDMPETDEKHGNGADTYLHRVGRAGRFGTKGLAVTFVASTKDSEV  398

Query  317  LNQVQERFEVDIKELPEQIDTSTYM  243
            LNQVQERF+V+IK LP+ I+ S YM
Sbjct  399  LNQVQERFDVEIKPLPQTIEASAYM  423



>gb|KFH69832.1| ATP-dependent RNA helicase SUB2 [Mortierella verticillata NRRL 
6337]
Length=432

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFVKSV+RA ELNKLLVECNFPSICIHS M+Q+ER+ R+K FKE +KRILVATD+
Sbjct  293  FNQVCIFVKSVSRANELNKLLVECNFPSICIHSQMAQDERIARFKSFKEFNKRILVATDV  352

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
              RG+D+ RVN+VINYD+P+ ADTYLHRVGRAGRFGTKGLAITFV+  SD +VL  +Q R
Sbjct  353  FARGVDVSRVNVVINYDVPEVADTYLHRVGRAGRFGTKGLAITFVTDDSDKEVLKTIQAR  412

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV I ELP++ID +TYM +
Sbjct  413  FEVQISELPDEIDVTTYMTA  432



>emb|CDS11016.1| Putative ATP-dependent RNA helicase uap56 [Absidia idahoensis 
var. thermophila]
Length=445

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA EL+++L  CNFPS+CIHS MSQE+R+ RYK FK+  KRI+VATD+
Sbjct  306  FNQVCIFVRSVPRARELDRILTSCNFPSVCIHSQMSQEDRIKRYKSFKDFEKRIMVATDI  365

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ R
Sbjct  366  FGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSR  425

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE++I+ LPE +D ++YM +
Sbjct  426  FEINIQPLPEDVDVNSYMAA  445



>emb|CDH51210.1| atp-dependent rna helicase uap56 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=446

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA EL+++L  CNFPS+CIHS MSQE+R+ RYK FK+  KRI+VATD+
Sbjct  307  FNQVCIFVRSVPRARELDRILTSCNFPSVCIHSQMSQEDRIKRYKSFKDFEKRIMVATDI  366

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGL ITFVS+  D++VLN VQ R
Sbjct  367  FGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLGITFVSNEKDTEVLNDVQSR  426

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FE++I+ LPE +D ++YM +
Sbjct  427  FEINIQPLPEDVDVNSYMAA  446



>gb|EPZ34119.1| Glycine cleavage system P protein, homodimeric domain-containing 
protein [Rozella allomycis CSF55]
Length=1389

 Score =   230 bits (586),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA EL+KLLVECNFPSICIH  + QEER++RY+ FK+  KRI+V TD+
Sbjct  289  FNQVVIFVKSVARANELDKLLVECNFPSICIHGSLPQEERISRYQTFKDFKKRIMVCTDI  348

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGLA+TFVSS+ DS +LNQVQER
Sbjct  349  FGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLAVTFVSSAEDSQILNQVQER  408

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELP++ID ++Y  S
Sbjct  409  FEVNITELPDKIDVNSYSTS  428



>emb|CEI95092.1| Putative ATP-dependent RNA helicase SUB2 [Rhizopus microsporus]
Length=494

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+
Sbjct  355  FNQVCIFVRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDI  414

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDSAD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  415  FGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSR  474

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE  D + YM S
Sbjct  475  FEVNIAPLPEDADINAYMTS  494



>ref|XP_004364885.1| nuclear RNA helicase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE88351.1| nuclear RNA helicase [Capsaspora owczarzaki ATCC 30864]
Length=433

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA EL KLLVECNFP+I IHS M Q+ER+ RY+ FK    RILVATDL
Sbjct  294  FNQVVIFVKSVNRAKELTKLLVECNFPAIAIHSAMPQDERIQRYQNFKNFQSRILVATDL  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPDS+D+YLHRV RAGRFGTKGLA+TFVSS  D+ +L+QVQ R
Sbjct  354  FGRGIDIERVNIVINYDMPDSSDSYLHRVARAGRFGTKGLAVTFVSSEEDATILSQVQSR  413

Query  296  FEVDIKELPEQIDTSTYM  243
            FEV I  LPE ID ++YM
Sbjct  414  FEVQIDALPETIDMTSYM  431



>emb|CEG73344.1| Putative ATP dependent RNA helicase [Rhizopus microsporus]
Length=435

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFV+SV RA ELN++L +CNFPSICIHS M+QEER+ RY+ FKE  KRI+VATD+
Sbjct  296  FNQVCIFVRSVARANELNRILTDCNFPSICIHSHMTQEERIKRYRSFKEFEKRIMVATDI  355

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD AD+YLHRVGRAGRFGTKGL ITFVS  +D+ VLN VQ R
Sbjct  356  FGRGIDIERVNIVINYDMPDGADSYLHRVGRAGRFGTKGLGITFVSDENDTKVLNDVQSR  415

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I  LPE  D + YM S
Sbjct  416  FEVNIAPLPEDADINAYMTS  435



>gb|ESA07313.1| hypothetical protein GLOINDRAFT_349525 [Rhizophagus irregularis 
DAOM 181602]
Length=433

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQV IFVKSV RA ELNKLL +CNFPSICIH  M QEER+ +YK FK+  KRI+VATD+
Sbjct  294  FNQVCIFVKSVQRANELNKLLCDCNFPSICIHGAMKQEERIAKYKSFKDFQKRIMVATDV  353

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
             GRGIDIERVNIVINYDMPD  DTYL +VGRAGRFGTKGLAITFV++  D+D LN+VQER
Sbjct  354  FGRGIDIERVNIVINYDMPDGPDTYLQKVGRAGRFGTKGLAITFVANQEDADTLNKVQER  413

Query  296  FEVDIKELPEQIDTSTYMPS  237
            FEV+I ELP +++ + YM S
Sbjct  414  FEVNITELPTELEINDYMAS  433



>emb|CDY56825.1| BnaC05g37790D [Brassica napus]
Length=228

 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  656  FNQVVIFVKSVTRAAELNKLLVECNFPSICIHSGMSQEERLTRYKGFKEGHKRILVATDL  477
            FNQVVIFVKSV RA ELNKLL+ECNFPSIC HSGMS E+RLT YK FKEGHKRILVATDL
Sbjct  76   FNQVVIFVKSVNRAGELNKLLIECNFPSICFHSGMSHEKRLTHYKSFKEGHKRILVATDL  135

Query  476  VGRGIDIERVNIVINYDMPDSADTYLHRVGRAGRFGTKGLAITFVSSSSDSDVLNQVQER  297
            VGRGIDIERVNIVINYD+PDSADTYLHRVGRAGRFGTKGLAITFV+S SDS+ +   Q  
Sbjct  136  VGRGIDIERVNIVINYDIPDSADTYLHRVGRAGRFGTKGLAITFVASGSDSEFMCMSQNF  195

Query  296  F  294
            F
Sbjct  196  F  196



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500