BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032P16

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAN61591.1|  hypothetical protein VITISV_030553                     324   1e-102   Vitis vinifera
emb|CDP15242.1|  unnamed protein product                                322   5e-102   Coffea canephora [robusta coffee]
gb|ABK94876.1|  unknown                                                 311   6e-102   Populus trichocarpa [western balsam poplar]
ref|XP_007163318.1|  hypothetical protein PHAVU_001G2247000g            308   1e-99    Phaseolus vulgaris [French bean]
emb|CBI39607.3|  unnamed protein product                                323   1e-99    Vitis vinifera
ref|XP_009609093.1|  PREDICTED: NHL repeat-containing protein 2 i...    323   4e-99    Nicotiana tomentosiformis
ref|XP_010313619.1|  PREDICTED: NHL repeat-containing protein 2 i...    321   5e-99    Solanum lycopersicum
ref|XP_007031176.1|  Haloacid dehalogenase-like hydrolase family ...    323   6e-99    
ref|XP_002277564.2|  PREDICTED: NHL repeat-containing protein 2         323   6e-99    Vitis vinifera
ref|XP_010313614.1|  PREDICTED: NHL repeat-containing protein 2 i...    321   6e-99    Solanum lycopersicum
ref|XP_009383937.1|  PREDICTED: putative uncharacterized hydrolas...    302   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO81648.1|  hypothetical protein CISIN_1g001380mg                   322   3e-98    Citrus sinensis [apfelsine]
ref|XP_009790946.1|  PREDICTED: NHL repeat-containing protein 2         321   4e-98    Nicotiana sylvestris
ref|XP_004230317.1|  PREDICTED: NHL repeat-containing protein 2 i...    321   4e-98    Solanum lycopersicum
gb|AAM65709.1|  unknown                                                 301   6e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010313598.1|  PREDICTED: NHL repeat-containing protein 2 i...    321   6e-98    Solanum lycopersicum
ref|XP_006344777.1|  PREDICTED: NHL repeat-containing protein 2-l...    322   1e-97    Solanum tuberosum [potatoes]
ref|XP_006472221.1|  PREDICTED: NHL repeat-containing protein 2-like    320   1e-97    Citrus sinensis [apfelsine]
ref|XP_006344776.1|  PREDICTED: NHL repeat-containing protein 2-l...    322   1e-97    Solanum tuberosum [potatoes]
ref|XP_002512523.1|  2-deoxyglucose-6-phosphate phosphatase, puta...    318   1e-97    
dbj|BAF00734.1|  hypothetical protein                                   299   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011023797.1|  PREDICTED: NHL repeat-containing protein 2 i...    316   2e-97    Populus euphratica
ref|XP_004494944.1|  PREDICTED: NHL repeat-containing protein 2-like    318   3e-97    
gb|KCW60570.1|  hypothetical protein EUGRSUZ_H03302                     316   3e-97    Eucalyptus grandis [rose gum]
ref|XP_011092161.1|  PREDICTED: NHL repeat-containing protein 2         318   5e-97    Sesamum indicum [beniseed]
gb|KDP23397.1|  hypothetical protein JCGZ_23230                         318   6e-97    Jatropha curcas
gb|KHG03125.1|  putative YhcW                                           301   3e-96    Gossypium arboreum [tree cotton]
ref|XP_011023795.1|  PREDICTED: NHL repeat-containing protein 2 i...    316   3e-96    Populus euphratica
ref|XP_011023796.1|  PREDICTED: NHL repeat-containing protein 2 i...    316   4e-96    Populus euphratica
ref|XP_010549436.1|  PREDICTED: NHL repeat-containing protein 2-like    315   5e-96    Tarenaya hassleriana [spider flower]
ref|XP_010024139.1|  PREDICTED: NHL repeat-containing protein 2         315   5e-96    Eucalyptus grandis [rose gum]
ref|XP_006604788.1|  PREDICTED: NHL repeat-containing protein 2-like    314   1e-95    Glycine max [soybeans]
gb|KHN43348.1|  NHL repeat-containing protein 2                         314   1e-95    Glycine soja [wild soybean]
ref|XP_010674631.1|  PREDICTED: NHL repeat-containing protein 2         314   2e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002319481.1|  haloacid dehalogenase-like hydrolase family ...    311   1e-94    
ref|XP_007208118.1|  hypothetical protein PRUPE_ppa000671mg             311   1e-94    
gb|KEH24491.1|  haloacid dehalogenase-like hydrolase family protein     311   1e-94    Medicago truncatula
gb|KEH24490.1|  haloacid dehalogenase-like hydrolase family protein     311   2e-94    Medicago truncatula
ref|XP_008388470.1|  PREDICTED: NHL repeat-containing protein 2         311   2e-94    
ref|XP_004169165.1|  PREDICTED: NHL repeat-containing protein 2-like    307   4e-94    
ref|XP_010259235.1|  PREDICTED: NHL repeat-containing protein 2 i...    310   5e-94    Nelumbo nucifera [Indian lotus]
ref|XP_009373299.1|  PREDICTED: NHL repeat-containing protein 2         310   5e-94    Pyrus x bretschneideri [bai li]
ref|XP_010259236.1|  PREDICTED: NHL repeat-containing protein 2 i...    309   7e-94    Nelumbo nucifera [Indian lotus]
ref|XP_008246083.1|  PREDICTED: NHL repeat-containing protein 2         310   7e-94    Prunus mume [ume]
ref|XP_010259234.1|  PREDICTED: NHL repeat-containing protein 2 i...    310   7e-94    Nelumbo nucifera [Indian lotus]
ref|XP_010259233.1|  PREDICTED: NHL repeat-containing protein 2 i...    310   8e-94    Nelumbo nucifera [Indian lotus]
tpg|DAA45052.1|  TPA: hypothetical protein ZEAMMB73_628261              291   3e-93    
ref|XP_004135754.1|  PREDICTED: NHL repeat-containing protein 2-like    308   4e-93    
gb|KGN65974.1|  hypothetical protein Csa_1G555590                       307   4e-93    Cucumis sativus [cucumbers]
ref|XP_002467968.1|  hypothetical protein SORBIDRAFT_01g037270          297   6e-93    
dbj|BAJ85249.1|  predicted protein                                      288   7e-93    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA45055.1|  TPA: hypothetical protein ZEAMMB73_628261              291   1e-92    
ref|XP_006841624.1|  hypothetical protein AMTR_s00003p00225260          306   1e-92    
tpg|DAA45053.1|  TPA: hypothetical protein ZEAMMB73_628261              291   1e-92    
ref|XP_008450538.1|  PREDICTED: NHL repeat-containing protein 2         306   1e-92    Cucumis melo [Oriental melon]
ref|XP_006301486.1|  hypothetical protein CARUB_v10021909mg             305   2e-92    Capsella rubella
gb|KJB81121.1|  hypothetical protein B456_013G130100                    305   3e-92    Gossypium raimondii
tpg|DAA45054.1|  TPA: hypothetical protein ZEAMMB73_628261              291   3e-92    
emb|CDY41708.1|  BnaA09g15360D                                          304   4e-92    Brassica napus [oilseed rape]
gb|EPS73091.1|  hypothetical protein M569_01658                         296   8e-92    Genlisea aurea
ref|NP_001146693.1|  uncharacterized protein LOC100280294               289   2e-91    
emb|CDX95268.1|  BnaC09g16020D                                          303   2e-91    
ref|XP_009113385.1|  PREDICTED: NHL repeat-containing protein 2 i...    303   2e-91    Brassica rapa
ref|XP_009113384.1|  PREDICTED: NHL repeat-containing protein 2 i...    303   2e-91    Brassica rapa
ref|XP_009384439.1|  PREDICTED: NHL repeat-containing protein 2         303   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649977.1|  PREDICTED: NHL repeat-containing protein 2-like    303   3e-91    
gb|KFK22541.1|  hypothetical protein AALP_AAs68488U000300               301   5e-91    Arabis alpina [alpine rockcress]
ref|XP_006392420.1|  hypothetical protein EUTSA_v10023228mg             301   1e-90    
ref|XP_002891968.1|  hypothetical protein ARALYDRAFT_892829             300   1e-90    Arabidopsis lyrata subsp. lyrata
gb|AAG51506.1|AC058785_9  hypothetical protein                          298   5e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_564718.2|  protein SUPPRESSOR OF QUENCHING 1                     298   6e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CCD74491.1|  haloacid dehalogenase-like hydrolase domain-cont...    298   9e-90    Arabidopsis halleri subsp. halleri
ref|XP_004984596.1|  PREDICTED: NHL repeat-containing protein 2-l...    298   1e-89    Setaria italica
ref|XP_010938229.1|  PREDICTED: LOW QUALITY PROTEIN: NHL repeat-c...    298   1e-89    Elaeis guineensis
ref|XP_011466179.1|  PREDICTED: LOW QUALITY PROTEIN: NHL repeat-c...    297   2e-89    Fragaria vesca subsp. vesca
ref|XP_010228705.1|  PREDICTED: NHL repeat-containing protein 2 i...    295   3e-89    
gb|EYU38416.1|  hypothetical protein MIMGU_mgv1a000526mg                296   4e-89    Erythranthe guttata [common monkey flower]
ref|XP_008808704.1|  PREDICTED: NHL repeat-containing protein 2 i...    296   5e-89    Phoenix dactylifera
ref|XP_008808706.1|  PREDICTED: NHL repeat-containing protein 2 i...    296   5e-89    
ref|XP_008808703.1|  PREDICTED: NHL repeat-containing protein 2 i...    296   5e-89    Phoenix dactylifera
ref|XP_008808705.1|  PREDICTED: NHL repeat-containing protein 2 i...    296   7e-89    Phoenix dactylifera
gb|ABF95582.1|  HAD-superfamily hydrolase, subfamily IA, variant ...    290   1e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228703.1|  PREDICTED: NHL repeat-containing protein 2 i...    295   2e-88    Brachypodium distachyon [annual false brome]
ref|XP_010228704.1|  PREDICTED: NHL repeat-containing protein 2 i...    295   2e-88    Brachypodium distachyon [annual false brome]
ref|XP_010480258.1|  PREDICTED: NHL repeat-containing protein 2-like    294   3e-88    Camelina sativa [gold-of-pleasure]
ref|XP_010511290.1|  PREDICTED: NHL repeat-containing protein 2-l...    293   4e-88    
gb|EMS60685.1|  NHL repeat-containing protein 2                         295   5e-88    Triticum urartu
gb|ABF95581.1|  HAD-superfamily hydrolase, subfamily IA, variant ...    293   9e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010414996.1|  PREDICTED: NHL repeat-containing protein 2-like    292   1e-87    Camelina sativa [gold-of-pleasure]
gb|EEE58932.1|  hypothetical protein OsJ_10596                          288   2e-86    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73215.1|  hypothetical protein OsI_07299                          288   4e-86    Oryza sativa Indica Group [Indian rice]
dbj|BAH56807.1|  AT1G56500                                              258   5e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101865.1|  Protein CbbY                                       255   3e-80    
gb|KHN03928.1|  NHL repeat-containing protein 2                         253   7e-78    Glycine soja [wild soybean]
ref|XP_002974809.1|  hypothetical protein SELMODRAFT_101985             258   2e-75    
ref|XP_002963725.1|  hypothetical protein SELMODRAFT_79954              258   2e-75    
ref|XP_001766513.1|  predicted protein                                  237   2e-74    
ref|XP_001764907.1|  predicted protein                                  249   3e-72    
ref|XP_010313611.1|  PREDICTED: NHL repeat-containing protein 2 i...    238   2e-68    
ref|XP_006577734.1|  PREDICTED: uncharacterized protein LOC102664458    199   3e-58    
gb|ABR17375.1|  unknown                                                 188   4e-55    Picea sitchensis
ref|XP_005719288.1|  HAD-superfamily hydrolase                          183   7e-53    Chondrus crispus [carageen]
ref|XP_005846618.1|  hypothetical protein CHLNCDRAFT_31604              183   1e-48    Chlorella variabilis
ref|XP_005703482.1|  phosphoglycolate phosphatase                       171   3e-48    Galdieria sulphuraria
ref|WP_038153621.1|  hypothetical protein                               166   6e-47    
ref|XP_005646493.1|  hypothetical protein COCSUDRAFT_16964              174   2e-45    Coccomyxa subellipsoidea C-169
ref|XP_006382374.1|  hypothetical protein POPTR_0005s01550g             158   4e-44    
ref|XP_005539373.1|  unknown phosphatase CbbY                           155   2e-41    Cyanidioschyzon merolae strain 10D
ref|XP_010544161.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    149   2e-39    Tarenaya hassleriana [spider flower]
gb|KIY99936.1|  hypothetical protein MNEG_8025                          139   9e-37    Monoraphidium neglectum
ref|WP_043922596.1|  hypothetical protein                               130   3e-33    
gb|AEF83038.1|  HAD-superfamily hydrolase, subfamily IA, variant 3      130   5e-33    Treponema azotonutricium ZAS-9
ref|XP_009609094.1|  PREDICTED: NHL repeat-containing protein 2 i...    120   4e-27    
ref|XP_006433547.1|  hypothetical protein CICLE_v10000268mg             116   2e-25    
dbj|BAC43111.1|  unknown protein                                        104   2e-24    Arabidopsis thaliana [mouse-ear cress]
gb|EPF30951.1|  HAD hydrolase, family IA                                104   4e-23    Treponema maltophilum ATCC 51939
ref|WP_040846718.1|  hypothetical protein                               103   6e-23    
ref|WP_022295948.1|  hAD-superfamily hydrolase subfamily IA varia...  98.6    4e-21    
ref|WP_021932266.1|  hypothetical protein                             98.6    4e-21    
gb|KJF43458.1|  hypothetical protein LH29_14635                       98.2    6e-21    Draconibacterium sediminis
ref|XP_010511291.1|  PREDICTED: NHL repeat-containing protein 2-l...    100   3e-20    
ref|WP_020613875.1|  hypothetical protein                             95.1    1e-19    Sediminispirochaeta bajacaliforniensis
ref|WP_013254903.1|  HAD-superfamily hydrolase                        93.2    4e-19    Sediminispirochaeta smaragdinae
ref|WP_041381312.1|  haloacid dehalogenase                            92.4    7e-19    
gb|ADY13911.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    92.0    4e-18    Sphaerochaeta globosa str. Buddy
gb|AEV30491.1|  cytidine deaminase, homotetrameric                    91.3    7e-18    Sphaerochaeta pleomorpha str. Grapes
ref|WP_013560147.1|  putative hydrolase                               82.8    2e-15    Anaerolinea thermophila
ref|WP_033362865.1|  hypothetical protein                             82.0    2e-15    
ref|WP_018702023.1|  hypothetical protein                             81.6    4e-15    Anaeromusa acidaminophila
ref|WP_018611194.1|  hypothetical protein                             80.9    8e-15    Segetibacter koreensis
ref|WP_041395699.1|  hypothetical protein                             79.7    1e-14    
ref|WP_022026745.1|  hAD-superfamily hydrolase subfamily IA varia...  79.7    1e-14    
ref|WP_012258011.1|  MULTISPECIES: haloacid dehalogenase              79.7    2e-14    Chloroflexus aurantiacus
ref|WP_037412609.1|  hypothetical protein                             79.0    2e-14    
ref|WP_043097617.1|  hypothetical protein                             79.3    2e-14    
ref|WP_044374067.1|  hydrolase                                        79.3    2e-14    Streptomyces albulus
ref|WP_022824907.1|  ABC transporter ATP-binding protein              79.3    3e-14    Hymenobacter norwichensis
ref|WP_022790060.1|  phosphoglycolate phosphatase [                   79.0    3e-14    Faecalicoccus pleomorphus
gb|EEW97332.1|  HAD hydrolase, family IA, variant 3                   79.0    4e-14    Dialister invisus DSM 15470
ref|WP_040381412.1|  HAD family hydrolase                             78.6    4e-14    
ref|WP_014141627.1|  hydrolase                                        78.2    6e-14    Streptomyces cattleya
gb|AEC02302.1|  cytidine deaminase                                    79.3    6e-14    Sphaerochaeta coccoides DSM 17374
ref|WP_037632999.1|  hydrolase                                        77.4    1e-13    
ref|WP_022432576.1|  beta-phosphoglucomutase                          77.4    1e-13    
ref|WP_031511313.1|  hydrolase                                        77.4    1e-13    Streptomyces megasporus
gb|EOT03950.1|  hypothetical protein K530_11078                       77.4    1e-13    Streptomyces albulus CCRC 11814
ref|WP_005299899.1|  2-deoxyglucose-6-phosphatase                     76.6    2e-13    Photobacterium damselae
ref|WP_022587907.1|  phosphatase                                      76.6    2e-13    Caldanaerobacter subterraneus
ref|WP_015527821.1|  haloacid dehalogenase superfamily, subfamily...  76.6    2e-13    
ref|WP_037546502.1|  hypothetical protein                             76.6    2e-13    Spirochaeta lutea
ref|WP_043029511.1|  haloacid dehalogenase                            76.3    2e-13    
emb|CDC17671.1|  haloacid dehalogenase superfamily subfamily IA v...  76.6    2e-13    Ruminococcus sp. CAG:55
ref|WP_037578896.1|  haloacid dehalogenase                            76.3    3e-13    
ref|WP_021320537.1|  phosphoglycolate phosphatase                     75.9    3e-13    
ref|WP_003422738.1|  hydrolase                                        76.3    3e-13    Clostridioides difficile
ref|WP_022211901.1|  hAD-superfamily hydrolase subfamily IA varia...  75.9    4e-13    
ref|WP_026047523.1|  hydrolase                                        75.9    4e-13    Streptomyces sp. AA0539
ref|WP_021385882.1|  HAD hydrolase, IA, variant 1 family protein      75.5    4e-13    Clostridioides difficile
ref|WP_036626557.1|  beta-phosphoglucomutase                          75.5    4e-13    Paenibacillus
ref|WP_013381050.1|  phosphatase/phosphohexomutase                    75.5    4e-13    Clostridiales
ref|WP_027937809.1|  hydrolase                                        75.5    5e-13    Anaeroarcus burkinensis
ref|WP_022166346.1|  hAD-superfamily hydrolase subfamily IA varia...  75.1    5e-13    
ref|WP_042400469.1|  hydrolase                                        75.1    6e-13    Clostridium
ref|WP_044175857.1|  2-deoxyglucose-6-phosphatase                     75.1    7e-13    Photobacterium damselae
ref|WP_043038806.1|  haloacid dehalogenase                            74.7    7e-13    
ref|WP_044047407.1|  phosphatase                                      74.7    7e-13    Prevotella intermedia
ref|WP_044513700.1|  ABC transporter ATP-binding protein              74.7    8e-13    Hymenobacter sp. DG25B
gb|AFJ07831.1|  HAD hydrolase, family IA, variant 3                   74.7    8e-13    Prevotella intermedia 17
ref|WP_038674841.1|  haloacid dehalogenase                            74.7    8e-13    
gb|ACG62029.1|  phosphoglycolate phosphatase                          74.7    8e-13    Streptococcus equi subsp. zooepidemicus MGCS10565
ref|WP_031131983.1|  hydrolase                                        74.7    9e-13    Streptomyces
ref|WP_022105032.1|  hAD hydrolase family IA                          73.9    1e-12    
ref|WP_009610953.1|  phosphatase                                      74.3    1e-12    Caldanaerobacter subterraneus
ref|WP_015940279.1|  haloacid dehalogenase                            74.3    1e-12    Chloroflexus aggregans
ref|WP_042680670.1|  hypothetical protein                             73.9    1e-12    
ref|WP_028905267.1|  phosphatase                                      73.9    2e-12    Prevotella intermedia
ref|WP_012679218.1|  haloacid dehalogenase                            73.9    2e-12    
ref|WP_011957985.1|  haloacid dehalogenase                            73.9    2e-12    Roseiflexus sp. RS-1
ref|WP_030889858.1|  hydrolase                                        74.3    2e-12    Streptomyces sp. NRRL F-5053
ref|WP_022449833.1|  hAD-superfamily hydrolase subfamily IA varia...  73.9    2e-12    
ref|WP_028436013.1|  hydrolase                                        73.9    2e-12    Streptomyces sp. TAA486
ref|WP_043025540.1|  haloacid dehalogenase                            73.6    2e-12    
ref|WP_012678251.1|  haloacid dehalogenase                            73.6    2e-12    
ref|WP_026762227.1|  haloacid dehalogenase                            73.6    2e-12    Selenomonas artemidis
ref|WP_027890959.1|  haloacid dehalogenase                            73.6    2e-12    Meiothermus chliarophilus
ref|WP_027757414.1|  hydrolase                                        73.6    2e-12    Streptomyces sp. CNH099
gb|EQG55870.1|  HAD hydrolase, IA, variant 1 family protein           73.2    2e-12    Clostridioides difficile DA00145
ref|WP_022619260.1|  Putative hydrolase, HAD superfamily, IA subf...  73.6    3e-12    Clostridioides difficile
ref|WP_021376252.1|  HAD hydrolase, IA, variant 1 family protein      73.6    3e-12    Clostridioides difficile
ref|WP_030874787.1|  hydrolase                                        73.6    3e-12    Streptomyces
gb|ELQ83199.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    72.8    3e-12    Streptomyces rimosus subsp. rimosus ATCC 10970
ref|WP_041734454.1|  HAD family hydrolase                             73.2    3e-12    
gb|ABN52015.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    73.2    3e-12    Hungateiclostridium thermocellum ATCC 27405
ref|WP_009752830.1|  haloacid dehalogenase                            72.8    3e-12    Selenomonas sp. oral taxon 137
ref|WP_019393780.1|  MULTISPECIES: hypothetical protein               73.2    3e-12    Bacillus
ref|WP_020384906.1|  hypothetical protein                             72.8    3e-12    Kribbella catacumbae
ref|WP_037294841.1|  HAD family hydrolase                             73.2    3e-12    
ref|WP_004624246.1|  HAD-superfamily hydrolase [                      72.8    3e-12    Ruminiclostridium cellobioparum
ref|WP_013786947.1|  phosphatase                                      72.8    3e-12    Thermoanaerobacterium xylanolyticum
ref|WP_028458715.1|  haloacid dehalogenase                            73.2    4e-12    Chloroflexus sp. Y-396-1
gb|EEU02433.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    73.2    4e-12    Hungateiclostridium thermocellum DSM 2360
gb|KJF63674.1|  hydrolase                                             72.8    4e-12    Clostridioides difficile
ref|WP_032920597.1|  hydrolase                                        72.8    4e-12    Streptomyces rimosus
ref|WP_009658403.1|  haloacid dehalogenase                            72.8    4e-12    Selenomonas sp. FOBRC9
ref|WP_003426722.1|  hydrolase                                        72.8    4e-12    Clostridioides difficile
ref|WP_031458377.1|  haloacid dehalogenase                            72.8    4e-12    Chloroflexus sp. MS-G
ref|WP_041444645.1|  phosphatase                                      72.8    4e-12    Syntrophobotulus glycolicus
gb|ADY55297.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    72.8    4e-12    Syntrophobotulus glycolicus DSM 8271
ref|WP_030321939.1|  hydrolase                                        72.8    4e-12    Streptomyces sp. NRRL B-3229
ref|WP_030616031.1|  hydrolase                                        72.8    4e-12    Streptomyces fulvoviolaceus
ref|WP_030643153.1|  hydrolase                                        72.8    5e-12    Streptomyces rimosus
ref|WP_018385426.1|  hypothetical protein                             72.8    5e-12    Streptomyces vitaminophilus
ref|WP_038654139.1|  hypothetical protein                             72.4    5e-12    Mucinivorans hirudinis
ref|WP_019093269.1|  HAD family hydrolase                             72.8    5e-12    Pseudomonas fluorescens group
ref|WP_022214734.1|  hAD hydrolase family IA variant 3                72.4    5e-12    Blautia
ref|WP_030179613.1|  MULTISPECIES: hydrolase                          72.8    5e-12    Streptomycetaceae
ref|WP_007714331.1|  hydrolase [                                      72.4    5e-12    [Clostridium] asparagiforme
ref|WP_024884987.1|  hydrolase                                        72.4    5e-12    Streptomyces sp. CNH189
ref|WP_008976305.1|  HAD family hydrolase                             72.4    6e-12    Lachnospiraceae
ref|WP_024998184.1|  phosphatase                                      72.0    6e-12    Prevotella falsenii
gb|EPD65884.1|  HAD hydrolase, family IA                              72.0    6e-12    Coprococcus sp. HPP0048
ref|WP_030673163.1|  hydrolase                                        72.4    6e-12    Streptomyces sp. NRRL B-1347
ref|WP_027437140.1|  hypothetical protein                             72.4    6e-12    Lachnospira multipara
ref|WP_006417787.1|  HAD hydrolase, family IA, variant 3              72.0    7e-12    Eremococcus coleocola
ref|WP_019635430.1|  beta-phosphoglucomutase                          72.0    7e-12    Paenibacillus fonticola
ref|WP_023589956.1|  hydrolase                                        72.0    7e-12    Streptomyces thermolilacinus
ref|WP_037646448.1|  hydrolase                                        72.0    8e-12    
ref|WP_003175550.1|  HAD family hydrolase                             72.0    9e-12    Pseudomonas fluorescens
ref|WP_033265533.1|  hydrolase                                        72.0    9e-12    Streptomyces
gb|AIA90665.1|  CAZy families GH65 protein                            70.9    9e-12    uncultured Nostoc sp.
gb|EST59051.1|  2-deoxyglucose-6-phosphatase                          71.6    9e-12    Proteus hauseri ZMd44
ref|WP_021418251.1|  HAD hydrolase, IA, variant 1 family protein      71.6    1e-11    Clostridioides difficile
ref|WP_036913260.1|  2-deoxyglucose-6-phosphatase                     71.6    1e-11    Proteus
ref|WP_027630786.1|  phosphatase [                                    71.6    1e-11    Ruminiclostridium cellobioparum
ref|WP_015327467.1|  beta-phosphoglucomutase                          71.6    1e-11    Halobacteroides halobius
ref|WP_043489439.1|  hydrolase                                        72.0    1e-11    Streptomyces
ref|WP_031556559.1|  hypothetical protein                             71.6    1e-11    Lachnospira multipara
gb|ADI05183.1|  putative hydrolase                                    72.0    1e-11    Streptomyces bingchenggensis BCW-1
ref|WP_009891161.1|  hydrolase                                        71.6    1e-11    Clostridiales
ref|WP_037838639.1|  hydrolase                                        71.6    1e-11    
ref|WP_042226659.1|  phosphatase                                      71.6    1e-11    Paenibacillus chitinolyticus
ref|WP_010982974.1|  hydrolase                                        71.6    1e-11    Streptomyces avermitilis
gb|EQH98119.1|  HAD hydrolase, IA, variant 1 family protein           71.2    1e-11    Clostridioides difficile F314
ref|WP_014678796.1|  beta-phosphoglucomutase                          71.2    1e-11    Solitalea canadensis
ref|WP_011060169.1|  HAD family hydrolase                             71.6    1e-11    Pseudomonas
ref|WP_009898027.1|  hydrolase                                        71.2    1e-11    Clostridiales
ref|WP_024735416.1|  hydrolase                                        71.2    1e-11    Clostridiales bacterium VE202-15
ref|WP_003439593.1|  hydrolase                                        71.2    1e-11    Clostridiales
ref|WP_043271552.1|  hydrolase                                        71.2    1e-11    
ref|WP_030731854.1|  hydrolase                                        71.6    1e-11    Streptomyces sp. NRRL F-2890
ref|WP_030629597.1|  MULTISPECIES: hydrolase                          71.6    1e-11    Streptomyces
ref|WP_021368763.1|  HAD hydrolase, IA, variant 1 family protein      71.2    1e-11    
ref|WP_033029530.1|  hydrolase                                        71.2    1e-11    Streptomyces rimosus
ref|WP_022189155.1|  hAD-superfamily protein                          71.2    1e-11    
gb|ACZ41793.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    70.9    2e-11    Thermobaculum terrenum ATCC BAA-798
ref|WP_030370095.1|  hydrolase                                        71.2    2e-11    Streptomyces rimosus
ref|WP_034271883.1|  haloacid dehalogenase superfamily protein, s...  71.2    2e-11    Actinospica robiniae
ref|WP_041332742.1|  haloacid dehalogenase                            71.2    2e-11    
ref|WP_027431911.1|  hypothetical protein                             70.9    2e-11    Lachnospira multipara
ref|WP_004242581.1|  2-deoxyglucose-6-phosphatase                     70.9    2e-11    Proteus mirabilis
ref|WP_041424681.1|  hypothetical protein                             70.9    2e-11    
ref|WP_036918226.1|  2-deoxyglucose-6-phosphatase                     70.9    2e-11    Proteus
ref|WP_036881776.1|  phosphatase                                      70.9    2e-11    Prevotella nigrescens
ref|WP_013156731.1|  haloacid dehalogenase                            70.9    2e-11    Meiothermus silvanus
gb|ABQ88764.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    71.2    2e-11    Roseiflexus sp. RS-1
ref|WP_021407405.1|  HAD hydrolase, IA, variant 1 family protein      70.9    2e-11    Clostridioides difficile
ref|WP_027181279.1|  hypothetical protein                             70.9    2e-11    Desulfovibrio alaskensis
ref|WP_013611711.1|  MULTISPECIES: haloacid dehalogenase              70.9    2e-11    Odoribacter splanchnicus
ref|WP_036654473.1|  hypothetical protein                             70.9    2e-11    Paenibacillus wynnii
ref|WP_032119668.1|  hydrolase                                        70.9    2e-11    Clostridium sp. CL-2
ref|WP_013296711.1|  phosphatase                                      70.9    2e-11    Thermoanaerobacterium thermosaccharolyticum
ref|WP_025000107.1|  phosphatase                                      70.5    2e-11    Prevotella aurantiaca
ref|WP_010497166.1|  phosphatase                                      70.9    2e-11    Paenibacillus elgii
ref|WP_003179312.1|  HAD family hydrolase                             70.9    2e-11    Pseudomonas fluorescens
ref|WP_015310690.1|  haloacid dehalogenase superfamily enzyme, su...  70.9    2e-11    Thermoanaerobacterium thermosaccharolyticum
ref|WP_008819665.1|  phosphoglycolate phosphatase                     70.9    2e-11    Erysipelotrichaceae bacterium 6_1_45
ref|WP_021360928.1|  HAD hydrolase, IA, variant 1 family protein      70.9    2e-11    Clostridioides difficile
ref|WP_010238622.1|  phosphatase                                      70.9    2e-11    Clostridium arbusti
gb|ELX67285.1|  HAD hydrolase, family IA                              70.5    2e-11    Prevotella nigrescens F0103
ref|WP_025779681.1|  hypothetical protein                             70.9    2e-11    
ref|WP_021365731.1|  HAD hydrolase, IA, variant 1 family protein      70.9    2e-11    
ref|WP_032928090.1|  hydrolase                                        70.5    2e-11    
ref|WP_034099744.1|  MULTISPECIES: HAD family hydrolase               70.9    2e-11    
gb|ADQ17585.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    70.5    2e-11    
ref|WP_021394924.1|  HAD hydrolase, IA, variant 1 family protein      70.9    2e-11    
ref|WP_007919620.1|  HAD-superfamily hydrolase, subfamily IA, var...  70.9    2e-11    
ref|WP_009587987.1|  phosphoglycolate phosphatase                     70.5    2e-11    
ref|WP_017025566.1|  hypothetical protein                             70.5    2e-11    
ref|WP_021420093.1|  HAD hydrolase, IA, variant 1 family protein      70.5    2e-11    
ref|WP_017010316.1|  2-deoxyglucose-6-phosphatase                     70.5    2e-11    
ref|WP_023925362.1|  hypothetical protein                             70.5    3e-11    
ref|WP_041851613.1|  2-deoxyglucose-6-phosphatase                     70.5    3e-11    
gb|KIZ01151.1|  hypothetical protein MNEG_6810                        72.8    3e-11    
ref|WP_031481641.1|  hydrolase                                        70.5    3e-11    
ref|WP_044294417.1|  hypothetical protein                             70.5    3e-11    
ref|WP_041823563.1|  ABC transporter ATP-binding protein              70.5    3e-11    
ref|WP_002608015.1|  phosphoglycolate phosphatase [                   70.5    3e-11    
ref|WP_017017675.1|  2-deoxyglucose-6-phosphatase                     70.5    3e-11    
ref|WP_036215543.1|  beta-phosphoglucomutase                          70.5    3e-11    
ref|WP_028726646.1|  haloacid dehalogenase                            70.1    3e-11    
ref|WP_039304589.1|  beta-phosphoglucomutase                          70.5    3e-11    
ref|WP_036247156.1|  beta-phosphoglucomutase                          70.5    3e-11    
gb|EFV01550.1|  HAD hydrolase, family IA, variant 3                   69.3    3e-11    
ref|WP_031086028.1|  hydrolase                                        70.9    3e-11    
ref|WP_044289820.1|  hypothetical protein                             70.5    3e-11    
ref|WP_019062620.1|  hydrolase                                        70.5    3e-11    
ref|WP_027890213.1|  phosphatase                                      70.1    3e-11    
ref|XP_002465957.1|  hypothetical protein SORBIDRAFT_01g048850        72.4    3e-11    
ref|WP_006537134.1|  2-deoxyglucose-6-phosphatase                     70.1    3e-11    
ref|WP_027695316.1|  2-deoxyglucose-6-phosphatase                     70.1    3e-11    
ref|WP_007932383.1|  MULTISPECIES: hydrolase                          70.5    3e-11    
ref|WP_037330518.1|  2-deoxyglucose-6-phosphatase                     70.1    3e-11    
ref|WP_015327208.1|  beta-phosphoglucomutase                          70.1    4e-11    
ref|WP_021860302.1|  haloacid dehalogenase superfamily subfamily ...  70.1    4e-11    
ref|WP_040181162.1|  haloacid dehalogenase                            70.1    4e-11    
ref|WP_002581493.1|  HAD hydrolase, family IA                         70.1    4e-11    
ref|WP_029191666.1|  hypothetical protein                             70.1    4e-11    
ref|WP_015158586.1|  beta-phosphoglucomutase                          72.8    4e-11    
ref|WP_030587937.1|  hydrolase                                        70.1    4e-11    
ref|WP_009655844.1|  haloacid dehalogenase                            69.7    4e-11    
ref|WP_025128746.1|  HAD family hydrolase                             70.1    4e-11    
ref|WP_036690309.1|  hypothetical protein                             69.7    4e-11    
ref|WP_010208454.1|  MULTISPECIES: HAD family hydrolase               70.1    4e-11    
ref|WP_025854201.1|  HAD family hydrolase                             70.1    4e-11    
ref|WP_005505566.1|  2-deoxyglucose-6-phosphatase                     69.7    4e-11    
ref|WP_005951934.1|  MULTISPECIES: beta-phosphoglucomutase            69.7    4e-11    
ref|WP_009348940.1|  haloacid dehalogenase                            69.7    4e-11    
ref|WP_003957673.1|  hydrolase                                        69.7    5e-11    
ref|WP_033318680.1|  hydrolase                                        70.1    5e-11    
ref|WP_020137125.1|  hydrolase                                        69.7    5e-11    
ref|WP_016439277.1|  HAD hydrolase, family IA                         70.1    5e-11    
gb|ABG66125.1|  HAD-superfamily hydrolase, subfamily IA, variant ...  72.0    5e-11    
ref|WP_031583878.1|  hydrolase                                        69.7    5e-11    
ref|WP_028617536.1|  HAD family hydrolase                             69.7    5e-11    
ref|WP_025007145.1|  HAD family hydrolase                             69.7    5e-11    
ref|NP_001064794.1|  Os10g0464400                                     71.6    5e-11    
ref|WP_043047105.1|  HAD family hydrolase                             69.7    5e-11    
gb|EEH98664.1|  HAD hydrolase, family IA                              69.7    5e-11    
ref|WP_012119399.1|  haloacid dehalogenase                            69.7    5e-11    
gb|EEQ61158.1|  HAD hydrolase, family IA, variant 3                   69.7    5e-11    
ref|WP_035285656.1|  hydrolase                                        69.7    5e-11    
ref|WP_036908059.1|  2-deoxyglucose-6-phosphatase                     69.7    5e-11    
ref|WP_038841925.1|  HAD family hydrolase                             69.7    5e-11    
ref|WP_014455264.1|  beta-phosphoglucomutase                          69.3    5e-11    
ref|WP_042571962.1|  HAD family hydrolase                             69.7    5e-11    
ref|WP_011604725.1|  phosphatase                                      69.7    5e-11    
ref|WP_017739227.1|  HAD family hydrolase                             69.7    5e-11    
ref|WP_037635233.1|  hydrolase                                        70.1    5e-11    
ref|WP_034120706.1|  HAD family hydrolase                             69.7    5e-11    
ref|WP_017475759.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_019820575.1|  MULTISPECIES: putative hydrolase                 69.7    6e-11    
ref|WP_013660800.1|  haloacid dehalogenase                            69.3    6e-11    
ref|WP_025484051.1|  MULTISPECIES: hydrolase                          69.3    6e-11    
ref|WP_017628174.1|  2-deoxyglucose-6-phosphatase                     69.7    6e-11    
ref|WP_016781171.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_004371166.1|  MULTISPECIES: HAD family hydrolase               69.7    6e-11    
ref|WP_032879900.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_031071204.1|  hydrolase                                        69.7    6e-11    
ref|WP_019689431.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_017527431.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_039593709.1|  HAD family hydrolase                             69.7    6e-11    
ref|WP_040557010.1|  phosphatase                                      69.3    6e-11    
ref|WP_013383693.1|  haloacid dehalogenase                            69.3    6e-11    
ref|WP_027634713.1|  hydrolase                                        69.3    6e-11    
ref|WP_016979237.1|  MULTISPECIES: HAD family hydrolase               69.3    6e-11    
ref|WP_041331156.1|  haloacid dehalogenase                            69.3    6e-11    
ref|WP_005790426.1|  HAD family hydrolase                             69.3    7e-11    
ref|WP_044621525.1|  haloacid dehalogenase                            69.3    7e-11    
ref|WP_003407601.1|  hydrolase                                        69.3    7e-11    
emb|CDN43758.1|  2-deoxyglucose-6-phosphate phosphatase               69.3    7e-11    
ref|WP_003193342.1|  HAD family hydrolase                             69.3    7e-11    
gb|ACZ39068.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    69.3    7e-11    
ref|WP_027290230.1|  hypothetical protein                             69.3    7e-11    
ref|WP_044134225.1|  hypothetical protein                             69.3    7e-11    
ref|WP_021981999.1|  hAD-superfamily hydrolase subfamily IA varia...  69.3    7e-11    
ref|WP_013232205.1|  sugar transferase                                69.3    7e-11    
gb|EGQ16848.1|  CbbY/CbbZ/GpH/YieH family hydrolase                   68.9    7e-11    
ref|WP_027736408.1|  hydrolase                                        69.3    7e-11    
ref|WP_029141977.1|  hypothetical protein                             69.3    8e-11    
gb|ABU59805.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    69.3    8e-11    
ref|WP_030759093.1|  hydrolase                                        69.3    8e-11    
ref|WP_038086288.1|  hypothetical protein                             69.3    8e-11    
ref|WP_010563788.1|  HAD family hydrolase                             69.3    8e-11    
ref|WP_029270462.1|  ABC transporter ATP-binding protein              68.9    8e-11    
ref|WP_028811897.1|  hydrolase                                        69.3    8e-11    
ref|WP_003866584.1|  phosphatase                                      68.9    8e-11    
ref|WP_030349676.1|  hydrolase                                        69.3    8e-11    
ref|WP_036937450.1|  2-deoxyglucose-6-phosphatase                     68.9    9e-11    
ref|WP_023843975.1|  haloacid dehalogenase superfamily protein, s...  69.3    9e-11    
ref|WP_022060964.1|  beta-phosphoglucomutase                          68.9    9e-11    
ref|WP_014719511.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_022084861.1|  hydrolase HAD superfamily                        68.9    9e-11    
ref|WP_038580784.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_024076905.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_023968470.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_009713431.1|  hydrolase                                        68.9    9e-11    
ref|WP_007923013.1|  HAD family hydrolase                             68.9    9e-11    
emb|CAL95253.1|  putative CbbY family protein                         69.3    9e-11    
ref|WP_009047886.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_026300200.1|  ABC transporter ATP-binding protein              68.9    9e-11    
ref|WP_025804298.1|  HAD family hydrolase                             68.9    9e-11    
ref|WP_022262214.1|  modulator of DNA gyrase family protein           68.9    1e-10    
ref|WP_037961740.1|  hydrolase                                        68.9    1e-10    
ref|WP_009042901.1|  HAD family hydrolase                             68.9    1e-10    
ref|WP_031052163.1|  hydrolase                                        68.9    1e-10    
ref|WP_042168255.1|  phosphoglycolate phosphatase                     68.6    1e-10    
ref|WP_033539519.1|  2-deoxyglucose-6-phosphatase                     68.9    1e-10    
ref|WP_018562339.1|  hypothetical protein                             68.9    1e-10    
ref|WP_036877306.1|  phosphatase                                      68.6    1e-10    
ref|WP_042222007.1|  HAD family hydrolase                             68.9    1e-10    
ref|WP_016184420.1|  hypothetical protein                             68.6    1e-10    
emb|CDR14967.1|  HAD-superfamily hydrolase, subfamily IA, variant3    68.9    1e-10    
ref|WP_005885159.1|  hydrolase                                        68.6    1e-10    
ref|WP_022048992.1|  hAD hydrolase family IA                          68.6    1e-10    
ref|WP_044462093.1|  HAD family hydrolase                             68.9    1e-10    
ref|WP_044579067.1|  hydrolase                                        68.9    1e-10    
ref|WP_021963377.1|  hAD-superfamily hydrolase subfamily IA           68.6    1e-10    
ref|WP_041642630.1|  hypothetical protein                             68.6    1e-10    
ref|WP_037921692.1|  hydrolase                                        68.9    1e-10    
ref|WP_043838092.1|  HAD family hydrolase                             68.6    1e-10    
ref|WP_037501954.1|  hypothetical protein                             68.2    1e-10    
ref|WP_031456545.1|  ABC transporter ATP-binding protein              68.6    1e-10    
ref|WP_043675855.1|  haloacid dehalogenase                            68.6    1e-10    
ref|WP_038166591.1|  hypothetical protein                             68.2    1e-10    
ref|WP_041899125.1|  hypothetical protein                             67.4    1e-10    
ref|WP_043587440.1|  haloacid dehalogenase                            68.6    1e-10    
ref|WP_036837993.1|  2-deoxyglucose-6-phosphatase                     68.6    1e-10    
gb|KJF40114.1|  hypothetical protein TQ39_08035                       68.6    1e-10    
ref|WP_027396349.1|  hypothetical protein                             68.6    1e-10    
gb|EEA89488.1|  HAD hydrolase, family IA, variant 3                   68.6    1e-10    
ref|WP_032863412.1|  HAD family hydrolase                             68.6    1e-10    
ref|WP_009323913.1|  HAD hydrolase, family IA                         68.6    1e-10    
ref|WP_020994266.1|  HAD hydrolase, family IA                         68.6    1e-10    
ref|WP_008791320.1|  hydrolase                                        68.6    1e-10    
ref|WP_040361756.1|  hypothetical protein                             68.6    1e-10    
ref|WP_009299996.1|  hydrolase                                        68.6    1e-10    
dbj|GAM70097.1|  2-deoxyglucose-6-phosphate hydrolase yniC            68.6    1e-10    
ref|WP_019000118.1|  MULTISPECIES: glycoprotease                      68.6    1e-10    
ref|WP_014096030.1|  hypothetical protein                             68.6    1e-10    
ref|WP_015190203.1|  HAD-superfamily hydrolase, subfamily IA, var...  68.6    1e-10    
dbj|GAM63626.1|  2-deoxyglucose-6-phosphate hydrolase yniC            68.2    1e-10    
ref|WP_027440183.1|  hypothetical protein                             68.6    1e-10    
ref|WP_003536133.1|  hydrolase                                        68.6    1e-10    
ref|WP_008705471.1|  MULTISPECIES: hydrolase                          68.2    1e-10    
ref|WP_012995747.1|  phosphatase                                      68.6    1e-10    
ref|WP_026992260.1|  ABC transporter ATP-binding protein              68.2    2e-10    
ref|WP_022094435.1|  hAD hydrolase family IA variant 3                68.2    2e-10    
ref|WP_037286686.1|  HAD family hydrolase                             68.2    2e-10    
ref|XP_003580687.1|  PREDICTED: bifunctional riboflavin kinase/FM...  70.5    2e-10    
ref|WP_031463528.1|  phosphatase                                      68.6    2e-10    
ref|WP_040345142.1|  hypothetical protein                             68.2    2e-10    
ref|WP_018047276.1|  hypothetical protein                             68.6    2e-10    
ref|WP_024857413.1|  HAD family hydrolase                             68.6    2e-10    
ref|WP_030818739.1|  MULTISPECIES: hydrolase                          68.6    2e-10    
ref|WP_008751025.1|  HAD family hydrolase                             68.2    2e-10    
ref|WP_010321469.1|  beta-phosphoglucomutase                          68.2    2e-10    
ref|XP_010686288.1|  PREDICTED: bifunctional riboflavin kinase/FM...  69.7    2e-10    
ref|WP_032895773.1|  HAD family hydrolase                             68.2    2e-10    
ref|WP_026561150.1|  hypothetical protein                             68.2    2e-10    
ref|WP_020873417.1|  hydrolase                                        68.2    2e-10    
ref|WP_007956244.1|  hydrolase                                        68.2    2e-10    
ref|XP_006647129.1|  PREDICTED: (DL)-glycerol-3-phosphatase 2-like    70.1    2e-10    
ref|WP_008755096.1|  HAD family hydrolase                             68.2    2e-10    
ref|WP_027603656.1|  HAD family hydrolase                             68.2    2e-10    
ref|WP_006723411.1|  hypothetical protein                             68.2    2e-10    
gb|EFQ22473.1|  HAD-superfamily hydrolase, subfamily IA, variant 3    68.2    2e-10    
ref|WP_021324219.1|  2-deoxyglucose-6-phosphatase                     68.2    2e-10    
ref|WP_034089646.1|  hydrolase                                        68.2    2e-10    
ref|WP_022008081.1|  hAD hydrolase family IA                          68.2    2e-10    
ref|WP_007477956.1|  hydrolase                                        68.2    2e-10    
ref|XP_004986518.1|  PREDICTED: pseudouridine-5'-monophosphatase-...  68.9    2e-10    
ref|WP_014601228.1|  haloacid dehalogenase                            68.2    2e-10    
ref|WP_003722157.1|  haloacid dehalogenase                            68.2    2e-10    
ref|WP_013176662.1|  hydrolase                                        68.2    2e-10    
ref|WP_029298315.1|  HAD family hydrolase                             68.2    2e-10    
ref|WP_031028854.1|  hydrolase                                        68.2    2e-10    
ref|WP_031176186.1|  MULTISPECIES: hydrolase                          68.2    2e-10    
ref|WP_014602302.1|  haloacid dehalogenase                            67.8    2e-10    
ref|WP_016818782.1|  phosphatase                                      68.2    2e-10    
dbj|GAM56823.1|  2-deoxyglucose-6-phosphate hydrolase yniC            67.8    2e-10    
ref|WP_026581378.1|  hypothetical protein                             67.8    2e-10    
ref|WP_039526917.1|  hypothetical protein                             68.2    2e-10    
ref|WP_003230275.1|  putative hydrolase                               68.2    2e-10    
ref|WP_041399828.1|  hydrolase                                        67.4    2e-10    
ref|WP_016471433.1|  HAD hydrolase, family IA                         68.2    2e-10    
ref|XP_010686287.1|  PREDICTED: bifunctional riboflavin kinase/FM...  69.7    2e-10    
ref|WP_003988420.1|  hydrolase                                        68.2    2e-10    
ref|WP_044787930.1|  phosphatase                                      67.8    2e-10    
ref|WP_043498443.1|  hydrolase                                        68.2    2e-10    
ref|WP_017510804.1|  MULTISPECIES: HAD family hydrolase               67.8    2e-10    
ref|WP_032887546.1|  HAD family hydrolase                             67.8    2e-10    
ref|WP_019614202.1|  hypothetical protein                             67.8    2e-10    
ref|WP_010991454.1|  haloacid dehalogenase                            67.8    2e-10    
ref|WP_034278088.1|  hypothetical protein                             67.8    2e-10    
ref|WP_040019517.1|  hydrolase                                        67.8    2e-10    
ref|WP_011515030.1|  HAD family hydrolase                             67.8    2e-10    
ref|WP_008642870.1|  MULTISPECIES: HAD-superfamily hydrolase          67.8    2e-10    
sp|O33513.1|CBBY_RHOCA  RecName: Full=Protein CbbY                    67.8    2e-10    
ref|WP_009223932.1|  beta-phosphoglucomutase                          67.8    2e-10    
ref|WP_015662307.1|  phosphoglycolate phosphatase, bacterial          67.8    2e-10    



>emb|CAN61591.1| hypothetical protein VITISV_030553 [Vitis vinifera]
Length=659

 Score =   324 bits (830),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVF EMGVQVT EDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  82   CNSEEPSRRAGVDVFHEMGVQVTTEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  141

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+ QCKS GLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  142  FEIYLEKYAKPNSGIGFPGALELINQCKSNGLKVAVASSADRIKVDANLAAAGLPLSMFD  201

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VPP EC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  202  AIVSADAFENLKPAPDIFLAASKILDVPPGECIVIEDALAGVQAAKAAQMRCIAVTTTLP  261

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++AA PSLIRK I
Sbjct  262  EETLKAAGPSLIRKEI  277



>emb|CDP15242.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   322 bits (825),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAVDVFAEMGVQVT EDF PF G GEANFLGGVA+VKGV GFNPEAAKKRF
Sbjct  89   CNSEELSRRAAVDVFAEMGVQVTTEDFVPFMGTGEANFLGGVASVKGVNGFNPEAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA++L+ QCKS GLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  149  FEIYLDKYAKPNSGIGFPGAYDLIQQCKSNGLKVAVASSADRIKVDANLAAAGLPVSMFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  209  AIVSADAFENLKPAPDIFLAASKILSVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            ED+++ A PSLIRK I
Sbjct  269  EDSLKEAGPSLIRKDI  284



>gb|ABK94876.1| unknown [Populus trichocarpa]
Length=308

 Score =   311 bits (797),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR A VDVFAEMGV+VTV+DF PF G GEANFLGGVANVKGV GF+ E AKKRF
Sbjct  95   CNSEEPSRMAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVANVKGVKGFDTEMAKKRF  154

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGF GA EL+TQCK+KGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  155  FEIYLDKYAKPNSGIGFLGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPVSMFD  214

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  215  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  274

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +  A+PSLIRK I
Sbjct  275  EEILNDASPSLIRKEI  290



>ref|XP_007163318.1| hypothetical protein PHAVU_001G2247000g, partial [Phaseolus vulgaris]
 gb|ESW35312.1| hypothetical protein PHAVU_001G2247000g, partial [Phaseolus vulgaris]
Length=399

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VD+FAEMG++VTV+DF PFTG GEANFLGGVA+VKGV GF+ EAAKKRF
Sbjct  90   CNSEEPSRKAGVDLFAEMGIEVTVDDFVPFTGTGEANFLGGVASVKGVKGFDTEAAKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+K+AKP+SGIGFPGA EL++QCKSKGLKVAVASSADR+KVDANL AAGL LSMFD
Sbjct  150  FEIYLNKFAKPDSGIGFPGALELISQCKSKGLKVAVASSADRVKVDANLAAAGLPLSMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
             IVSADAFENLKPAPDIFLAAS+ILNVPPSEC+VIEDALAG+QAAKAA+MRCIAV T+L+
Sbjct  210  VIVSADAFENLKPAPDIFLAASRILNVPPSECIVIEDALAGVQAAKAAQMRCIAVRTSLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E+A P+ IR  I
Sbjct  270  DEVLESAEPTFIRDDI  285



>emb|CBI39607.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   323 bits (829),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVF EMGVQVT EDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  6    CNSEEPSRRAGVDVFHEMGVQVTTEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  65

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+ QCKS GLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  66   FEIYLEKYAKPNSGIGFPGALELINQCKSNGLKVAVASSADRIKVDANLAAAGLPLSMFD  125

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VPP EC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  126  AIVSADAFENLKPAPDIFLAASKILDVPPGECIVIEDALAGVQAAKAAQMRCIAVTTTLP  185

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++AA PSLIRK I
Sbjct  186  EETLKAAGPSLIRKEI  201



>ref|XP_009609093.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Nicotiana 
tomentosiformis]
Length=1080

 Score =   323 bits (829),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 169/197 (86%), Positives = 184/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGVQVTV+DF PF GMGEA FLGGVA+ KGV GF+P AAKKRF
Sbjct  86   CNSEEPSRRAAVDVFAEMGVQVTVDDFVPFMGMGEAYFLGGVASAKGVEGFDPNAAKKRF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGA+ELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  146  FEIYLSKYAKPNSGIGFPGAYELVSQCKSNGLKVAVASSADRIKVDANLAAAGLPITMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  265

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT++AA P+LIRK IS
Sbjct  266  EDTLKAAEPTLIRKEIS  282



>ref|XP_010313619.1| PREDICTED: NHL repeat-containing protein 2 isoform X5 [Solanum 
lycopersicum]
Length=943

 Score =   321 bits (823),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT+ AA PSLIRK IS
Sbjct  264  EDTLNAAEPSLIRKEIS  280



>ref|XP_007031176.1| Haloacid dehalogenase-like hydrolase family protein [Theobroma 
cacao]
 gb|EOY11678.1| Haloacid dehalogenase-like hydrolase family protein [Theobroma 
cacao]
Length=1077

 Score =   323 bits (828),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE PSR+A VDVFAEMGVQVTVEDF PFTGMGEA FLGGVA+VKGV  F+PEAAKKRF
Sbjct  84   CNSENPSRKAGVDVFAEMGVQVTVEDFVPFTGMGEAYFLGGVASVKGVKEFDPEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK+KGLKVAVASSADR+KVDANL AAGL LSMFD
Sbjct  144  FEIYLDKYAKPNSGIGFPGALELITQCKNKGLKVAVASSADRVKVDANLAAAGLPLSMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VPP EC+VIEDALAG+QAAKAAKMRCIAVTTTL 
Sbjct  204  AIVSADAFENLKPAPDIFLAASKILDVPPDECIVIEDALAGVQAAKAAKMRCIAVTTTLK  263

Query  202  EDTIEAAAPSLIRKGI  155
            EDT++ A PS IR  I
Sbjct  264  EDTLKDAGPSFIRNDI  279



>ref|XP_002277564.2| PREDICTED: NHL repeat-containing protein 2 [Vitis vinifera]
Length=1096

 Score =   323 bits (829),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVF EMGVQVT EDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  100  CNSEEPSRRAGVDVFHEMGVQVTTEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  159

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+ QCKS GLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  160  FEIYLEKYAKPNSGIGFPGALELINQCKSNGLKVAVASSADRIKVDANLAAAGLPLSMFD  219

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VPP EC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  220  AIVSADAFENLKPAPDIFLAASKILDVPPGECIVIEDALAGVQAAKAAQMRCIAVTTTLP  279

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++AA PSLIRK I
Sbjct  280  EETLKAAGPSLIRKEI  295


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = -1

Query  649  GMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDK  542
            G GEANFLGGVA+VKGV GF+PEAAKKRFFEIYL+K
Sbjct  2    GTGEANFLGGVASVKGVKGFDPEAAKKRFFEIYLEK  37



>ref|XP_010313614.1| PREDICTED: NHL repeat-containing protein 2 isoform X4 [Solanum 
lycopersicum]
Length=970

 Score =   321 bits (823),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT+ AA PSLIRK IS
Sbjct  264  EDTLNAAEPSLIRKEIS  280



>ref|XP_009383937.1| PREDICTED: putative uncharacterized hydrolase YKL033W-A [Musa 
acuminata subsp. malaccensis]
Length=308

 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVDVFA+MGV VT +DF PF G GEANFLGGVA+VK V GFNPEAAKKRF
Sbjct  96   CNSEELSRMAAVDVFADMGVSVTTDDFIPFMGTGEANFLGGVASVKEVKGFNPEAAKKRF  155

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL+ +CKS+GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  156  FEIYLDKYAKPDSGIGFPGALELIMECKSRGLKVAVASSADRIKVDANLAAAGLPVSLFD  215

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK LNVP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  216  AIVSADAFENLKPAPDIFLAASKNLNVPQSECLVIEDALAGVQAAKAAQMRCIAVTTTLP  275

Query  202  EDTIEAAAPSLIRKGI  155
            E+ ++ A+PSLIRK I
Sbjct  276  EEMLQPASPSLIRKEI  291



>gb|KDO81648.1| hypothetical protein CISIN_1g001380mg [Citrus sinensis]
Length=1089

 Score =   322 bits (824),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGV+VTVEDF PF G GEANFLGGVA+VKGV GF+ EAAKKRF
Sbjct  91   CNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRF  150

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ QCKSKGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  151  FEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFD  210

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFL+ASKILNVP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  211  AIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  270

Query  202  EDTIEAAAPSLIRKGI  155
            E+ ++ A+PSLIRK I
Sbjct  271  EERLKEASPSLIRKEI  286



>ref|XP_009790946.1| PREDICTED: NHL repeat-containing protein 2 [Nicotiana sylvestris]
Length=1078

 Score =   321 bits (823),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 168/197 (85%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGVQVTV+DF PF GMGEA FLGGVA+ K V GF+P AAKKRF
Sbjct  86   CNSEEPSRRAAVDVFAEMGVQVTVDDFVPFMGMGEAYFLGGVASAKSVEGFDPNAAKKRF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGA+ELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  146  FEIYLSKYAKPNSGIGFPGAYELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  265

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT++AA P+LIRK IS
Sbjct  266  EDTLKAAEPTLIRKEIS  282



>ref|XP_004230317.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Solanum 
lycopersicum]
Length=1077

 Score =   321 bits (822),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT+ AA PSLIRK IS
Sbjct  264  EDTLNAAEPSLIRKEIS  280



>gb|AAM65709.1| unknown [Arabidopsis thaliana]
Length=299

 Score =   301 bits (770),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAKKRF
Sbjct  86   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKKRF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  146  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  265

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  266  EAILKDAGPSMIRDDI  281



>ref|XP_010313598.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Solanum 
lycopersicum]
Length=1104

 Score =   321 bits (822),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT+ AA PSLIRK IS
Sbjct  264  EDTLNAAEPSLIRKEIS  280



>ref|XP_006344777.1| PREDICTED: NHL repeat-containing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=1233

 Score =   322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLLKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT++AA PSLIRK IS
Sbjct  264  EDTLKAAEPSLIRKEIS  280



>ref|XP_006472221.1| PREDICTED: NHL repeat-containing protein 2-like [Citrus sinensis]
Length=1089

 Score =   320 bits (819),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 182/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGV+VTVEDF PF G GEANFLGGVA+VKGV GF+ EAAKKRF
Sbjct  91   CNSEEPSRRAAVDVFAEMGVEVTVEDFLPFMGTGEANFLGGVASVKGVKGFDSEAAKKRF  150

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ QCKSKGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  151  FEIYLDKYAKPNSGIGFPGALELINQCKSKGLKVAVASSADRIKVDANLAAAGLPVSMFD  210

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFL+ASKILNVP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  211  AIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  270

Query  202  EDTIEAAAPSLIRKGI  155
            E+ ++  +PSLIRK I
Sbjct  271  EERLKEGSPSLIRKEI  286



>ref|XP_006344776.1| PREDICTED: NHL repeat-containing protein 2-like isoform X1 [Solanum 
tuberosum]
Length=1234

 Score =   322 bits (824),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 170/197 (86%), Positives = 183/197 (93%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGVQVTVEDF PF GMGEANFLGGVA  KGV GF+ EAAKKRF
Sbjct  84   CNSEESSRKAAVDVFAEMGVQVTVEDFVPFMGMGEANFLGGVAAAKGVEGFDTEAAKKRF  143

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDANL AAGL ++MFD
Sbjct  144  FEIYLLKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDANLAAAGLPITMFD  203

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  204  AIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTTTLS  263

Query  202  EDTIEAAAPSLIRKGIS  152
            EDT++AA PSLIRK IS
Sbjct  264  EDTLKAAEPSLIRKEIS  280



>ref|XP_002512523.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis]
 gb|EEF49975.1| 2-deoxyglucose-6-phosphate phosphatase, putative [Ricinus communis]
Length=1016

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 168/196 (86%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV VTVEDF PF G GEANFLGGVANVKGV GFN +AAKKRF
Sbjct  38   CNSEEPSRLAAVDVFAEMGVDVTVEDFVPFMGTGEANFLGGVANVKGVQGFNTDAAKKRF  97

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  98   FEIYLEKYAKPNSGIGFPGALELITQCKEKGLKVAVASSADRIKVDANLAAAGLPLSMFD  157

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VPPSEC+VIEDALAG+QAA+AA+MRCIAV TTL+
Sbjct  158  AIVSADAFENLKPAPDIFLAASKILEVPPSECIVIEDALAGVQAAQAAQMRCIAVKTTLS  217

Query  202  EDTIEAAAPSLIRKGI  155
            E+T+  A+PSLIR  I
Sbjct  218  EETLSNASPSLIRNDI  233



>dbj|BAF00734.1| hypothetical protein [Arabidopsis thaliana]
Length=299

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAK+RF
Sbjct  86   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKERF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  146  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  265

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  266  EAILKDAGPSMIRDDI  281



>ref|XP_011023797.1| PREDICTED: NHL repeat-containing protein 2 isoform X3 [Populus 
euphratica]
Length=910

 Score =   316 bits (810),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR A VDVFAEMGV+VTV+DF PF G GEANFLGGVANVKGV GF+ E AKKRF
Sbjct  95   CNSEEPSRMAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVANVKGVKGFDTEMAKKRF  154

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK+KGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  155  FEIYLDKYAKPNSGIGFPGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPVSMFD  214

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  215  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  274

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +  A+PSLIRK I
Sbjct  275  EEILNDASPSLIRKEI  290



>ref|XP_004494944.1| PREDICTED: NHL repeat-containing protein 2-like [Cicer arietinum]
Length=1061

 Score =   318 bits (815),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 181/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVFAE+GV VTV+DF PF G GEANFLGGVA+VKGV GFNPEAAKKRF
Sbjct  85   CNSEEPSRRAGVDVFAEIGVPVTVDDFVPFMGTGEANFLGGVASVKGVKGFNPEAAKKRF  144

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL++QCKS+GLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  145  FEIYLDKYAKPDSGIGFPGALELISQCKSRGLKVAVASSADRIKVDANLAAAGLPLSMFD  204

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKILNVPPSEC+VIEDALAG+QAAKAA+MRCIAV TTL+
Sbjct  205  AIVSADAFENLKPAPDIFLAASKILNVPPSECIVIEDALAGVQAAKAAQMRCIAVRTTLS  264

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E+A P+ IR  I
Sbjct  265  DEALESAGPTFIRDDI  280



>gb|KCW60570.1| hypothetical protein EUGRSUZ_H03302 [Eucalyptus grandis]
 gb|KCW60571.1| hypothetical protein EUGRSUZ_H03302 [Eucalyptus grandis]
Length=907

 Score =   316 bits (809),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSRRAAVDVFAEMGV+VTVEDF PF G GEANFLGGVA+ KGV  F+ EAAKKRF
Sbjct  94   CDSEEPSRRAAVDVFAEMGVEVTVEDFVPFMGTGEANFLGGVASAKGVKEFDTEAAKKRF  153

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  154  FEIYLDKYAKPNSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  213

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIV ADAFENLKPAPDIFLAASKILNVPP+EC+VIEDALAG+QAAKAA+MRCIA+TTTL+
Sbjct  214  AIVPADAFENLKPAPDIFLAASKILNVPPNECIVIEDALAGVQAAKAAQMRCIALTTTLS  273

Query  202  EDTIEAAAPSLIRKGIS  152
            E+ ++ A PSL+RK I 
Sbjct  274  EERLKVAGPSLVRKEIQ  290



>ref|XP_011092161.1| PREDICTED: NHL repeat-containing protein 2 [Sesamum indicum]
Length=1082

 Score =   318 bits (815),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VDVF EMGV+VTV+DF PF G GEANFLGGVA+VKGV GFNPE AKKRF
Sbjct  87   CNSEELSRLAGVDVFKEMGVEVTVQDFVPFMGTGEANFLGGVASVKGVKGFNPETAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA+EL+ QCK+KGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  147  FEIYLDKYAKPDSGIGFPGAYELIVQCKNKGLKVAVASSADRIKVDANLGAAGLQLSMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+IL+VP SECVVIEDALAG+QAAK+A MRCIAVTTTLA
Sbjct  207  AIVSADAFENLKPAPDIFLAASRILDVPTSECVVIEDALAGVQAAKSANMRCIAVTTTLA  266

Query  202  EDTIEAAAPSLIRKGI  155
            EDT++AA PSLIRK I
Sbjct  267  EDTLQAAGPSLIRKEI  282



>gb|KDP23397.1| hypothetical protein JCGZ_23230 [Jatropha curcas]
Length=1085

 Score =   318 bits (815),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV+VT EDF PF G GEANFLGGVANVKGV GFN E AKKRF
Sbjct  90   CNSEEPSRMAAVDVFAEMGVEVTAEDFVPFMGTGEANFLGGVANVKGVKGFNTEEAKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  150  FEIYLEKYAKPNSGIGFPGALELITQCKEKGLKVAVASSADRIKVDANLAAAGLPLSMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKILNVP SEC+VIEDALAG+QAAKAA+MRCIAV TTL+
Sbjct  210  AIVSADAFENLKPAPDIFLAASKILNVPTSECIVIEDALAGVQAAKAAEMRCIAVKTTLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E+T+  AAPSLIR  I
Sbjct  270  EETLRNAAPSLIRDDI  285



>gb|KHG03125.1| putative YhcW [Gossypium arboreum]
Length=458

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE PSR+AAVDVFAEMGVQV  EDFAPFTGMGEANFLGGVA+VKGV  FN EAAKKRF
Sbjct  83   CNSENPSRKAAVDVFAEMGVQVIAEDFAPFTGMGEANFLGGVASVKGVKEFNTEAAKKRF  142

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGAFEL+ +CK+KGLKVAVASSADR+KVDANL AAGL LSMFD
Sbjct  143  FEIYLDKYAKPNSGIGFPGAFELINECKNKGLKVAVASSADRVKVDANLAAAGLPLSMFD  202

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+V P EC+VIEDALAG+QAA AAKMRCIAVTTTL 
Sbjct  203  AIVSADAFENLKPAPDIFLAASKILDVSPDECLVIEDALAGVQAANAAKMRCIAVTTTLT  262

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IR  I
Sbjct  263  EETLKPAGPSIIRNDI  278



>ref|XP_011023795.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Populus 
euphratica]
Length=1107

 Score =   316 bits (810),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR A VDVFAEMGV+VTV+DF PF G GEANFLGGVANVKGV GF+ E AKKRF
Sbjct  95   CNSEEPSRMAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVANVKGVKGFDTEMAKKRF  154

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK+KGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  155  FEIYLDKYAKPNSGIGFPGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPVSMFD  214

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  215  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  274

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +  A+PSLIRK I
Sbjct  275  EEILNDASPSLIRKEI  290



>ref|XP_011023796.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Populus 
euphratica]
Length=1093

 Score =   316 bits (809),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR A VDVFAEMGV+VTV+DF PF G GEANFLGGVANVKGV GF+ E AKKRF
Sbjct  95   CNSEEPSRMAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVANVKGVKGFDTEMAKKRF  154

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK+KGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  155  FEIYLDKYAKPNSGIGFPGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPVSMFD  214

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  215  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  274

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +  A+PSLIRK I
Sbjct  275  EEILNDASPSLIRKEI  290



>ref|XP_010549436.1| PREDICTED: NHL repeat-containing protein 2-like [Tarenaya hassleriana]
Length=1070

 Score =   315 bits (808),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAVDVF EMGV+VTVEDF PF G GEA FLGGVA+VKGV GF+PE AKKRF
Sbjct  92   CNSEELSRRAAVDVFTEMGVEVTVEDFVPFMGTGEAKFLGGVASVKGVEGFDPETAKKRF  151

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVTQCK+KGLKVAVASSADRIKVD NLTAAGL LSMFD
Sbjct  152  FEIYLDKYAKPESGIGFPGALELVTQCKNKGLKVAVASSADRIKVDTNLTAAGLPLSMFD  211

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL+VPPSEC+VIEDALAG+QAAKAAKMRCIAV TTL+
Sbjct  212  AIVSADAFENLKPAPDIFLAAAKILDVPPSECIVIEDALAGVQAAKAAKMRCIAVKTTLS  271

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IR  I
Sbjct  272  EETLKDAGPSIIRDNI  287



>ref|XP_010024139.1| PREDICTED: NHL repeat-containing protein 2 [Eucalyptus grandis]
 gb|KCW60569.1| hypothetical protein EUGRSUZ_H03302 [Eucalyptus grandis]
Length=1087

 Score =   315 bits (808),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 181/197 (92%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSRRAAVDVFAEMGV+VTVEDF PF G GEANFLGGVA+ KGV  F+ EAAKKRF
Sbjct  94   CDSEEPSRRAAVDVFAEMGVEVTVEDFVPFMGTGEANFLGGVASAKGVKEFDTEAAKKRF  153

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  154  FEIYLDKYAKPNSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  213

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIV ADAFENLKPAPDIFLAASKILNVPP+EC+VIEDALAG+QAAKAA+MRCIA+TTTL+
Sbjct  214  AIVPADAFENLKPAPDIFLAASKILNVPPNECIVIEDALAGVQAAKAAQMRCIALTTTLS  273

Query  202  EDTIEAAAPSLIRKGIS  152
            E+ ++ A PSL+RK I 
Sbjct  274  EERLKVAGPSLVRKEIQ  290



>ref|XP_006604788.1| PREDICTED: NHL repeat-containing protein 2-like [Glycine max]
Length=1067

 Score =   314 bits (805),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VD+FAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  91   CNSEEPSRRAGVDLFAEMGVDVTVDDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  150

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  151  FEIYLDKYAKPDSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  210

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+ILNVP +EC+VIEDALAG++AAKAA+MRCIAV TTL+
Sbjct  211  AIVSADAFENLKPAPDIFLAASRILNVPSNECIVIEDALAGVEAAKAAQMRCIAVRTTLS  270

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E A P+LIR  I
Sbjct  271  DEALEPAGPTLIRDNI  286



>gb|KHN43348.1| NHL repeat-containing protein 2 [Glycine soja]
Length=1067

 Score =   314 bits (805),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VD+FAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  91   CNSEEPSRRAGVDLFAEMGVDVTVDDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  150

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  151  FEIYLDKYAKPDSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  210

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+ILNVP +EC+VIEDALAG++AAKAA+MRCIAV TTL+
Sbjct  211  AIVSADAFENLKPAPDIFLAASRILNVPSNECIVIEDALAGVEAAKAAQMRCIAVRTTLS  270

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E A P+LIR  I
Sbjct  271  DEALEPAGPTLIRDNI  286



>ref|XP_010674631.1| PREDICTED: NHL repeat-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=1073

 Score =   314 bits (804),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+ + AKKRF
Sbjct  89   CNSEEPSRRAGVDVFAEMGVDVTVDDFVPFMGTGEANFLGGVASVKGVKGFDTDVAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGAFEL+TQCK+KGLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLEKYAKPNSGIGFPGAFELITQCKAKGLKVAVASSADRIKVDANLAAAGLSIQLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFL+AS ILNVPPSEC+VIEDALAG+QAA AAKMRCI VTTTL+
Sbjct  209  AIVSADAFEKLKPAPDIFLSASNILNVPPSECIVIEDALAGLQAANAAKMRCIVVTTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +   APSLIRK I
Sbjct  269  EEILATEAPSLIRKDI  284



>ref|XP_002319481.1| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
 gb|EEE95404.1| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
Length=1065

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR A VDVFAEMGV+VTV+DF PF G GEANFLGGVANVKGV GF+ E AKKRF
Sbjct  95   CNSEEPSRMAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVANVKGVKGFDTEMAKKRF  154

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGF GA EL+TQCK+KGLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  155  FEIYLDKYAKPNSGIGFLGALELITQCKNKGLKVAVASSADRIKVDANLAAAGLPVSMFD  214

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  215  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  274

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +  A+PSLIRK I
Sbjct  275  EEILNDASPSLIRKEI  290



>ref|XP_007208118.1| hypothetical protein PRUPE_ppa000671mg [Prunus persica]
 gb|EMJ09317.1| hypothetical protein PRUPE_ppa000671mg [Prunus persica]
Length=1041

 Score =   311 bits (796),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 165/196 (84%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSR A VDVFAEMGV++TVEDF PF G GEANFLGGVA VKGV GF+PEAAKKRF
Sbjct  87   CDSEEPSRLAGVDVFAEMGVEITVEDFVPFMGTGEANFLGGVAAVKGVKGFDPEAAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKV+ANL AA L LSMFD
Sbjct  147  FEIYLDKYAKPNSGIGFPGALELITQCKGKGLKVAVASSADRIKVNANLAAANLPLSMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASKIL+VP SEC+VIEDALAG+QAAKAAKMRCIAV TTL+
Sbjct  207  AIVSADAFEKLKPAPDIFLAASKILDVPVSECIVIEDALAGVQAAKAAKMRCIAVKTTLS  266

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++AA PSLIR  I
Sbjct  267  EETLKAAGPSLIRNEI  282



>gb|KEH24491.1| haloacid dehalogenase-like hydrolase family protein [Medicago 
truncatula]
Length=1059

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRR+ VD FAE+GVQVTV+DF PF G GEANFLGGVA+VKGV GFN EAAKKRF
Sbjct  85   CNSEEPSRRSGVDFFAEIGVQVTVDDFVPFMGTGEANFLGGVASVKGVEGFNTEAAKKRF  144

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  145  FEIYLDKYAKPDSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  204

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+ILNVP SEC+VIEDALAG+QAAKAA+MRCIAV TTL+
Sbjct  205  AIVSADAFENLKPAPDIFLAASRILNVPASECIVIEDALAGVQAAKAAQMRCIAVRTTLS  264

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E A P+ IR  I
Sbjct  265  DEALEPAGPTFIRDDI  280



>gb|KEH24490.1| haloacid dehalogenase-like hydrolase family protein [Medicago 
truncatula]
Length=1081

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRR+ VD FAE+GVQVTV+DF PF G GEANFLGGVA+VKGV GFN EAAKKRF
Sbjct  85   CNSEEPSRRSGVDFFAEIGVQVTVDDFVPFMGTGEANFLGGVASVKGVEGFNTEAAKKRF  144

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  145  FEIYLDKYAKPDSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  204

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAAS+ILNVP SEC+VIEDALAG+QAAKAA+MRCIAV TTL+
Sbjct  205  AIVSADAFENLKPAPDIFLAASRILNVPASECIVIEDALAGVQAAKAAQMRCIAVRTTLS  264

Query  202  EDTIEAAAPSLIRKGI  155
            ++ +E A P+ IR  I
Sbjct  265  DEALEPAGPTFIRDDI  280



>ref|XP_008388470.1| PREDICTED: NHL repeat-containing protein 2 [Malus domestica]
Length=1080

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSR AAVDVFAEMGVQVTVEDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  87   CDSEEPSRLAAVDVFAEMGVQVTVEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKV+ANL AA L LSMFD
Sbjct  147  FEIYLDKYAKPNSGIGFPGALELITQCKEKGLKVAVASSADRIKVNANLAAANLPLSMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASKIL+VP SEC+VIEDALAG+QAAKAAKM CIAV TTL+
Sbjct  207  AIVSADAFEKLKPAPDIFLAASKILDVPTSECIVIEDALAGVQAAKAAKMXCIAVKTTLS  266

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++AA PSLIRK I
Sbjct  267  EAELKAAXPSLIRKEI  282



>ref|XP_004169165.1| PREDICTED: NHL repeat-containing protein 2-like, partial [Cucumis 
sativus]
Length=892

 Score =   307 bits (787),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF E+GV+VT E+F PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  88   CNSEDLSRRAAVDVFRELGVEVTPEEFVPFMGTGEANFLGGVASVKGVAGFSPEAAKKRF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+T+CKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  148  FEIYLEKYAKPNSGIGFPGALELITECKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  207

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK+LNVP  EC+VIEDALAG+QAA+AAKMRCIAV TTL+
Sbjct  208  AIVSADAFENLKPAPDIFIAASKLLNVPSDECIVIEDALAGVQAAQAAKMRCIAVKTTLS  267

Query  202  EDTIEAAAPSLIRKGI  155
            ++T++ A PSLIR  I
Sbjct  268  DETLKTAGPSLIRNDI  283



>ref|XP_010259235.1| PREDICTED: NHL repeat-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=1072

 Score =   310 bits (793),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV+VT EDF PF G GEANFLGGVA+VKGV GFNPE AKKRF
Sbjct  97   CNSEEPSRMAAVDVFAEMGVEVTTEDFVPFMGTGEANFLGGVASVKGVKGFNPELAKKRF  156

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IYL KYAKPNSGIGFPGA EL+ QCK  GLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  157  FDIYLSKYAKPNSGIGFPGALELIMQCKENGLKVAVASSADRIKVDANLAAAGLPVSMFD  216

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK LNV P EC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  217  AIVSADAFENLKPAPDIFIAASKSLNVTPDECIVIEDALAGVQAAKAAKMRCIAVTTTLS  276

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IRK I
Sbjct  277  EETLKEAGPSVIRKEI  292



>ref|XP_009373299.1| PREDICTED: NHL repeat-containing protein 2 [Pyrus x bretschneideri]
Length=1080

 Score =   310 bits (793),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSR AAVDVFAEMGV+VTVEDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  87   CDSEEPSRLAAVDVFAEMGVEVTVEDFVPFMGTGEANFLGGVASVKGVKGFDPEAAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKV+ANL AA L LSMFD
Sbjct  147  FEIYLDKYAKPNSGIGFPGALELITQCKEKGLKVAVASSADRIKVNANLAAANLPLSMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASKIL+VP SEC+VIEDALAG+QAAKAA MRCIAV TTL+
Sbjct  207  AIVSADAFEKLKPAPDIFLAASKILDVPTSECIVIEDALAGVQAAKAANMRCIAVKTTLS  266

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++AA PSLIRK I
Sbjct  267  EVELKAAGPSLIRKEI  282



>ref|XP_010259236.1| PREDICTED: NHL repeat-containing protein 2 isoform X4 [Nelumbo 
nucifera]
Length=1071

 Score =   309 bits (792),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV+VT EDF PF G GEANFLGGVA+VKGV GFNPE AKKRF
Sbjct  97   CNSEEPSRMAAVDVFAEMGVEVTTEDFVPFMGTGEANFLGGVASVKGVKGFNPELAKKRF  156

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IYL KYAKPNSGIGFPGA EL+ QCK  GLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  157  FDIYLSKYAKPNSGIGFPGALELIMQCKENGLKVAVASSADRIKVDANLAAAGLPVSMFD  216

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK LNV P EC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  217  AIVSADAFENLKPAPDIFIAASKSLNVTPDECIVIEDALAGVQAAKAAKMRCIAVTTTLS  276

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IRK I
Sbjct  277  EETLKEAGPSVIRKEI  292



>ref|XP_008246083.1| PREDICTED: NHL repeat-containing protein 2 [Prunus mume]
Length=1081

 Score =   310 bits (793),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 166/196 (85%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSR A VDVFAEMGV+VTVEDF PF G GEANFLGGVA VKGV GF+PEAAKKRF
Sbjct  87   CDSEEPSRLAGVDVFAEMGVEVTVEDFVPFMGTGEANFLGGVAAVKGVKGFDPEAAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+TQCK KGLKVAVASSADRIKV ANL AA L LSMFD
Sbjct  147  FEIYLDKYAKPNSGIGFPGALELITQCKGKGLKVAVASSADRIKVIANLAAANLPLSMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASKIL+VP SEC+VIEDALAG+QAAKAAKMRCIAV TTL+
Sbjct  207  AIVSADAFEKLKPAPDIFLAASKILDVPVSECIVIEDALAGVQAAKAAKMRCIAVKTTLS  266

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++AA PSLIR  I
Sbjct  267  EETLKAAGPSLIRNEI  282



>ref|XP_010259234.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=1097

 Score =   310 bits (793),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV+VT EDF PF G GEANFLGGVA+VKGV GFNPE AKKRF
Sbjct  97   CNSEEPSRMAAVDVFAEMGVEVTTEDFVPFMGTGEANFLGGVASVKGVKGFNPELAKKRF  156

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IYL KYAKPNSGIGFPGA EL+ QCK  GLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  157  FDIYLSKYAKPNSGIGFPGALELIMQCKENGLKVAVASSADRIKVDANLAAAGLPVSMFD  216

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK LNV P EC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  217  AIVSADAFENLKPAPDIFIAASKSLNVTPDECIVIEDALAGVQAAKAAKMRCIAVTTTLS  276

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IRK I
Sbjct  277  EETLKEAGPSVIRKEI  292



>ref|XP_010259233.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=1103

 Score =   310 bits (793),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV+VT EDF PF G GEANFLGGVA+VKGV GFNPE AKKRF
Sbjct  97   CNSEEPSRMAAVDVFAEMGVEVTTEDFVPFMGTGEANFLGGVASVKGVKGFNPELAKKRF  156

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IYL KYAKPNSGIGFPGA EL+ QCK  GLKVAVASSADRIKVDANL AAGL +SMFD
Sbjct  157  FDIYLSKYAKPNSGIGFPGALELIMQCKENGLKVAVASSADRIKVDANLAAAGLPVSMFD  216

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK LNV P EC+VIEDALAG+QAAKAAKMRCIAVTTTL+
Sbjct  217  AIVSADAFENLKPAPDIFIAASKSLNVTPDECIVIEDALAGVQAAKAAKMRCIAVTTTLS  276

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IRK I
Sbjct  277  EETLKEAGPSVIRKEI  292



>tpg|DAA45052.1| TPA: hypothetical protein ZEAMMB73_628261 [Zea mays]
Length=355

 Score =   291 bits (744),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+V V+DF PF G GEANFLGGVA  KGV  FNPE+AKKRF
Sbjct  89   CNSEEPSRQAGVDVFAEMGVEVAVDDFVPFMGTGEANFLGGVARAKGVKDFNPESAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLDKYAKPNSGIGFPGALELILECKNSGLKVAVASSADRIKVDANLAAAGLSVFLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  +EC+VIEDALAG+QAA AA+MRCIAVTTTL 
Sbjct  209  AIVSADAFEKLKPAPDIFLAASKSLGVDTNECIVIEDALAGVQAANAAEMRCIAVTTTLE  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  +   +PS IRK I
Sbjct  269  EIALRQGSPSFIRKNI  284



>ref|XP_004135754.1| PREDICTED: NHL repeat-containing protein 2-like [Cucumis sativus]
Length=1086

 Score =   308 bits (788),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF E+GV+VT E+F PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  88   CNSEDLSRRAAVDVFRELGVEVTPEEFVPFMGTGEANFLGGVASVKGVAGFSPEAAKKRF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+T+CKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  148  FEIYLEKYAKPNSGIGFPGALELITECKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  207

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK+LNVP  EC+VIEDALAG+QAA+AAKMRCIAV TTL+
Sbjct  208  AIVSADAFENLKPAPDIFIAASKLLNVPSDECIVIEDALAGVQAAQAAKMRCIAVKTTLS  267

Query  202  EDTIEAAAPSLIRKGI  155
            ++T++ A PSLIR  I
Sbjct  268  DETLKTAGPSLIRNDI  283



>gb|KGN65974.1| hypothetical protein Csa_1G555590 [Cucumis sativus]
Length=1082

 Score =   307 bits (787),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF E+GV+VT E+F PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  88   CNSEDLSRRAAVDVFRELGVEVTPEEFVPFMGTGEANFLGGVASVKGVAGFSPEAAKKRF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+T+CKSKGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  148  FEIYLEKYAKPNSGIGFPGALELITECKSKGLKVAVASSADRIKVDANLAAAGLPLSMFD  207

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK+LNVP  EC+VIEDALAG+QAA+AAKMRCIAV TTL+
Sbjct  208  AIVSADAFENLKPAPDIFIAASKLLNVPSDECIVIEDALAGVQAAQAAKMRCIAVKTTLS  267

Query  202  EDTIEAAAPSLIRKGI  155
            ++T++ A PSLIR  I
Sbjct  268  DETLKTAGPSLIRNDI  283



>ref|XP_002467968.1| hypothetical protein SORBIDRAFT_01g037270 [Sorghum bicolor]
 gb|EER94966.1| hypothetical protein SORBIDRAFT_01g037270 [Sorghum bicolor]
Length=607

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSR+A VDVFAEMGV+VTV+DF PF G GEANFLGGVA  KGV GFNPE+AKKRF
Sbjct  92   CDSEEPSRQAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVARAKGVKGFNPESAKKRF  151

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  152  FEIYLDKYAKPNSGIGFPGALELIMECKNSGLKVAVASSADRIKVDANLAAAGLPVSLFD  211

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V  ++C+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  212  AIVSADAFENLKPAPDIFLAASKNLGVDTNKCIVIEDALAGVQAAKAAEMRCIAVTTTLE  271

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++  +PSLIRK I
Sbjct  272  EVALQQGSPSLIRKNI  287



>dbj|BAJ85249.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=308

 Score =   288 bits (737),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 171/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGV V V+DF PFTG GEANFLGGVA VKGV  F+ E+AKKRF
Sbjct  94   CNSEEPSRRAAVDVFAEMGVDVNVDDFIPFTGTGEANFLGGVARVKGVKDFSTESAKKRF  153

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADR+KVDANL AAGL +S+FD
Sbjct  154  FEIYLEKYAKPNSGIGFPGALELIMECKNAGLKVAVASSADRVKVDANLAAAGLPVSLFD  213

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAA+AA++RCIAVTT+L 
Sbjct  214  AIVSADAFENLKPAPDIFLAASKNLGVDTDECIVIEDALAGVQAAEAAEIRCIAVTTSLD  273

Query  202  EDTIEAAAPSLIRKGI  155
            ED +  A+P  IRK I
Sbjct  274  EDALRQASPVFIRKDI  289



>tpg|DAA45055.1| TPA: hypothetical protein ZEAMMB73_628261 [Zea mays]
Length=420

 Score =   291 bits (745),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+V V+DF PF G GEANFLGGVA  KGV  FNPE+AKKRF
Sbjct  89   CNSEEPSRQAGVDVFAEMGVEVAVDDFVPFMGTGEANFLGGVARAKGVKDFNPESAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLDKYAKPNSGIGFPGALELILECKNSGLKVAVASSADRIKVDANLAAAGLSVFLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  +EC+VIEDALAG+QAA AA+MRCIAVTTTL 
Sbjct  209  AIVSADAFEKLKPAPDIFLAASKSLGVDTNECIVIEDALAGVQAANAAEMRCIAVTTTLE  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  +   +PS IRK I
Sbjct  269  EIALRQGSPSFIRKNI  284



>ref|XP_006841624.1| hypothetical protein AMTR_s00003p00225260 [Amborella trichopoda]
 gb|ERN03299.1| hypothetical protein AMTR_s00003p00225260 [Amborella trichopoda]
Length=1110

 Score =   306 bits (785),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMGV+VTV DF PF G GEANFLGGVA+VKG+ GFNPEAAK+RF
Sbjct  117  CNSEELSRQAAVDVFAEMGVEVTVNDFVPFMGTGEANFLGGVASVKGIEGFNPEAAKRRF  176

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IYLDKYAKP+SGIGFPGA ELV QCK +GLKVAVASSADRIKVDANL AAGL  SMFD
Sbjct  177  FDIYLDKYAKPDSGIGFPGALELVMQCKKEGLKVAVASSADRIKVDANLAAAGLPSSMFD  236

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSAD+FENLKPAPDIFLAAS  LNV P+ECVVIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  237  AIVSADSFENLKPAPDIFLAASNNLNVSPTECVVIEDALAGVQAAKAAQMRCIAVTTTLS  296

Query  202  EDTIEAAAPSLIRKGI  155
            EDT+  A PSLIRK I
Sbjct  297  EDTLLQAGPSLIRKVI  312



>tpg|DAA45053.1| TPA: hypothetical protein ZEAMMB73_628261 [Zea mays]
Length=415

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+V V+DF PF G GEANFLGGVA  KGV  FNPE+AKKRF
Sbjct  89   CNSEEPSRQAGVDVFAEMGVEVAVDDFVPFMGTGEANFLGGVARAKGVKDFNPESAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLDKYAKPNSGIGFPGALELILECKNSGLKVAVASSADRIKVDANLAAAGLSVFLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  +EC+VIEDALAG+QAA AA+MRCIAVTTTL 
Sbjct  209  AIVSADAFEKLKPAPDIFLAASKSLGVDTNECIVIEDALAGVQAANAAEMRCIAVTTTLE  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  +   +PS IRK I
Sbjct  269  EIALRQGSPSFIRKNI  284



>ref|XP_008450538.1| PREDICTED: NHL repeat-containing protein 2 [Cucumis melo]
Length=1082

 Score =   306 bits (784),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF E+GV+VT EDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  88   CNSEDLSRRAAVDVFRELGVEVTPEDFVPFMGTGEANFLGGVASVKGVAGFSPEAAKKRF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKPNSGIGFPGA EL+T+CKSKGLKVAVASSADRIKVDANL AAGL  SMFD
Sbjct  148  FEIYLEKYAKPNSGIGFPGALELITECKSKGLKVAVASSADRIKVDANLAAAGLPPSMFD  207

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIF+AASK+LNVP  EC+VIEDALAG+QAA+AAKMRCIAV TTL+
Sbjct  208  AIVSADAFENLKPAPDIFIAASKLLNVPSDECIVIEDALAGVQAAQAAKMRCIAVKTTLS  267

Query  202  EDTIEAAAPSLIRKGI  155
            ++T++ A PSLIR  I
Sbjct  268  DETLKTAGPSLIRNDI  283



>ref|XP_006301486.1| hypothetical protein CARUB_v10021909mg [Capsella rubella]
 gb|EOA34384.1| hypothetical protein CARUB_v10021909mg [Capsella rubella]
Length=1058

 Score =   305 bits (781),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE PSR AAVDVFAEMGV+VTVEDF PFTG GEA FLGGVA+VKGV GF+ +AAKKRF
Sbjct  89   CNSEVPSRLAAVDVFAEMGVEVTVEDFVPFTGTGEARFLGGVASVKGVEGFDTDAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSLSMFD
Sbjct  149  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLSMFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL V  SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  209  AIVSADAFENLKPAPDIFLAAAKILGVSTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E+ ++ AAPS+IR+ I
Sbjct  269  EEILKDAAPSMIRENI  284



>gb|KJB81121.1| hypothetical protein B456_013G130100 [Gossypium raimondii]
Length=1076

 Score =   305 bits (781),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 167/196 (85%), Positives = 180/196 (92%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE PSR+AAVDVFAEMGVQVT EDFAPFTGMGEANFLGGVA+VKGV  FN EAAKKRF
Sbjct  83   CNSENPSRKAAVDVFAEMGVQVTAEDFAPFTGMGEANFLGGVASVKGVKEFNTEAAKKRF  142

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGAFEL+ +CK+KGLKVAVASSADR+KVDANL AAGL LSMFD
Sbjct  143  FEIYLDKYAKPNSGIGFPGAFELINECKNKGLKVAVASSADRVKVDANLAAAGLPLSMFD  202

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+V P EC+VIEDALAG+QAA AAKMRCIAVTTTL 
Sbjct  203  AIVSADAFENLKPAPDIFLAASKILDVSPDECIVIEDALAGVQAANAAKMRCIAVTTTLT  262

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A PS+IR  I
Sbjct  263  EETLKPAGPSIIRNDI  278



>tpg|DAA45054.1| TPA: hypothetical protein ZEAMMB73_628261 [Zea mays]
Length=446

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/196 (78%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+V V+DF PF G GEANFLGGVA  KGV  FNPE+AKKRF
Sbjct  89   CNSEEPSRQAGVDVFAEMGVEVAVDDFVPFMGTGEANFLGGVARAKGVKDFNPESAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLDKYAKPNSGIGFPGALELILECKNSGLKVAVASSADRIKVDANLAAAGLSVFLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  +EC+VIEDALAG+QAA AA+MRCIAVTTTL 
Sbjct  209  AIVSADAFEKLKPAPDIFLAASKSLGVDTNECIVIEDALAGVQAANAAEMRCIAVTTTLE  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  +   +PS IRK I
Sbjct  269  EIALRQGSPSFIRKNI  284



>emb|CDY41708.1| BnaA09g15360D [Brassica napus]
Length=1061

 Score =   304 bits (779),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  89   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVQGFDPDAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADR+KVDANL AAGLSLSMFD
Sbjct  149  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRVKVDANLAAAGLSLSMFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  209  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAQAANMRCIAVKTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR+ I
Sbjct  269  EAILKDAGPSMIREDI  284



>gb|EPS73091.1| hypothetical protein M569_01658, partial [Genlisea aurea]
Length=665

 Score =   296 bits (758),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVD FAEMGVQVTV+DF PF G GEA FLGGVA+VKGV GF+P  AKKRF
Sbjct  17   CNSEELSRMAAVDFFAEMGVQVTVQDFIPFMGTGEAKFLGGVASVKGVEGFDPVTAKKRF  76

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGI FPGA+EL+ QCK+KGLKVAVASSADR+KV+ANL AAGL LS+FD
Sbjct  77   FEIYLDKYAKPDSGIAFPGAYELIVQCKNKGLKVAVASSADRVKVNANLAAAGLPLSLFD  136

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            A+VSADAFENLKPAPDIFL+ASKIL+VP +EC+VIEDALAG+QAA++A MRCIAVTTTL 
Sbjct  137  AVVSADAFENLKPAPDIFLSASKILDVPTNECIVIEDALAGVQAAQSAGMRCIAVTTTLE  196

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++AA PS IRK I
Sbjct  197  EKALDAAGPSFIRKNI  212



>ref|NP_001146693.1| uncharacterized protein LOC100280294 [Zea mays]
 gb|ACL54559.1| unknown [Zea mays]
Length=446

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/196 (78%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+V V+DF PF G GEANFLGGVA  KGV  FNPE+AKKRF
Sbjct  89   CNSEEPSRQAGVDVFAEMGVEVAVDDFVPFMGTGEANFLGGVARAKGVKDFNPESAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKY KPNSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGLS+ +FD
Sbjct  149  FEIYLDKYEKPNSGIGFPGALELILECKNSGLKVAVASSADRIKVDANLAAAGLSVFLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  +EC+VIEDALAG+QAA AA+MRCIAVTTTL 
Sbjct  209  AIVSADAFEKLKPAPDIFLAASKSLGVDTNECIVIEDALAGVQAANAAEMRCIAVTTTLE  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  +   +PS IRK I
Sbjct  269  EIALRQGSPSFIRKNI  284



>emb|CDX95268.1| BnaC09g16020D [Brassica napus]
Length=1073

 Score =   303 bits (776),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  90   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVQGFDPDAAKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADR+KVDANL AAGLSLSMFD
Sbjct  150  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRVKVDANLAAAGLSLSMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  210  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAQAANMRCIAVKTTLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  270  EAILKDAGPSIIRDDI  285



>ref|XP_009113385.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Brassica 
rapa]
Length=1056

 Score =   303 bits (775),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  90   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVQGFDPDAAKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADR+KVDANL AAGLSL+MFD
Sbjct  150  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRVKVDANLAAAGLSLTMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  210  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAQAANMRCIAVKTTLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  270  EAILKDAGPSMIRDDI  285



>ref|XP_009113384.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Brassica 
rapa]
Length=1058

 Score =   303 bits (775),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  90   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVQGFDPDAAKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADR+KVDANL AAGLSL+MFD
Sbjct  150  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRVKVDANLAAAGLSLTMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SEC+VIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  210  AIVSADAFENLKPAPDIFLAASKILGVPTSECIVIEDALAGVQAAQAANMRCIAVKTTLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  270  EAILKDAGPSMIRDDI  285



>ref|XP_009384439.1| PREDICTED: NHL repeat-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=1099

 Score =   303 bits (776),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/196 (82%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VDVFAEMGV VT +DF PF G GEANFLGGVA+VKG+  F+PEAAKKRF
Sbjct  101  CNSEELSRLAGVDVFAEMGVPVTTDDFVPFMGTGEANFLGGVASVKGINDFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA ELV +CK KGLKVAVASSADRIKVDANLTAAGL +S+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELVMECKRKGLKVAVASSADRIKVDANLTAAGLPVSLFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
             IVSADAFE LKPAPDIFLAASK LNVP SEC+VIEDALAG+QAAKAA+MRCIAVTTTL+
Sbjct  221  VIVSADAFEKLKPAPDIFLAASKSLNVPQSECIVIEDALAGVQAAKAAQMRCIAVTTTLS  280

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A PSLIRK I
Sbjct  281  EDILQQAGPSLIRKEI  296



>ref|XP_006649977.1| PREDICTED: NHL repeat-containing protein 2-like [Oryza brachyantha]
Length=1099

 Score =   303 bits (775),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRA VDVFAEMGV VTV+DF PF G GEANFLGGVA VKGV  FN E+AKKRF
Sbjct  99   CNSEEPSRRAGVDVFAEMGVDVTVDDFVPFMGTGEANFLGGVARVKGVKDFNTESAKKRF  158

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA +L+ +CK+ GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  159  FEIYLDKYAKPNSGIGFPGALDLIMECKNAGLKVAVASSADRIKVDANLAAAGLPISLFD  218

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L+V   EC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  219  AIVSADAFENLKPAPDIFLAASKNLDVDTDECIVIEDALAGVQAAKAAEMRCIAVTTTLE  278

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+PSLIRK I
Sbjct  279  EDALQQASPSLIRKNI  294



>gb|KFK22541.1| hypothetical protein AALP_AAs68488U000300 [Arabis alpina]
Length=1058

 Score =   301 bits (772),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRA VDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  87   CNSEDLSRRAGVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVQGFDPDAAKKRF  146

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK +GLKVAVASSADRIKVDANL AAGLSL MFD
Sbjct  147  FEIYLDKYAKPESGIGFPGALELVTECKKRGLKVAVASSADRIKVDANLKAAGLSLDMFD  206

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  207  AIVSADAFENLKPAPDIFLAASKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  266

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  267  EAILKDAGPSMIRDNI  282



>ref|XP_006392420.1| hypothetical protein EUTSA_v10023228mg [Eutrema salsugineum]
 gb|ESQ29706.1| hypothetical protein EUTSA_v10023228mg [Eutrema salsugineum]
Length=1113

 Score =   301 bits (771),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VKGV GF+P+AAKKRF
Sbjct  147  CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKGVKGFDPDAAKKRF  206

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  207  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRIKVDANLKAAGLSLTMFD  266

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  267  AIVSADAFENLKPAPDIFLAASKNLGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  326

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  327  EAVLKDAGPSMIRDDI  342



>ref|XP_002891968.1| hypothetical protein ARALYDRAFT_892829 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68227.1| hypothetical protein ARALYDRAFT_892829 [Arabidopsis lyrata subsp. 
lyrata]
Length=1058

 Score =   300 bits (769),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 160/196 (82%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVFAEMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAKKRF
Sbjct  89   CNSEDLSRRAAVDVFAEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL MFD
Sbjct  149  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLKMFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  209  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  269  EAILKDAGPSMIRDDI  284



>gb|AAG51506.1|AC058785_9 hypothetical protein [Arabidopsis thaliana]
Length=1041

 Score =   298 bits (764),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAK+RF
Sbjct  86   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKERF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  146  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  265

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  266  EAILKDAGPSMIRDDI  281



>ref|NP_564718.2| protein SUPPRESSOR OF QUENCHING 1 [Arabidopsis thaliana]
 gb|AAL38840.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33400.1| haloacid dehalogenase-like hydrolase family protein [Arabidopsis 
thaliana]
Length=1055

 Score =   298 bits (764),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 175/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAK+RF
Sbjct  86   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKERF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  146  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  206  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  265

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  266  EAILKDAGPSMIRDDI  281



>emb|CCD74491.1| haloacid dehalogenase-like hydrolase domain-containing protein 
[Arabidopsis halleri subsp. halleri]
Length=1028

 Score =   298 bits (762),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAKKRF
Sbjct  89   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELV +CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  149  FEIYLDKYAKPESGIGFPGALELVNECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV TTL+
Sbjct  209  AIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKTTLS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  269  EAILKDAGPSMIRDDI  284



>ref|XP_004984596.1| PREDICTED: NHL repeat-containing protein 2-like isoform X1 [Setaria 
italica]
Length=1092

 Score =   298 bits (764),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR+A VDVFAEMGV+VTV+DF PF G GEANFLGGVA VKGV  FNPE+AKKRF
Sbjct  94   CNSEEPSRQAGVDVFAEMGVEVTVDDFVPFMGTGEANFLGGVARVKGVKDFNPESAKKRF  153

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAK NSGIGFPGA EL+ +CK+ GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  154  FEIYLDKYAKLNSGIGFPGALELIMECKNAGLKVAVASSADRIKVDANLAAAGLPVSLFD  213

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFE LKPAPDIFLAASK L V  SEC+VIEDALAG+QAAKAA+MRCIAVTTTL 
Sbjct  214  AIVSADAFEKLKPAPDIFLAASKNLGVDTSECIVIEDALAGVQAAKAAEMRCIAVTTTLE  273

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++  +PSLIRK I
Sbjct  274  EDALQEGSPSLIRKNI  289



>ref|XP_010938229.1| PREDICTED: LOW QUALITY PROTEIN: NHL repeat-containing protein 
2 [Elaeis guineensis]
Length=1099

 Score =   298 bits (764),  Expect = 1e-89, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 178/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSR AAVDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  101  CNSEEPSRMAAVDVFAEMGVSVTVDDFVPFMGTGEANFLGGVASVKGVTGFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK  GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELIMECKRIGLKVAVASSADRIKVDANLAAAGLPISIFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L++PP EC+VIEDALAG+QAAKAA MRCIAVTTTL 
Sbjct  221  AIVSADAFENLKPAPDIFLAASKSLSIPPGECIVIEDALAGVQAAKAAHMRCIAVTTTLT  280

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A+PSLIRK I
Sbjct  281  EETLQQASPSLIRKDI  296



>ref|XP_011466179.1| PREDICTED: LOW QUALITY PROTEIN: NHL repeat-containing protein 
2 [Fragaria vesca subsp. vesca]
Length=1066

 Score =   297 bits (760),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 176/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAV+VFAEMGV+ TVEDF PF G GEANFLGGVA+VKGV GF+ EAAKKRF
Sbjct  89   CNSEELSRRAAVEVFAEMGVETTVEDFIPFGGTGEANFLGGVASVKGVKGFDTEAAKKRF  148

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAKP+SGIGFPGA ELVTQCKSKGLKVAVASSAD IKV ANL AA L LS+FD
Sbjct  149  FEIYLEKYAKPDSGIGFPGALELVTQCKSKGLKVAVASSADLIKVKANLAAANLPLSLFD  208

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKP+PDIFLAASKIL+V PSEC+VIEDALAG+QAAK+AKMRCIAV TT +
Sbjct  209  AIVSADAFENLKPSPDIFLAASKILDVIPSECIVIEDALAGVQAAKSAKMRCIAVKTTFS  268

Query  202  EDTIEAAAPSLIRKGI  155
            E+ +++A PS+IR  I
Sbjct  269  EEALKSAGPSIIRNHI  284



>ref|XP_010228705.1| PREDICTED: NHL repeat-containing protein 2 isoform X3 [Brachypodium 
distachyon]
Length=944

 Score =   295 bits (755),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSRRAAVDVFAEMGV+ TV+DF PF G GEANFLGGVA VK V  FNPE+AKKRF
Sbjct  128  CDSEEPSRRAAVDVFAEMGVEATVDDFIPFMGTGEANFLGGVARVKEVKDFNPESAKKRF  187

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CKS GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  188  FEIYLDKYAKPNSGIGFPGALELIMECKSAGLKVAVASSADRIKVDANLAAAGLPVSLFD  247

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V  +EC+VIEDALAG+QAAKAA++RCIAVTTTL 
Sbjct  248  AIVSADAFENLKPAPDIFLAASKNLGVDTNECIVIEDALAGVQAAKAAEIRCIAVTTTLE  307

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+P  IRK I
Sbjct  308  EDELQQASPVFIRKDI  323



>gb|EYU38416.1| hypothetical protein MIMGU_mgv1a000526mg [Erythranthe guttata]
Length=1094

 Score =   296 bits (759),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 164/196 (84%), Positives = 179/196 (91%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SR AAVDVFAEMGVQV V+DF PF G GEA FLGGVA+VKGV GFNPEAAKKRF
Sbjct  91   CNSEDLSRLAAVDVFAEMGVQVAVQDFIPFMGTGEAKFLGGVASVKGVKGFNPEAAKKRF  150

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP+SGIGFPGA+EL+ QCK+KGLKVAVASSADRIKVDANL AAGL LSMFD
Sbjct  151  FEIYLDKYAKPSSGIGFPGAYELIVQCKNKGLKVAVASSADRIKVDANLAAAGLQLSMFD  210

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASKIL+VP +EC+VIEDALAG+QAAK+A MRCIAVTTTL 
Sbjct  211  AIVSADAFENLKPAPDIFLAASKILDVPTNECIVIEDALAGVQAAKSANMRCIAVTTTLG  270

Query  202  EDTIEAAAPSLIRKGI  155
            E+T+ AA PSL+RK I
Sbjct  271  EETLTAAGPSLVRKEI  286



>ref|XP_008808704.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Phoenix 
dactylifera]
Length=1067

 Score =   296 bits (758),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  101  CNSEELSRMAAVDVFAEMGVSVTVDDFVPFMGTGEANFLGGVASVKGVTGFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK  G KVAVASSADRIKVDANL AAGL LS+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELIRECKRSGFKVAVASSADRIKVDANLAAAGLPLSIFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L++PPSEC+VIEDALAG+QAAKAA MRCIAVTTTL 
Sbjct  221  AIVSADAFENLKPAPDIFLAASKSLSIPPSECIVIEDALAGVQAAKAAHMRCIAVTTTLT  280

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A+PSLIRK I
Sbjct  281  EETLQQASPSLIRKDI  296



>ref|XP_008808706.1| PREDICTED: NHL repeat-containing protein 2 isoform X4 [Phoenix 
dactylifera]
Length=1046

 Score =   296 bits (757),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  101  CNSEELSRMAAVDVFAEMGVSVTVDDFVPFMGTGEANFLGGVASVKGVTGFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK  G KVAVASSADRIKVDANL AAGL LS+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELIRECKRSGFKVAVASSADRIKVDANLAAAGLPLSIFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L++PPSEC+VIEDALAG+QAAKAA MRCIAVTTTL 
Sbjct  221  AIVSADAFENLKPAPDIFLAASKSLSIPPSECIVIEDALAGVQAAKAAHMRCIAVTTTLT  280

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A+PSLIRK I
Sbjct  281  EETLQQASPSLIRKDI  296



>ref|XP_008808703.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Phoenix 
dactylifera]
Length=1099

 Score =   296 bits (758),  Expect = 5e-89, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  101  CNSEELSRMAAVDVFAEMGVSVTVDDFVPFMGTGEANFLGGVASVKGVTGFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK  G KVAVASSADRIKVDANL AAGL LS+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELIRECKRSGFKVAVASSADRIKVDANLAAAGLPLSIFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L++PPSEC+VIEDALAG+QAAKAA MRCIAVTTTL 
Sbjct  221  AIVSADAFENLKPAPDIFLAASKSLSIPPSECIVIEDALAGVQAAKAAHMRCIAVTTTLT  280

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A+PSLIRK I
Sbjct  281  EETLQQASPSLIRKDI  296



>ref|XP_008808705.1| PREDICTED: NHL repeat-containing protein 2 isoform X3 [Phoenix 
dactylifera]
Length=1063

 Score =   296 bits (757),  Expect = 7e-89, Method: Composition-based stats.
 Identities = 163/196 (83%), Positives = 177/196 (90%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR AAVDVFAEMGV VTV+DF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  101  CNSEELSRMAAVDVFAEMGVSVTVDDFVPFMGTGEANFLGGVASVKGVTGFDPEAAKKRF  160

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK  G KVAVASSADRIKVDANL AAGL LS+FD
Sbjct  161  FEIYLDKYAKPNSGIGFPGALELIRECKRSGFKVAVASSADRIKVDANLAAAGLPLSIFD  220

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L++PPSEC+VIEDALAG+QAAKAA MRCIAVTTTL 
Sbjct  221  AIVSADAFENLKPAPDIFLAASKSLSIPPSECIVIEDALAGVQAAKAAHMRCIAVTTTLT  280

Query  202  EDTIEAAAPSLIRKGI  155
            E+T++ A+PSLIRK I
Sbjct  281  EETLQQASPSLIRKDI  296



>gb|ABF95582.1| HAD-superfamily hydrolase, subfamily IA, variant 3 containing 
protein, expressed [Oryza sativa Japonica Group]
Length=772

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VD+FAEMGV VT +DF P+ G GEANFLGGVA +KGV  FN E+AKKRF
Sbjct  92   CNSEELSRLAGVDLFAEMGVDVTGDDFVPYMGTGEANFLGGVAKLKGVKDFNAESAKKRF  151

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPN+GIGFPGA +LVT+CK+ GLKVAVASSADRIKVDANL AAGL LS+FD
Sbjct  152  FEIYLDKYAKPNAGIGFPGALDLVTECKNAGLKVAVASSADRIKVDANLAAAGLPLSLFD  211

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAAKAA+MRCIAV TTL 
Sbjct  212  AIVSADAFENLKPAPDIFLAASKTLGVDTDECIVIEDALAGVQAAKAAEMRCIAVMTTLE  271

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+PSLIRK I
Sbjct  272  EDALQQASPSLIRKNI  287



>ref|XP_010228703.1| PREDICTED: NHL repeat-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=1131

 Score =   295 bits (756),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSRRAAVDVFAEMGV+ TV+DF PF G GEANFLGGVA VK V  FNPE+AKKRF
Sbjct  128  CDSEEPSRRAAVDVFAEMGVEATVDDFIPFMGTGEANFLGGVARVKEVKDFNPESAKKRF  187

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CKS GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  188  FEIYLDKYAKPNSGIGFPGALELIMECKSAGLKVAVASSADRIKVDANLAAAGLPVSLFD  247

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V  +EC+VIEDALAG+QAAKAA++RCIAVTTTL 
Sbjct  248  AIVSADAFENLKPAPDIFLAASKNLGVDTNECIVIEDALAGVQAAKAAEIRCIAVTTTLE  307

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+P  IRK I
Sbjct  308  EDELQQASPVFIRKDI  323



>ref|XP_010228704.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Brachypodium 
distachyon]
Length=1128

 Score =   295 bits (755),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEEPSRRAAVDVFAEMGV+ TV+DF PF G GEANFLGGVA VK V  FNPE+AKKRF
Sbjct  128  CDSEEPSRRAAVDVFAEMGVEATVDDFIPFMGTGEANFLGGVARVKEVKDFNPESAKKRF  187

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CKS GLKVAVASSADRIKVDANL AAGL +S+FD
Sbjct  188  FEIYLDKYAKPNSGIGFPGALELIMECKSAGLKVAVASSADRIKVDANLAAAGLPVSLFD  247

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V  +EC+VIEDALAG+QAAKAA++RCIAVTTTL 
Sbjct  248  AIVSADAFENLKPAPDIFLAASKNLGVDTNECIVIEDALAGVQAAKAAEIRCIAVTTTLE  307

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+P  IRK I
Sbjct  308  EDELQQASPVFIRKDI  323



>ref|XP_010480258.1| PREDICTED: NHL repeat-containing protein 2-like [Camelina sativa]
Length=1059

 Score =   294 bits (752),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 155/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAVDVFAEMGV+V+V+DF PFTG GEA FLGGVA++KGV GF+  A KKRF
Sbjct  90   CNSEELSRRAAVDVFAEMGVEVSVDDFIPFTGKGEAKFLGGVASIKGVQGFDTGALKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK++GLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  150  FEIYLDKYAKPESGIGFPGALELVTECKNRGLKVAVASSADRIKVDANLKAAGLSLTMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKP+PDIFLAA+KIL  P SECVVIEDALAG+QAA+AA MRCIAV T+L+
Sbjct  210  AIVSADAFENLKPSPDIFLAAAKILGAPTSECVVIEDALAGVQAAQAANMRCIAVKTSLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  270  EAILKDAGPSMIRDDI  285



>ref|XP_010511290.1| PREDICTED: NHL repeat-containing protein 2-like isoform X1 [Camelina 
sativa]
Length=1059

 Score =   293 bits (751),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAVDVFAEMGV+VT +DF PFTG GEA FLGGVA++KGV GF+ +A KKRF
Sbjct  90   CNSEELSRRAAVDVFAEMGVEVTEDDFIPFTGKGEAKFLGGVASIKGVQGFDTDALKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYA P SGIGFPGA ELVT+CK++GLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  150  FEIYLDKYATPESGIGFPGALELVTECKNRGLKVAVASSADRIKVDANLKAAGLSLTMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKP+PDIFLAA+KIL  P SECVVIEDALAG+QAA+AA MRCIAV T+L+
Sbjct  210  AIVSADAFENLKPSPDIFLAAAKILGAPTSECVVIEDALAGVQAAQAANMRCIAVKTSLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E +++ A PS+IR  I
Sbjct  270  EASLKDAGPSMIRDNI  285



>gb|EMS60685.1| NHL repeat-containing protein 2 [Triticum urartu]
Length=1316

 Score =   295 bits (754),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAEMGV VTV+DF PFTG GEANFLGGVA VKGV  F+ E+AKKRF
Sbjct  94   CNSEEPSRRAAVDVFAEMGVDVTVDDFIPFTGTGEANFLGGVARVKGVKDFSTESAKKRF  153

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPNSGIGFPGA EL+ +CK+ GLKVAVASSADR+KVDANL AAGL +S+FD
Sbjct  154  FEIYLDKYAKPNSGIGFPGALELIMECKNAGLKVAVASSADRVKVDANLAAAGLPVSLFD  213

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAAKAA++RCIAVTT+L 
Sbjct  214  AIVSADAFENLKPAPDIFLAASKNLGVDTDECIVIEDALAGVQAAKAAEIRCIAVTTSLD  273

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+P  IRK I
Sbjct  274  EDALQQASPVFIRKDI  289



>gb|ABF95581.1| HAD-superfamily hydrolase, subfamily IA, variant 3 containing 
protein, expressed [Oryza sativa Japonica Group]
Length=1064

 Score =   293 bits (749),  Expect = 9e-88, Method: Composition-based stats.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VD+FAEMGV VT +DF P+ G GEANFLGGVA +KGV  FN E+AKKRF
Sbjct  92   CNSEELSRLAGVDLFAEMGVDVTGDDFVPYMGTGEANFLGGVAKLKGVKDFNAESAKKRF  151

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPN+GIGFPGA +LVT+CK+ GLKVAVASSADRIKVDANL AAGL LS+FD
Sbjct  152  FEIYLDKYAKPNAGIGFPGALDLVTECKNAGLKVAVASSADRIKVDANLAAAGLPLSLFD  211

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAAKAA+MRCIAV TTL 
Sbjct  212  AIVSADAFENLKPAPDIFLAASKTLGVDTDECIVIEDALAGVQAAKAAEMRCIAVMTTLE  271

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+PSLIRK I
Sbjct  272  EDALQQASPSLIRKNI  287



>ref|XP_010414996.1| PREDICTED: NHL repeat-containing protein 2-like [Camelina sativa]
Length=1059

 Score =   292 bits (748),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SRRAAVDVFAEMGV+VT +DF PFTG GEA FLGGVA++KGV GF+ +A KKRF
Sbjct  90   CNSEELSRRAAVDVFAEMGVEVTEDDFIPFTGKGEAKFLGGVASIKGVQGFDTDALKKRF  149

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYA P SGIGFPGA ELVT+CK++GLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  150  FEIYLDKYATPESGIGFPGALELVTECKNRGLKVAVASSADRIKVDANLKAAGLSLTMFD  209

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKP+PDIFLAA+KIL  P SECVVIEDALAG+QAA+AA MRCIAV T+L+
Sbjct  210  AIVSADAFENLKPSPDIFLAAAKILGAPTSECVVIEDALAGVQAAQAANMRCIAVKTSLS  269

Query  202  EDTIEAAAPSLIRKGI  155
            E  ++ A PS+IR  I
Sbjct  270  EAILKDAGPSMIRDDI  285



>gb|EEE58932.1| hypothetical protein OsJ_10596 [Oryza sativa Japonica Group]
Length=1017

 Score =   288 bits (738),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VD+FAEMGV VT +DF P+ G GEANFLGGVA +KGV  FN E+AKKRF
Sbjct  6    CNSEELSRLAGVDLFAEMGVDVTGDDFVPYMGTGEANFLGGVAKLKGVKDFNAESAKKRF  65

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPN+GIGFPGA +LVT+CK+ GLKVAVASSADRIKVDANL AAGL LS+FD
Sbjct  66   FEIYLDKYAKPNAGIGFPGALDLVTECKNAGLKVAVASSADRIKVDANLAAAGLPLSLFD  125

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAAKAA+MRCIAV TTL 
Sbjct  126  AIVSADAFENLKPAPDIFLAASKTLGVDTDECIVIEDALAGVQAAKAAEMRCIAVMTTLE  185

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+PSLIRK I
Sbjct  186  EDALQQASPSLIRKNI  201



>gb|EEC73215.1| hypothetical protein OsI_07299 [Oryza sativa Indica Group]
Length=1103

 Score =   288 bits (738),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 170/196 (87%), Gaps = 0/196 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR A VD+FAEMGV VT +DF P+ G GEANFLGGVA +KGV  FN E+AKKRF
Sbjct  92   CNSEELSRLAGVDLFAEMGVDVTGDDFVPYMGTGEANFLGGVAKLKGVKDFNAESAKKRF  151

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKPN+GIGFPGA +LVT+CK+ GLKVAVASSADRIKVDANL AAGL LS+FD
Sbjct  152  FEIYLDKYAKPNAGIGFPGALDLVTECKNAGLKVAVASSADRIKVDANLAAAGLPLSLFD  211

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSADAFENLKPAPDIFLAASK L V   EC+VIEDALAG+QAAKAA+MRCIAV TTL 
Sbjct  212  AIVSADAFENLKPAPDIFLAASKTLGVDTDECIVIEDALAGVQAAKAAEMRCIAVMTTLE  271

Query  202  EDTIEAAAPSLIRKGI  155
            ED ++ A+PSLIRK I
Sbjct  272  EDALQQASPSLIRKNI  287



>dbj|BAH56807.1| AT1G56500 [Arabidopsis thaliana]
Length=236

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSE+ SRRAAVDVF EMGV+VTV+DF PF G GEA FLGGVA+VK V GF+P+AAK+RF
Sbjct  86   CNSEDLSRRAAVDVFTEMGVEVTVDDFVPFMGTGEAKFLGGVASVKEVKGFDPDAAKERF  145

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYLDKYAKP SGIGFPGA ELVT+CK+KGLKVAVASSADRIKVDANL AAGLSL+MFD
Sbjct  146  FEIYLDKYAKPESGIGFPGALELVTECKNKGLKVAVASSADRIKVDANLKAAGLSLTMFD  205

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSE  290
            AIVSADAFENLKPAPDIFLAA+KIL VP SE
Sbjct  206  AIVSADAFENLKPAPDIFLAAAKILGVPTSE  236



>ref|XP_010101865.1| Protein CbbY [Morus notabilis]
 gb|EXB90002.1| Protein CbbY [Morus notabilis]
Length=282

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEEPSRRAAVDVFAE+GV VTVEDF PF G GEANFLGGVA+VKGV GF+PEAAKKRF
Sbjct  83   CNSEEPSRRAAVDVFAELGVDVTVEDFVPFMGTGEANFLGGVASVKGVQGFDPEAAKKRF  142

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FEIYL+KYAK NSGIGFPGA EL+TQCKSKGLKVAVASSADRIKVDANL AA L L MF+
Sbjct  143  FEIYLEKYAKTNSGIGFPGALELITQCKSKGLKVAVASSADRIKVDANLAAAALPLPMFN  202

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSE  290
            AIVSADAFENLKPAPDIFLAASKILNVP SE
Sbjct  203  AIVSADAFENLKPAPDIFLAASKILNVPTSE  233



>gb|KHN03928.1| NHL repeat-containing protein 2 [Glycine soja]
Length=413

 Score =   253 bits (646),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -1

Query  646  MGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGL  467
            +GEANFLGGVA+VKG+ GF+ EAAK RFFEIYLDKYAKP+SGIGFPGA EL++QCKSKGL
Sbjct  2    IGEANFLGGVASVKGIKGFDTEAAKTRFFEIYLDKYAKPDSGIGFPGALELISQCKSKGL  61

Query  466  KVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSEC  287
            KVAVASSADRIKVDANL AAGL LSMFDAIVSA AFENLKPAPDIFLAAS+ILNVPP+EC
Sbjct  62   KVAVASSADRIKVDANLAAAGLPLSMFDAIVSAYAFENLKPAPDIFLAASRILNVPPNEC  121

Query  286  VVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIRKGI  155
            +VIEDALAG+QAAKAA+MRCIAV TTL+++ +E A P+LIR  I
Sbjct  122  IVIEDALAGLQAAKAAQMRCIAVRTTLSDENLEPAGPTLIRDNI  165



>ref|XP_002974809.1| hypothetical protein SELMODRAFT_101985 [Selaginella moellendorffii]
 gb|EFJ24329.1| hypothetical protein SELMODRAFT_101985 [Selaginella moellendorffii]
Length=1049

 Score =   258 bits (660),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEE SR AAVDVFA MGV V  EDF PF G GEANFLGGVA +  V GF+P  AK++F
Sbjct  85   CDSEERSRDAAVDVFAGMGVTVRPEDFIPFMGTGEANFLGGVAGLYQVPGFDPIQAKEKF  144

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FE+Y+ KYAKP+SG+G+PGA EL+ +CK  GLKVAVASSADRIKVDANL+AAGL  + FD
Sbjct  145  FEVYIQKYAKPDSGLGYPGALELIMECKRAGLKVAVASSADRIKVDANLSAAGLPQTNFD  204

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSAD FE LKPAPDIFLAA+K L +PPSECVV+EDALAG+QAA+AA MRCIAV+TTL+
Sbjct  205  AIVSADVFERLKPAPDIFLAAAKALGLPPSECVVVEDALAGVQAARAAGMRCIAVSTTLS  264

Query  202  EDTIEAAAPSLIRKGIS  152
            E+++  A P+L R  I+
Sbjct  265  EESLAKANPTLTRMNIA  281



>ref|XP_002963725.1| hypothetical protein SELMODRAFT_79954 [Selaginella moellendorffii]
 gb|EFJ35596.1| hypothetical protein SELMODRAFT_79954 [Selaginella moellendorffii]
Length=1052

 Score =   258 bits (659),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SEE SR AAVDVFA MGV V  EDF PF G GEANFLGGVA +  V GF+P  AK++F
Sbjct  88   CDSEERSRDAAVDVFAGMGVTVRPEDFIPFMGTGEANFLGGVAGLYQVPGFDPIQAKEKF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            FE+Y+ KYAKP+SG+G+PGA EL+ +CK  GLKVAVASSADRIKVDANL+AAGL  + FD
Sbjct  148  FEVYIQKYAKPDSGLGYPGALELIMECKRAGLKVAVASSADRIKVDANLSAAGLPQTNFD  207

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AIVSAD FE LKPAPDIFLAA+K L +PPSECVV+EDALAG+QAA+AA MRCIAV+TTL+
Sbjct  208  AIVSADVFERLKPAPDIFLAAAKALGLPPSECVVVEDALAGVQAARAAGMRCIAVSTTLS  267

Query  202  EDTIEAAAPSLIRKGIS  152
            E+++  A P+L R  I+
Sbjct  268  EESLAKANPTLTRMNIA  284



>ref|XP_001766513.1| predicted protein [Physcomitrella patens]
 gb|EDQ68578.1| predicted protein, partial [Physcomitrella patens]
Length=216

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SE  SR+AAV++FAEMG  V  +DF PF G G+ANFLGGVA   G+  F+  +AKKR+
Sbjct  13   CDSEHCSRKAAVELFAEMGYIVDDKDFIPFMGTGDANFLGGVARKYGIKDFDTASAKKRY  72

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            ++IY+ K+A PNSG+G+PGA +L+ QCK  GLK+AVASSADR+KVDANL AAG+  + FD
Sbjct  73   YQIYIGKFATPNSGLGYPGALDLILQCKEAGLKLAVASSADRVKVDANLAAAGIPQNTFD  132

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            AI++AD FE LKPAPD FLAA++ L +PP ECVVIEDA+AG+QAA+AA MRCI+VTTTL+
Sbjct  133  AIIAADLFERLKPAPDAFLAAAESLGLPPHECVVIEDAIAGVQAARAAGMRCISVTTTLS  192

Query  202  EDTIEAAAPSLIRKGIS  152
            ++ + A  P L+R+ IS
Sbjct  193  KEQLTAEGPQLVREDIS  209



>ref|XP_001764907.1| predicted protein [Physcomitrella patens]
 gb|EDQ70349.1| predicted protein [Physcomitrella patens]
Length=1040

 Score =   249 bits (636),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 159/198 (80%), Gaps = 1/198 (1%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            C+SE  SR+AAV++FAEMG  VT EDF PF G GEANFLGGVA   GV  F+  +AK+RF
Sbjct  63   CDSEHCSRKAAVELFAEMGYNVTEEDFIPFMGTGEANFLGGVAKKYGVKDFDTVSAKRRF  122

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F+IY++K+A PNSG+G+PGA +L+ QCK  GLK+AVASSADR+KVDANL AAG   S FD
Sbjct  123  FQIYIEKFAPPNSGLGYPGALDLILQCKEAGLKLAVASSADRVKVDANLAAAGFPQSNFD  182

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKM-RCIAVTTTL  206
            AIVSAD FENLKPAPDIF+AA+K L +P  ECVVIEDA AGIQAA+AA M RCI+VTTTL
Sbjct  183  AIVSADLFENLKPAPDIFIAAAKSLGLPTHECVVIEDAYAGIQAARAAGMSRCISVTTTL  242

Query  205  AEDTIEAAAPSLIRKGIS  152
            +E+ +  A P L+RK IS
Sbjct  243  SEEKLMEAGPQLVRKDIS  260



>ref|XP_010313611.1| PREDICTED: NHL repeat-containing protein 2 isoform X3 [Solanum 
lycopersicum]
Length=978

 Score =   238 bits (606),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -1

Query  601  VLGFNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDA  422
            V GF+ EAAKKRFFEIYL KYAKPNSGIGFPGAFELV+QCKS GLKVAVASSADRIKVDA
Sbjct  5    VEGFDTEAAKKRFFEIYLSKYAKPNSGIGFPGAFELVSQCKSSGLKVAVASSADRIKVDA  64

Query  421  NLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaaka  242
            NL AAGL ++MFDAIVSADAF+NLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKA
Sbjct  65   NLAAAGLPITMFDAIVSADAFKNLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKA  124

Query  241  AKMRCIAVTTTLAEDTIEAAAPSLIRKGIS  152
            AKMRCIAVTTTL+EDT+ AA PSLIRK IS
Sbjct  125  AKMRCIAVTTTLSEDTLNAAEPSLIRKEIS  154



>ref|XP_006577734.1| PREDICTED: uncharacterized protein LOC102664458 [Glycine max]
Length=312

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  556  IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAI  377
            + L   AKP+SGIGFPGA EL++QCKSKGLKVAVASSADRIKVDANL AAGL LSMFDAI
Sbjct  133  LLLVSVAKPDSGIGFPGALELISQCKSKGLKVAVASSADRIKVDANLAAAGLPLSMFDAI  192

Query  376  VSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAED  197
            VSADAFENLKPAPDIFLAAS+ILNVPP+EC+VIEDALAG+QA KAA+MRCIAV TTL+++
Sbjct  193  VSADAFENLKPAPDIFLAASRILNVPPNECIVIEDALAGLQAVKAAQMRCIAVRTTLSDE  252

Query  196  TIEAAAPSLIRKGI  155
            T+E A P+LIR  I
Sbjct  253  TLEPAGPTLIRDNI  266



>gb|ABR17375.1| unknown [Picea sitchensis]
Length=223

 Score =   188 bits (478),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            CNSEE SR+AAVDVFAEMG++VT EDF PF G GEANFLGGVA VK V  F+P AAKKRF
Sbjct  88   CNSEEASRQAAVDVFAEMGIEVTTEDFIPFMGTGEANFLGGVARVKSVKDFDPVAAKKRF  147

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
            FEIYL KYA+PNSG+G+PG+ EL+ QCK+KGLKVAVASSADRIKV+ANL AAGL  S
Sbjct  148  FEIYLKKYARPNSGLGYPGSLELILQCKNKGLKVAVASSADRIKVNANLAAAGLHQS  204



>ref|XP_005719288.1| HAD-superfamily hydrolase [Chondrus crispus]
 emb|CDF39377.1| HAD-superfamily hydrolase [Chondrus crispus]
Length=235

 Score =   183 bits (464),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 136/194 (70%), Gaps = 2/194 (1%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEM-GVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKR  566
            C+SE PSR AAV +F +   V V+ +DF+PFTG GEANFL GVA +  V  F+P+ AK R
Sbjct  6    CDSELPSRHAAVALFDQFYNVSVSADDFSPFTGTGEANFLAGVAALYRVPAFDPDEAKAR  65

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            FF+IY  +    +    FPG   LV + K+ GLKVAVAS+ADR+KVDANL A GL    F
Sbjct  66   FFDIYTSREYIADLA-PFPGVVSLVQRVKALGLKVAVASAADRVKVDANLNAIGLPPETF  124

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            + I S+D   N KPAPD+FLAA+  LNV P  CVVIEDA+AG+QAAKAA MRCIAV+T+L
Sbjct  125  NFITSSDFIPNKKPAPDVFLAAANGLNVRPDRCVVIEDAIAGVQAAKAAGMRCIAVSTSL  184

Query  205  AEDTIEAAAPSLIR  164
              D +E  AP +IR
Sbjct  185  PSDLLEKEAPDVIR  198



>ref|XP_005846618.1| hypothetical protein CHLNCDRAFT_31604 [Chlorella variabilis]
 gb|EFN54516.1| hypothetical protein CHLNCDRAFT_31604 [Chlorella variabilis]
Length=1072

 Score =   183 bits (465),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 141/194 (73%), Gaps = 4/194 (2%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEM-GVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKR  566
            C+SEE SR AA +V  E+ G++V   +F  +TG GEANFLGGVA   G   F  E+ K +
Sbjct  91   CDSEEISREAACEVMKELYGLEVEPSEFIEYTGTGEANFLGGVARKYGA-PFEVESCKAK  149

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            FFEIY+ +YA+  S I   GA  LV  C++ GLK AVASSADR+KVDANL A+ + L +F
Sbjct  150  FFEIYM-RYAQKTS-IAHAGARSLVEACRAAGLKTAVASSADRVKVDANLAASDIPLDLF  207

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            DAIVSADAF+NLKP+PDIFLAA+  L V P+ CVVIEDA+AG+QAA+AA MR I V+TTL
Sbjct  208  DAIVSADAFQNLKPSPDIFLAAAAQLGVDPANCVVIEDAVAGVQAARAAGMRVIGVSTTL  267

Query  205  AEDTIEAAAPSLIR  164
                +++AAP  I+
Sbjct  268  TPAVMQSAAPDWIQ  281



>ref|XP_005703482.1| phosphoglycolate phosphatase [Galdieria sulphuraria]
 gb|EME26962.1| phosphoglycolate phosphatase [Galdieria sulphuraria]
Length=248

 Score =   171 bits (433),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/195 (53%), Positives = 128/195 (66%), Gaps = 1/195 (1%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEM-GVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKR  566
            C+SE  SR AA  +F++   V+V  E FA FTG GE  FL GVA +  V  F+P  AK+R
Sbjct  36   CDSEILSRLAAATMFSQYHNVRVKPEHFAAFTGQGEERFLSGVAEMYNVPHFDPVIAKQR  95

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            FF+IY+ +YA       +PG  +L+  CK  GL VAVASSADRIKV ANL   GL   +F
Sbjct  96   FFDIYISQYALSGKLHSYPGVKDLIAVCKKVGLFVAVASSADRIKVRANLLGIGLDEQIF  155

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            D IV +D  E  KP PDIFL A+K L V P  CVVIEDA AGIQAAK A MRCIAVTT+L
Sbjct  156  DYIVESDQIERKKPFPDIFLQAAKGLGVNPERCVVIEDATAGIQAAKEAGMRCIAVTTSL  215

Query  205  AEDTIEAAAPSLIRK  161
            + + + +  P +I++
Sbjct  216  SAEQLSSLYPDVIKE  230



>ref|WP_038153621.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA164-N20]
Length=191

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 122/175 (70%), Gaps = 3/175 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE     A+V +FAE+GVQV  EDF P+ G GE +++GGVA   G +  +   AK R +
Sbjct  19   DSEPLINEASVKMFAELGVQVQPEDFYPYVGTGEKHYIGGVAEKYG-MTIDLFEAKMRIY  77

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
            EIYL K A P     FPGA ELV +C+ +G K+ VASSAD IK++AN+T  GL L  +DA
Sbjct  78   EIYL-KLA-PRKLRSFPGAVELVHRCRDQGWKIGVASSADMIKIEANMTQIGLPLETWDA  135

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVT  215
            +  AD  E+ KPAPDIFLAA+K L V PS+CVVIEDA  G+QAAK+A MRC+AVT
Sbjct  136  VTGADHVEHKKPAPDIFLAAAKQLEVMPSQCVVIEDASHGVQAAKSAGMRCVAVT  190



>ref|XP_005646493.1| hypothetical protein COCSUDRAFT_16964 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21949.1| hypothetical protein COCSUDRAFT_16964 [Coccomyxa subellipsoidea 
C-169]
Length=1021

 Score =   174 bits (440),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 133/199 (67%), Gaps = 2/199 (1%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEM-GVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKR  566
            CNSEE ++R   +   ++ GV V  ++F  F GMGEA FL GVA   G+   + +  K+ 
Sbjct  34   CNSEEMTQRVGAETLLKVYGVTVDPDEFRAFAGMGEAYFLSGVAGKYGIQIDDIDKLKEV  93

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM-  389
            F+ IYL+K A P   IG PGA ELV  C+  GLKVAVASSADR+KVDANL   G      
Sbjct  94   FYGIYLEKAADPTEDIGLPGAIELVKACREAGLKVAVASSADRVKVDANLKLVGFDAEAD  153

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            FDAIVSAD FE LKPAPDIFLAA++ + V PS C+V+EDA AG+QAA+AA MR + VTTT
Sbjct  154  FDAIVSADLFERLKPAPDIFLAAAREVGVEPSACIVVEDAAAGVQAARAAGMRVVGVTTT  213

Query  208  LAEDTIEAAAPSLIRKGIS  152
            L++  + A  P  +R  I+
Sbjct  214  LSKQDMLAQRPDEVRPTIA  232



>ref|XP_006382374.1| hypothetical protein POPTR_0005s01550g, partial [Populus trichocarpa]
 gb|ERP60171.1| hypothetical protein POPTR_0005s01550g, partial [Populus trichocarpa]
Length=165

 Score =   158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 94/134 (70%), Gaps = 25/134 (19%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            NSEEP R A VD+FAEMGV+VTVEDF PF  MG AN+L GVAN          A KK F 
Sbjct  48   NSEEPLRMAGVDIFAEMGVEVTVEDFVPF--MGTANYLRGVAN----------AEKKWFC  95

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
            EIYLDKYAKPN GIGFPGA EL+TQCK+KGLKVA+AS+AD +             S FDA
Sbjct  96   EIYLDKYAKPNPGIGFPGALELITQCKNKGLKVAIASNADHV-------------SKFDA  142

Query  379  IVSADAFENLKPAP  338
            IVS DAFENLK AP
Sbjct  143  IVSTDAFENLKQAP  156



>ref|XP_005539373.1| unknown phosphatase CbbY [Cyanidioschyzon merolae strain 10D]
 dbj|BAM83337.1| unknown phosphatase CbbY [Cyanidioschyzon merolae strain 10D]
Length=324

 Score =   155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 121/199 (61%), Gaps = 3/199 (2%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAE-MGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKR  566
            C+SE  SR A V+ F    GV  T +DFA F G GEA FL GVA    V  F+   AK+ 
Sbjct  105  CDSERLSRAAGVEYFRRYHGVWPTEKDFADFAGTGEAAFLSGVARRYSVKDFDVNKAKEG  164

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            FF IY+++Y        F G  E + Q K+ GLK A+ASSAD IKV ANL+A G    MF
Sbjct  165  FFNIYVNEYVSALEP--FEGVREFIQQIKTMGLKTALASSADAIKVHANLSAIGFERDMF  222

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            D +  +D   N KPAPDIFLAA++ L VPP  CVVIEDA AG+ AAK A+MRC+AV T++
Sbjct  223  DFVTRSDEIANKKPAPDIFLAAAEGLGVPPESCVVIEDAPAGVLAAKRARMRCVAVATSV  282

Query  205  AEDTIEAAAPSLIRKGISY  149
            +   +  A   ++R    Y
Sbjct  283  SAQLLWDAGADIVRPAPQY  301



>ref|XP_010544161.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104816864 
[Tarenaya hassleriana]
Length=261

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = -1

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            F + L    +P++GIGFPGA EL T+CK+KGLKVAVASSADRIKV ANLTAAGL LSMFD
Sbjct  12   FVLSLSMLNQPSTGIGFPGALELATECKNKGLKVAVASSADRIKVGANLTAAGLPLSMFD  71

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVI  278
            AIVS DAFEN KPAPDI LAAS+IL+VPPSEC+VI
Sbjct  72   AIVSVDAFENXKPAPDILLAASRILDVPPSECLVI  106



>gb|KIY99936.1| hypothetical protein MNEG_8025 [Monoraphidium neglectum]
Length=195

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 85/162 (52%), Positives = 110/162 (68%), Gaps = 2/162 (1%)
 Frame = -1

Query  646  MGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAK-PNSG-IGFPGAFELVTQCKSK  473
            MGEA FLGGVA   GV  F+   AK+ F EIY++ Y + PN+G I F GA  LV   ++ 
Sbjct  1    MGEARFLGGVAEKYGVQAFDVSEAKRLFLEIYVETYCQGPNAGDIAFQGAVALVRALRAA  60

Query  472  GLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPS  293
            GL  AVASSA R+K+DANL AAG +   F  +VS   FE  KP PD+FLAA++ L + P+
Sbjct  61   GLATAVASSAARVKIDANLGAAGFTPEDFGCVVSGTEFERNKPFPDVFLAAARGLGLAPA  120

Query  292  ECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLI  167
            ECVV+EDA AG++AA+AA MR I VTTTL+   ++A AP  +
Sbjct  121  ECVVLEDAPAGVRAARAAGMRVIGVTTTLSRAEMDAEAPDAV  162



>ref|WP_043922596.1| hypothetical protein [Treponema azotonutricium]
Length=209

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  679  VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSGIGFPGAF  500
            VT EDF PF GMGE  FLGGVA    + GF+ E  KKR +EIY++        +  PGA 
Sbjct  28   VTHEDFLPFVGMGENRFLGGVAEKYRLNGFDIERDKKRTYEIYVEIIKGKLDPL--PGAV  85

Query  499  ELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAA  320
            E V  C + G K A+A+S D IK++A+L A GL+   F+A V+    E  KP PDIFL A
Sbjct  86   EFVKACIAAGYKTALATSTDYIKMNASLEAIGLAHGFFEATVNGLEVERRKPFPDIFLEA  145

Query  319  SKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIRKGIS  152
            ++ + + P  C V+ED++ G+QAAKAA MRC+ + TT  E  I  A   +I K +S
Sbjct  146  ARRIGIAPDHCWVVEDSVGGVQAAKAAGMRCLGLLTTFPEGEIRKAGADIIVKDLS  201



>gb|AEF83038.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Treponema 
azotonutricium ZAS-9]
Length=223

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 107/176 (61%), Gaps = 2/176 (1%)
 Frame = -1

Query  679  VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSGIGFPGAF  500
            VT EDF PF GMGE  FLGGVA    + GF+ E  KKR +EIY++        +  PGA 
Sbjct  42   VTHEDFLPFVGMGENRFLGGVAEKYRLNGFDIERDKKRTYEIYVEIIKGKLDPL--PGAV  99

Query  499  ELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAA  320
            E V  C + G K A+A+S D IK++A+L A GL+   F+A V+    E  KP PDIFL A
Sbjct  100  EFVKACIAAGYKTALATSTDYIKMNASLEAIGLAHGFFEATVNGLEVERRKPFPDIFLEA  159

Query  319  SKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIRKGIS  152
            ++ + + P  C V+ED++ G+QAAKAA MRC+ + TT  E  I  A   +I K +S
Sbjct  160  ARRIGIAPDHCWVVEDSVGGVQAAKAAGMRCLGLLTTFPEGEIRKAGADIIVKDLS  215



>ref|XP_009609094.1| PREDICTED: NHL repeat-containing protein 2 isoform X2 [Nicotiana 
tomentosiformis]
Length=878

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = -1

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            MFDAIVSADAFENLKPAPDIFLAAS+IL+VP SEC+VIEDALAG+QAAKAAKMRCIAVTT
Sbjct  1    MFDAIVSADAFENLKPAPDIFLAASRILDVPTSECIVIEDALAGVQAAKAAKMRCIAVTT  60

Query  211  TLAEDTIEAAAPSLIRKGIS  152
            TL+EDT++AA P+LIRK IS
Sbjct  61   TLSEDTLKAAEPTLIRKEIS  80



>ref|XP_006433547.1| hypothetical protein CICLE_v10000268mg [Citrus clementina]
 gb|ESR46787.1| hypothetical protein CICLE_v10000268mg [Citrus clementina]
Length=844

 Score =   116 bits (290),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 66/79 (84%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -1

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            MFDAIVSADAFENLKPAPDIFL+ASKILNVP SEC+VIEDALAG+QAAKAA+MRCIAVTT
Sbjct  1    MFDAIVSADAFENLKPAPDIFLSASKILNVPTSECIVIEDALAGVQAAKAAQMRCIAVTT  60

Query  211  TLAEDTIEAAAPSLIRKGI  155
            TL+E+ ++ A+PSLIRK I
Sbjct  61   TLSEERLKEASPSLIRKEI  79



>dbj|BAC43111.1| unknown protein [Arabidopsis thaliana]
Length=97

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = -1

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            MFDAIVSADAFENLKPAPDIFLAA+KIL VP SECVVIEDALAG+QAA+AA MRCIAV T
Sbjct  1    MFDAIVSADAFENLKPAPDIFLAAAKILGVPTSECVVIEDALAGVQAAQAANMRCIAVKT  60

Query  211  TLAEDTIEAAAPSLIRKGI  155
            TL+E  ++ A PS+IR  I
Sbjct  61   TLSEAILKDAGPSMIRDDI  79



>gb|EPF30951.1| HAD hydrolase, family IA [Treponema maltophilum ATCC 51939]
Length=228

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 111/197 (56%), Gaps = 3/197 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            NSE+   +A ++ F   GV     DFAPF G GE  F+GGVA   G L  +  AAK   +
Sbjct  15   NSEKEIAQACIEFFKRRGVHAVPADFAPFIGAGENRFIGGVAEKYG-LKIDIAAAKIEAY  73

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
             IY +  +  +  +   G  + +   +  G+K A+A+SAD+IK+D NL A G S+  FD 
Sbjct  74   GIYDELISGTDCAM--KGTADFIRNAQKAGIKTALATSADKIKLDVNLKAIGFSIDDFDY  131

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE  200
             V  +   + KP P+I+L A+  L +   +C+V+EDA+ G+QAAKAA   CI +  + +E
Sbjct  132  AVWGNKVTHKKPDPEIYLTAAAGLGLNACDCLVVEDAVNGVQAAKAAGSLCIGLLGSFSE  191

Query  199  DTIEAAAPSLIRKGISY  149
              ++ A   ++ + +S+
Sbjct  192  AELKRAGADIVLQDLSF  208



>ref|WP_040846718.1| hypothetical protein, partial [Treponema maltophilum]
Length=207

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/196 (36%), Positives = 110/196 (56%), Gaps = 3/196 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            NSE+   +A ++ F   GV     DFAPF G GE  F+GGVA   G L  +  AAK   +
Sbjct  15   NSEKEIAQACIEFFKRRGVHAVPADFAPFIGAGENRFIGGVAEKYG-LKIDIAAAKIEAY  73

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
             IY +  +  +  +   G  + +   +  G+K A+A+SAD+IK+D NL A G S+  FD 
Sbjct  74   GIYDELISGTDCAM--KGTADFIRNAQKAGIKTALATSADKIKLDVNLKAIGFSIDDFDY  131

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE  200
             V  +   + KP P+I+L A+  L +   +C+V+EDA+ G+QAAKAA   CI +  + +E
Sbjct  132  AVWGNKVTHKKPDPEIYLTAAAGLGLNACDCLVVEDAVNGVQAAKAAGSLCIGLLGSFSE  191

Query  199  DTIEAAAPSLIRKGIS  152
              ++ A   ++ + +S
Sbjct  192  AELKRAGADIVLQDLS  207



>ref|WP_022295948.1| hAD-superfamily hydrolase subfamily IA variant 3 [Firmicutes 
bacterium CAG:272]
 emb|CDC75877.1| hAD-superfamily hydrolase subfamily IA variant 3 [Firmicutes 
bacterium CAG:272]
Length=217

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 108/197 (55%), Gaps = 4/197 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE     AA++V   +G +    ++  +TGMG+  F+GGV    G  G      K   +
Sbjct  15   DSEPAITYAAMEVNRSLGYETEPWEYRQYTGMGDDKFIGGVLEKHG--GVYKSEYKDEAY  72

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
             IY +  AK    + +P +  ++ + KS G  +AVAS++D +KV  NL   G      DA
Sbjct  73   RIYTET-AKDKVKV-YPWSAVIIEKLKSLGYTLAVASASDIVKVKCNLDCIGDVTGKLDA  130

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE  200
            +V+    E  KPAPDIFL A++   + P  C+V EDA+AGI AAKAA MR + VTT+ + 
Sbjct  131  VVTGSDVERKKPAPDIFLKAAEKAGLEPRFCIVAEDAIAGIMAAKAAGMRAVGVTTSFSA  190

Query  199  DTIEAAAPSLIRKGISY  149
            D ++ A   ++   +SY
Sbjct  191  DELKKAGADVVTDSLSY  207



>ref|WP_021932266.1| hypothetical protein [Firmicutes bacterium CAG:124]
 emb|CCY42101.1| putative uncharacterized protein [Firmicutes bacterium CAG:124]
Length=214

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 104/187 (56%), Gaps = 4/187 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SEE   +  V    + G+     DFA F G GE  ++GGVA   GV  +  E  K   +
Sbjct  16   DSEEYMAKTGVRALKKYGIDAKESDFAEFVGCGENRYVGGVAEKYGV-PYRTEM-KDYLY  73

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
              Y  ++ K  + I   G  +++   +++G ++AV SSADR+KV  NL+A G   S+FD 
Sbjct  74   ACY-GEHVKEEANIP-DGVLDVLHTLRARGYRLAVCSSADRVKVLMNLSAIGAEESLFDQ  131

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE  200
            +V+    +N KP P+I+L  +  L + PSEC+V+EDA +GI+AA AA +  I + T+   
Sbjct  132  LVTGTDIKNPKPDPEIYLTGAASLGLAPSECIVVEDAPSGIRAAHAAGIEAIGLATSFPA  191

Query  199  DTIEAAA  179
            D +   A
Sbjct  192  DYLRQQA  198



>gb|KJF43458.1| hypothetical protein LH29_14635 [Draconibacterium sp. JN14CK-3]
Length=218

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 95/180 (53%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            NSE+   +A V+ F +  + V  ++F PF G GE N+L GVA       +N + A K   
Sbjct  15   NSEDIIAKAGVEFFKKRNIVVDKKEFTPFIGTGEFNYLNGVAE-----NYNFKIATKDKL  69

Query  559  EIY--LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            E+Y    K AK    I + G  E++ + K + +K+A+A+SAD  KV+ N         +F
Sbjct  70   ELYKIYKKIAKEELSI-YKGIIEIINKSKKQNVKIALATSADMSKVEINFGIVNYDYKIF  128

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            D I +    +N KP P+IF      LN+ P   +VIED+  GI AAK A  +C A+T T 
Sbjct  129  DIITTGTEIKNKKPHPEIFQITCSNLNIKPENSIVIEDSPMGICAAKKAGCKCFAITNTF  188



>ref|XP_010511291.1| PREDICTED: NHL repeat-containing protein 2-like isoform X2 [Camelina 
sativa]
Length=857

 Score =   100 bits (249),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/78 (74%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = -1

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            FDAIVSADAFENLKP+PDIFLAA+KIL  P SECVVIEDALAG+QAA+AA MRCIAV T+
Sbjct  6    FDAIVSADAFENLKPSPDIFLAAAKILGAPTSECVVIEDALAGVQAAQAANMRCIAVKTS  65

Query  208  LAEDTIEAAAPSLIRKGI  155
            L+E +++ A PS+IR  I
Sbjct  66   LSEASLKDAGPSMIRDNI  83



>ref|WP_020613875.1| hypothetical protein [Spirochaeta bajacaliforniensis]
Length=236

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 104/192 (54%), Gaps = 4/192 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAE-MGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE     AA+++F +    +V  + F PF G GE NF+ GV  +  +    P   K++ 
Sbjct  20   DSERYIAEAAIEMFRQGYDTEVDPKTFLPFVGTGEGNFITGVGKLYNISLTMPRD-KEKT  78

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            +EIY +        I   GA   V  CK  GL VA+A+SAD+ K+ ANL   G     FD
Sbjct  79   YEIYEELIQGHLHEIN--GARAFVQACKKAGLAVAIATSADKRKMMANLRELGFHQEDFD  136

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            A V     +N KP P+I+L A++ + + P +C+V+EDA+ GI+A KAA  RC+ +T++  
Sbjct  137  ATVHGAEVKNNKPDPEIYLRAAQKVGIDPGDCLVVEDAVRGIEAGKAAGARCLGLTSSFD  196

Query  202  EDTIEAAAPSLI  167
               + AA    +
Sbjct  197  AKALLAAGADYV  208



>ref|WP_013254903.1| HAD-superfamily hydrolase [Spirochaeta smaragdinae]
 gb|ADK81440.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Spirochaeta 
smaragdinae DSM 11293]
Length=232

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 102/192 (53%), Gaps = 4/192 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAE-MGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE     AA+ +F +    +V  + F PF G GE NF+ GV  +  +    P   K+R 
Sbjct  20   DSERYIAEAAIAMFRQTYNTEVDPKTFLPFVGTGEDNFISGVGKLYNISLTMPRD-KERT  78

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
            +EIY +        I   GA   V  CK  GL +A+A+SAD+ K+  NL   G     FD
Sbjct  79   YEIYEELVHGHLKEIN--GARAFVYACKRSGLAIAIATSADKRKMMTNLRELGFQQEDFD  136

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLA  203
            A V     +N KP P+I+L A++ + + P +C+V+EDA+ GI++ KAA  RC+ +T++  
Sbjct  137  ATVHGAEVKNNKPDPEIYLKAAQKVGIDPGDCLVVEDAVRGIESGKAAGARCLGLTSSFD  196

Query  202  EDTIEAAAPSLI  167
               + AA    +
Sbjct  197  AKALLAAGADYV  208



>ref|WP_041381312.1| haloacid dehalogenase, partial [Sphaerochaeta globosa]
Length=209

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 84/156 (54%), Gaps = 4/156 (3%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE    +AA+   ++ GV    EDF PF G G+  +L GV    G L  + E AK  FF
Sbjct  15   DSEPVILQAAISYLSDRGVTAQPEDFIPFIGTGDRRYLCGVGQKYG-LSIDFEEAKHPFF  73

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
              Y +++A  N G   PG    +   +  GLK+A+A+SA ++K   NL A GL    FD 
Sbjct  74   A-YYEQFA-INRG-PMPGVHRFIANARKAGLKLALATSAMKMKAAINLKAIGLKFEDFDT  130

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            +V+ D  +  KP PDI+  ++  + +   EC+V+ED
Sbjct  131  VVTGDMVKRTKPNPDIYQLSALSMGLSTDECLVVED  166



>gb|ADY13911.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Sphaerochaeta 
globosa str. Buddy]
Length=388

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/156 (36%), Positives = 84/156 (54%), Gaps = 4/156 (3%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE    +AA+   ++ GV    EDF PF G G+  +L GV    G L  + E AK  FF
Sbjct  15   DSEPVILQAAISYLSDRGVTAQPEDFIPFIGTGDRRYLCGVGQKYG-LSIDFEEAKHPFF  73

Query  559  EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDA  380
              Y +++A  N G   PG    +   +  GLK+A+A+SA ++K   NL A GL    FD 
Sbjct  74   A-YYEQFAI-NRG-PMPGVHRFIANARKAGLKLALATSAMKMKAAINLKAIGLKFEDFDT  130

Query  379  IVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            +V+ D  +  KP PDI+  ++  + +   EC+V+ED
Sbjct  131  VVTGDMVKRTKPNPDIYQLSALSMGLSTDECLVVED  166



>gb|AEV30491.1| cytidine deaminase, homotetrameric [Sphaerochaeta pleomorpha 
str. Grapes]
Length=390

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 100/193 (52%), Gaps = 8/193 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE    +AA+  F  +G+ V  EDF PF G GE  FL GVA  K     + E A+K  F
Sbjct  15   DSEPIILQAAIAYFDSIGIVVKPEDFTPFIGAGERQFLCGVAE-KYHETIDFEKARKALF  73

Query  559  EIY--LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
             +Y  L   A P  G+        +    + GLK+AVASSA R KV  NL + G   + F
Sbjct  74   SLYGELAAEAGPLEGVS-----RFLRNGHNAGLKMAVASSASREKVLMNLVSIGCKETDF  128

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            D +VS D     KP PDI+  A+  + +   +C+V+EDAL GI +AK AK     +TTT 
Sbjct  129  DLVVSGDMISRNKPEPDIYQLAALSMGLATQDCLVMEDALNGIVSAKRAKCTVCGLTTTF  188

Query  205  AEDTIEAAAPSLI  167
              + +  A   L+
Sbjct  189  TVNQLFEAGADLV  201



>ref|WP_013560147.1| putative hydrolase [Anaerolinea thermophila]
 dbj|BAJ63769.1| putative hydrolase [Anaerolinea thermophila UNI-1]
Length=219

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 95/180 (53%), Gaps = 15/180 (8%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFN------PEA  578
            +SE  S+R+   V AE G  ++ + +    G  E +     A +K   G N         
Sbjct  16   DSERLSQRSWSQVMAEAGYLLSEDIYHQMIGRTEKDV---KAILKQAFGNNFPFEDMYRK  72

Query  577  AKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLS  398
             ++RFFEI +++   P       G  EL       GL+ AVASS  R   +  L+AA L 
Sbjct  73   REQRFFEI-IEQEGMPRKA----GWDELAQYILQNGLRTAVASSTYRRLAEKKLSAARL-  126

Query  397  LSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            LS F+ IV+ D   + KPAPD+FL A+  L +PP +CVV+ED+ AGIQAA  A M+CI +
Sbjct  127  LSFFEVIVTGDEVSHGKPAPDLFLTAASKLAIPPEKCVVLEDSEAGIQAAYNAGMKCIHI  186



>ref|WP_033362865.1| hypothetical protein, partial [Dactylosporangium aurantiacum]
Length=192

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 97/173 (56%), Gaps = 7/173 (4%)
 Frame = -1

Query  730  EPSRRAA-VDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNP-EAAKKRFFE  557
            EP+  AA  ++ A  G+  T +   P+ G G  + L  VA   G+   +P +A   R   
Sbjct  20   EPNYLAAERELLAGYGIDFTEDMKRPYIGWGTRDMLIDVAARHGI--DDPVDALVARKNT  77

Query  556  IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAI  377
             YL    +  +G  +PG  E++   ++ GL  A+AS +    +D  LT   L    FDA+
Sbjct  78   TYLSLTRRHVTG--YPGTREILLALRADGLPTALASGSSPEVIDVILTTLDLH-DAFDAV  134

Query  376  VSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            VSA+   + KPAPD+FL A++ L VPP+ CVV ED+ AG++AA AA MRC+A+
Sbjct  135  VSAEQVPHGKPAPDLFLEAARRLAVPPASCVVFEDSEAGVRAALAAGMRCVAI  187



>ref|WP_018702023.1| hypothetical protein [Anaeromusa acidaminophila]
Length=228

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 89/162 (55%), Gaps = 4/162 (2%)
 Frame = -1

Query  703  VFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNS  524
            +F  +G+ V  E   P+TG+    FL  +      L  + E   +R    Y++  A+  +
Sbjct  33   IFRPLGIIVEAEHKKPYTGLSSHCFLADIKKQYN-LSLSVEELLRRKNAAYME-MARKRT  90

Query  523  GIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKP  344
             + FP     V   K  G  +AVAS + +  +DA L AA L  + FD  +S+   +  KP
Sbjct  91   HV-FPEMRIFVHLLKEHGYPLAVASGSSKEVIDAVLEAADLH-NYFDVTLSSAQVKQGKP  148

Query  343  APDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            APD+FL A+++LN PP  C+V+ED+  G++AAK A+M CIA+
Sbjct  149  APDVFLEAARLLNTPPQACLVMEDSRYGVEAAKKAQMSCIAI  190



>ref|WP_018611194.1| hypothetical protein [Segetibacter koreensis]
Length=235

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 63/190 (33%), Positives = 96/190 (51%), Gaps = 14/190 (7%)
 Frame = -1

Query  736  SEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFE  557
            S E    A   VF   G ++T ED+ P  G+  A+       +K  LG + E   KR  +
Sbjct  32   STEADYLAWEKVFNNYGKKLTYEDYQPILGVRSADV------IKNHLGISGEEDVKRILK  85

Query  556  IYLDKY-----AKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
               D +     A P   +     F  +    +  +KVA+A+S+ + K++  L      L 
Sbjct  86   EKFDYFVDIITANPIKPVHAAETF--LKSLANYPVKVALATSSRKEKMEMVLKQLNF-LQ  142

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
             FD +V+ D  +N KPAPDIFL A+  L + P++C V+ED   G+ AAK AKM+C+A+T 
Sbjct  143  YFDVLVTGDEVKNSKPAPDIFLKAADRLGLAPNDCFVVEDGPIGVAAAKNAKMKCVAITE  202

Query  211  TLAEDTIEAA  182
            T   D ++ A
Sbjct  203  THEADKLQQA  212



>ref|WP_041395699.1| hypothetical protein, partial [Sphaerochaeta coccoides]
Length=200

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 76/158 (48%), Gaps = 6/158 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE   + A +  FA+ GV V   DF  F G+GE   L GV      +  + + AK   +
Sbjct  15   DSEPLIQDAMISWFADQGVTVYPRDFKAFFGVGETAMLRGVGGCHDYVIDDIDTAKLDVY  74

Query  559  EIYLDKYAKPNSG--IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            E    +Y +   G  +  PG        +  GL  A+ SSADR KV  N+ A  +S+   
Sbjct  75   E----RYYRLLEGKDLSHPGILRFFKNARKAGLITAIVSSADRTKVLKNMAAVKISVEDV  130

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            D +VS D  +  KP PDIF  A+  L V   E +V+ED
Sbjct  131  DLVVSGDDVKRKKPFPDIFQYAALSLGVTCDEALVVED  168



>ref|WP_022026745.1| hAD-superfamily hydrolase subfamily IA variant 3 [Dialister invisus 
CAG:218]
 emb|CCZ54187.1| hAD-superfamily hydrolase subfamily IA variant 3 [Dialister invisus 
CAG:218]
Length=214

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA E++ +C+  G+K AVASS+   +++ NL  AG+  + FDAIVS D  E  KPAPDIF
Sbjct  88   GAVEILGRCRLLGIKTAVASSSPLRQIENNLENAGME-NCFDAIVSGDEVERGKPAPDIF  146

Query  328  LAASKILNVPPSECVVIED  272
            L A+K + +PP EC V ED
Sbjct  147  LLAAKRIGIPPGECTVFED  165



>ref|WP_012258011.1| MULTISPECIES: haloacid dehalogenase [Chloroflexus]
 ref|YP_001635746.1| HAD family hydrolase [Chloroflexus aurantiacus J-10-fl]
 gb|ABY35357.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Chloroflexus 
aurantiacus J-10-fl]
 gb|ACM53708.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Chloroflexus 
sp. Y-400-fl]
Length=227

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 88/165 (53%), Gaps = 13/165 (8%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF-  563
            ++E P+ ++  +++AE GV ++V D+A   G   A F      V  +   +P+ A++   
Sbjct  16   DTETPALQSWQEIYAEYGVTLSVHDWAITLG-ANAGFDAHAHLVALLRQRDPQLAEQVIA  74

Query  562  --------FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAA  407
                     +   D+ + P + +  PG  EL+ +  SKGL  AVASS+ R  V+  L   
Sbjct  75   ARDTILARRQARKDELSAPQTLL--PGVAELLAEAHSKGLPCAVASSSSRRWVEGWLERL  132

Query  406  GLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            G+    F  +V+AD     KPAPD+FL A++ L +PP+ C+V+ED
Sbjct  133  GIR-PFFATVVTADDVAATKPAPDLFLEAARRLGLPPATCLVLED  176



>ref|WP_037412609.1| hypothetical protein, partial [Solirubrobacter sp. URHD0082]
Length=181

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 83/159 (52%), Gaps = 13/159 (8%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEAN---FLGGVANVKGVLGFNPEAAKK  569
            +SE  + RA     A  G +VT  D A   G+  A    +L   A +     F P   K 
Sbjct  16   DSEPLAGRAWKATVAPYGYEVTDADLAACMGIPYARTHAYLSERAELPEAHEFWP-LLKH  74

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
              F + +D    P     FP A E   +  ++G+++AVASS+ R ++D  L  AGLS   
Sbjct  75   ELFSL-IDAELVP-----FPDAVEAAAELHARGVRLAVASSSPRERLDRTLARAGLS---  125

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            F   V+ D  E+ KPAPD+FLAA++ L +PP+ CVV+ED
Sbjct  126  FAVTVAGDEVEHGKPAPDMFLAAAERLELPPARCVVVED  164



>ref|WP_043097617.1| hypothetical protein, partial [bacterium JKG1]
Length=204

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 95/187 (51%), Gaps = 15/187 (8%)
 Frame = -1

Query  706  DVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE---AAKKRFFEIYLDKYA  536
            +  A  G  +T E FA   G      L  +        F PE   AA +R  +    +Y 
Sbjct  26   EALAAEGYALTREQFARTFGQRNDTILRTL--------FGPELSDAAIQRIGDAKEQRYR  77

Query  535  K--PNSGIGF-PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSAD  365
            +     GI   PGA + + +  + G + A+ASSA R+ ++A L    +    FDA+VSA+
Sbjct  78   ELIRERGIDLLPGARDWLARLHAAGWRQAIASSAPRLNIEAILDVLAIR-PFFDALVSAE  136

Query  364  AFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEA  185
              +  KP P +FL A+  L+VPP  CVV+EDA AG++AA+ A MR IAV T     + + 
Sbjct  137  DVQRGKPDPQVFLVAAARLDVPPERCVVVEDAAAGVEAARRAGMRVIAVGTAHPPHSADL  196

Query  184  AAPSLIR  164
              PSL R
Sbjct  197  VTPSLDR  203



>ref|WP_044374067.1| hydrolase [Streptomyces ahygroscopicus]
Length=235

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 67/175 (38%), Positives = 94/175 (54%), Gaps = 5/175 (3%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE     A   + A+ GV   T E  A F G+G    L  +A   G L    E    R 
Sbjct  23   DSEPTYFEAGRRLLAQYGVTDFTWERHARFIGIGTRETLEILAREYG-LNAPVEELLARK  81

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
              +YL+  A+  + + FP   ELV +  + G  +AVAS + R  ++A L   GL  ++  
Sbjct  82   NRLYLE-LARAGTAV-FPQMRELVGRLAAGGHPMAVASGSSRAAIEAVLAGTGLD-ALLS  138

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             +VSA+   N KP PD+FLAA++ L V P+ CVV+EDA  G+ AA+ A MRCIAV
Sbjct  139  TVVSAEEVPNGKPEPDVFLAAARRLRVEPAACVVVEDAAPGVVAARRAGMRCIAV  193



>ref|WP_022824907.1| ABC transporter ATP-binding protein [Hymenobacter norwichensis]
Length=218

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 90/179 (50%), Gaps = 13/179 (7%)
 Frame = -1

Query  730  EPSRRAA-VDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE-----AAKK  569
            EP   AA    FAE+G+QV+ E++A F G    N      ++K      P+     + K+
Sbjct  17   EPLHHAAFYSHFAELGIQVSDEEYATFLGSSTRNV---YQHLKQQYNLKPDVEELMSRKR  73

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
             FF    D+          PG  +LV     +G+ +A+ASSA +  +        L    
Sbjct  74   DFFGKTFDESTTLEL---LPGVRDLVVALHEQGIPLALASSASKETISRVFKRFDL-YPY  129

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            F  +VS + FE  KP P IFL A++++  PP+ECVVIEDA  G+ AAKAA M CI   +
Sbjct  130  FQHLVSGEDFEKSKPNPAIFLHAAELVGTPPAECVVIEDAANGVAAAKAAGMHCIGYQS  188



>ref|WP_022790060.1| phosphoglycolate phosphatase [[Streptococcus] pleomorphus]
Length=220

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 72/114 (63%), Gaps = 1/114 (1%)
 Frame = -1

Query  535  KPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFE  356
            + N      G  EL+ + KS+GLK+A+A+SA + K    L   GL L  FDA  +A+  E
Sbjct  80   RTNRLPAMEGVKELIIRAKSEGLKLAIATSATQKKPVTQLKRLGL-LDYFDAFSTAELSE  138

Query  355  NLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
            N+KPAPDIFL A+++L+  P EC+ IED+L G+ AA+ A M C+ V   + +D+
Sbjct  139  NIKPAPDIFLKAAELLDCKPEECLAIEDSLNGLIAAQRASMPCLIVPNMITKDS  192



>gb|EEW97332.1| HAD hydrolase, family IA, variant 3 [Dialister invisus DSM 15470]
Length=241

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA E++ +C+  G+K AVASS+   ++  NL  AG+  + FDA+VS D  E  KPAPDIF
Sbjct  115  GAVEILGRCRMLGIKTAVASSSPLRQIKNNLENAGME-NCFDALVSGDEVERGKPAPDIF  173

Query  328  LAASKILNVPPSECVVIED  272
            L A+K + +PP EC V ED
Sbjct  174  LLAAKRIGIPPGECTVFED  192



>ref|WP_040381412.1| HAD family hydrolase [Dialister invisus]
Length=214

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA E++ +C+  G+K AVASS+   ++  NL  AG+  + FDA+VS D  E  KPAPDIF
Sbjct  88   GAVEILGRCRMLGIKTAVASSSPLRQIKNNLENAGME-NCFDALVSGDEVERGKPAPDIF  146

Query  328  LAASKILNVPPSECVVIED  272
            L A+K + +PP EC V ED
Sbjct  147  LLAAKRIGIPPGECTVFED  165



>ref|WP_014141627.1| hydrolase [Streptomyces cattleya]
 emb|CCB73589.1| Hydrolase [Streptomyces cattleya NRRL 8057 = DSM 46488]
 gb|AEW93226.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Streptomyces 
cattleya NRRL 8057 = DSM 46488]
Length=223

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 92/182 (51%), Gaps = 19/182 (10%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGV-------ANVKGVLGFNP  584
            +SE     A   + A  GV   + E  A F G+G    L  +       A V+ +L    
Sbjct  16   DSEPAYYEAGRQLLARYGVDGYSWEHHARFVGIGTEETLAALRAEYRIAAPVQELL----  71

Query  583  EAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAG  404
             A K R   IYL+   +      FPG  ELV + ++ G+ +AVAS +    + A L   G
Sbjct  72   -AGKNR---IYLELAGRTVRA--FPGMRELVERLRAAGVPMAVASGSSPRAIRAVLAGTG  125

Query  403  LSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L    F   VSA+  E+ KPAPD+FLAA++ L V P  CVV+EDA  G+ AA  A MRC+
Sbjct  126  LD-GAFALTVSAEQVEHGKPAPDVFLAAAERLGVAPERCVVLEDAAPGVTAAARAGMRCV  184

Query  223  AV  218
            AV
Sbjct  185  AV  186



>gb|AEC02302.1| cytidine deaminase [Sphaerochaeta coccoides DSM 17374]
Length=391

 Score = 79.3 bits (194),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 76/158 (48%), Gaps = 6/158 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE   + A +  FA+ GV V   DF  F G+GE   L GV      +  + + AK   +
Sbjct  15   DSEPLIQDAMISWFADQGVTVYPRDFKAFFGVGETAMLRGVGGCHDYVIDDIDTAKLDVY  74

Query  559  EIYLDKYAKPNSG--IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            E    +Y +   G  +  PG        +  GL  A+ SSADR KV  N+ A  +S+   
Sbjct  75   E----RYYRLLEGKDLSHPGILRFFKNARKAGLITAIVSSADRTKVLKNMAAVKISVEDV  130

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            D +VS D  +  KP PDIF  A+  L V   E +V+ED
Sbjct  131  DLVVSGDDVKRKKPFPDIFQYAALSLGVTCDEALVVED  168


 Score = 25.4 bits (54),  Expect(2) = 6e-14, Method: Compositional matrix adjust.
 Identities = 11/18 (61%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = -2

Query  771  AVLFDMDGVLATARSLLE  718
            AVLFDMDGVL  +  L++
Sbjct  4    AVLFDMDGVLIDSEPLIQ  21



>ref|WP_037632999.1| hydrolase [Streptomyces albulus]
Length=222

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 93/175 (53%), Gaps = 5/175 (3%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE     A   + A+ GV   T E  A F G+G    L  +A   G L    E    R 
Sbjct  10   DSEPTYFEAGRRLLAQYGVTDFTWERHARFIGIGTRETLEILAREYG-LNAPVEELLARK  68

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
              +YL+  A+  + + FP   ELV +  + G  +AVAS + R  ++A L   GL  ++  
Sbjct  69   NRLYLE-LARAGTAV-FPQMRELVGRLAAGGHPMAVASGSSRAAIEAVLAGTGLD-ALLS  125

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             +VSA+     KP PD+FLAA++ L V P+ CVV+EDA  G+ AA+ A MRCIAV
Sbjct  126  TVVSAEEVPRGKPEPDVFLAAARRLRVEPAACVVVEDAAPGVVAARRAGMRCIAV  180



>ref|WP_022432576.1| beta-phosphoglucomutase [Eubacterium sp. CAG:38]
 emb|CDE37049.1| beta-phosphoglucomutase [Eubacterium sp. CAG:38]
Length=212

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 75/137 (55%), Gaps = 10/137 (7%)
 Frame = -1

Query  583  EAAKKRFFEIYLDKYAKPNSGIGFP---GAFELVTQCKSKGLKVAVASSADRIKVDANLT  413
            EA K R   IY     K     G P   G FEL+   +  G+K AVA+S  R   +  L 
Sbjct  59   EARKLRTEHIY-----KIREKEGLPIKKGLFELLDYIRENGIKCAVATSTRRESAEKTLH  113

Query  412  AAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKM  233
              G +    D +V  D+ E+ KP PDIFLAA+  + VPP EC+VIED++ GI+A  AA M
Sbjct  114  TIG-AWEYLDNVVYGDSVEHGKPEPDIFLAAADRIGVPPQECIVIEDSINGIKAGHAAGM  172

Query  232  RCIAVTTTLA-EDTIEA  185
            + + V  T+  +DTI A
Sbjct  173  KVVHVPDTIQIDDTIRA  189



>ref|WP_031511313.1| hydrolase [Streptomyces megasporus]
Length=229

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 91/177 (51%), Gaps = 9/177 (5%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            +SE     A+  + A  G+   T ED   F G+G    L  +    G+     E  A K 
Sbjct  19   DSEPAYHEASRRLLARYGITDFTWEDHTRFIGIGTRETLTTLREEHGIDAPVEELLAGKN  78

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R   +YL+  A+  S   FPG   LV + ++ G+ +AVAS + R  +DA L  AGL  ++
Sbjct  79   R---LYLE-LAR-TSVRAFPGMLVLVERLRAAGVPMAVASGSSRAAIDAVLAGAGLD-AL  132

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
                VSA+     KP PD+FL A++ L V P  C V+EDA  G +AA  A MRC+AV
Sbjct  133  LPVRVSAEEVARGKPEPDVFLEAAERLGVEPGRCAVVEDAPPGAEAAHRAGMRCVAV  189



>gb|EOT03950.1| hypothetical protein K530_11078 [Streptomyces albulus CCRC 11814]
 gb|EXU87430.1| hydrolase [Streptomyces albulus PD-1]
 gb|AIA07417.1| hydrolase [Streptomyces albulus]
Length=235

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/175 (38%), Positives = 93/175 (53%), Gaps = 5/175 (3%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE     A   + A+ GV   T E  A F G+G    L  +A   G L    E    R 
Sbjct  23   DSEPTYFEAGRRLLAQYGVTDFTWERHARFIGIGTRETLEILAREYG-LNAPVEELLARK  81

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
              +YL+  A+  + + FP   ELV +  + G  +AVAS + R  ++A L   GL  ++  
Sbjct  82   NRLYLE-LARAGTAV-FPQMRELVGRLAAGGHPMAVASGSSRAAIEAVLAGTGLD-ALLS  138

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             +VSA+     KP PD+FLAA++ L V P+ CVV+EDA  G+ AA+ A MRCIAV
Sbjct  139  TVVSAEEVPRGKPEPDVFLAAARRLRVEPAACVVVEDAAPGVVAARRAGMRCIAV  193



>ref|WP_005299899.1| 2-deoxyglucose-6-phosphatase [Photobacterium damselae]
 gb|EEZ41302.1| 2-deoxyglucose-6-phosphate hydrolase YniC [Photobacterium damselae 
subsp. damselae CIP 102761]
Length=217

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 97/176 (55%), Gaps = 7/176 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE   ++A V+VF ++GV++++ED     G+     +    N +   G N     +   
Sbjct  15   DSEPFWQQAQVEVFTDLGVKISIEDTHKTMGLRIDQVVEFWFNQQPWQGPNCAEVTQTIV  74

Query  559  EIY--LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            +    L +  KP      PG  E +T CK  GLK+A+ASS+    ++A + A  L+  +F
Sbjct  75   DRVKALVREQKPM----LPGVVEAITCCKESGLKIALASSSPMDLIEATIDALSLT-GLF  129

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            +A++SA+     KP P++++ A+  L V P  CV  ED++ G+ AAKAA+M+ IAV
Sbjct  130  EAVLSAEHLRYGKPHPEVYINAADALGVKPQHCVAFEDSVNGLLAAKAAQMKGIAV  185



>ref|WP_022587907.1| phosphatase [Caldanaerobacter subterraneus]
 gb|ERM92035.1| phosphatase [Caldanaerobacter subterraneus subsp. yonseiensis 
KB-1]
Length=224

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 92/181 (51%), Gaps = 6/181 (3%)
 Frame = -1

Query  748  CACNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKK  569
               +SE    R   ++F E+GV++T E+   F G   + ++      +  L  + E   +
Sbjct  12   VMIDSEPVHLRLERELFRELGVEITEEEHMTFVG-SSSYYMWEKIKERFNLKESVEELVR  70

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDA-NLTAAGLSL-  395
            R  + YLD        I  PG  ELV +   +  K+AVASS+    +D   L    L+L 
Sbjct  71   RDRKRYLDHVLSTGEIIPVPGIQELVKKLFEREYKLAVASSS---PIDVIELVVQKLNLK  127

Query  394  SMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVT  215
            + FD +VS D  +  KP PDIFL  ++ L V P ECVVIED+  G+ AAK+A M+ I + 
Sbjct  128  NFFDMLVSGDYVKRSKPYPDIFLYTAEKLRVKPEECVVIEDSYNGVHAAKSAGMKVIGLV  187

Query  214  T  212
             
Sbjct  188  N  188



>ref|WP_015527821.1| haloacid dehalogenase superfamily, subfamily IA, variant 3 with 
third motif having DD or ED/haloacid dehalogenase superfamily, 
subfamily IA, variant 1 with third motif having Dx(3-4)D 
or Dx(3-4)E [[Ruminococcus] torques]
 ref|YP_007785689.1| haloacid dehalogenase superfamily, subfamily IA, variant 3 with 
third motif having DD or ED/haloacid dehalogenase superfamily, 
subfamily IA, variant 1 with third motif having Dx(3-4)D 
or Dx(3-4)E [Ruminococcus torques L2-14]
 emb|CBL25181.1| haloacid dehalogenase superfamily, subfamily IA, variant 3 with 
third motif having DD or ED/haloacid dehalogenase superfamily, 
subfamily IA, variant 1 with third motif having Dx(3-4)D 
or Dx(3-4)E [Ruminococcus torques L2-14]
Length=228

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 89/175 (51%), Gaps = 3/175 (2%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAE-MGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            N+E    +  V++F E  G+ +  E + P  G    +F+  +    G+  F   A   + 
Sbjct  15   NTEPLHYQCWVEIFKERYGIDLDYEVYKPCIGSTRLHFMNLIKENYGI-TFESLAVMNQI  73

Query  562  FEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFD  383
             +   D+    +     PG  +++   K  G ++AVASS+ +  +   L    L +  FD
Sbjct  74   MKEKKDEIIARDGFPEMPGVGQMLCCLKDAGYRLAVASSSPKPVITETLETLDL-MKYFD  132

Query  382  AIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             + S D  +N KPAPD FL A+K L VP  EC+VIED+  G +AAKAAKM CI +
Sbjct  133  VVTSGDEVKNPKPAPDTFLFAAKQLGVPVDECIVIEDSTNGGKAAKAAKMLCIWM  187



>ref|WP_037546502.1| hypothetical protein [Spirochaeta sp. JC230]
 gb|KGE73161.1| hypothetical protein DC28_05115 [Spirochaeta sp. JC230]
Length=228

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 85/160 (53%), Gaps = 6/160 (4%)
 Frame = -1

Query  688  GVQVTVEDFAPFTGMGEANFLGGVANVKGVLG-FNPEAAKKRFFEIYLDKYAKPNSGIGF  512
            G+ +  E +    G+G  +FL  +    G+ G  +   A+K     YL K A+ N+   F
Sbjct  33   GIHLPEEHWKDVVGVGSRSFLRTLQRDYGLTGDLDDLLAEKD--SCYL-KIARGNTR-AF  88

Query  511  PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDI  332
            P     V  C S+G+K+AVAS + R  ++  L  AGL    F   VSAD     KP PDI
Sbjct  89   PQMQLFVEACHSRGIKMAVASGSSREAIEKTLGWAGLE-QYFPVRVSADEVAGGKPQPDI  147

Query  331  FLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            F+ A++ + V P EC+VIED+  G+ A KAA M C A+ T
Sbjct  148  FIEAARRMGVDPGECLVIEDSQYGVTAGKAAGMVCAAIPT  187



>ref|WP_043029511.1| haloacid dehalogenase [Streptococcus equi]
 gb|KIS08698.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz16]
 gb|KIS19980.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
SzAM35]
Length=212

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +   + KPAPDIF
Sbjct  90   GATQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVTHSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A+++L V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAELLRVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>emb|CDC17671.1| haloacid dehalogenase superfamily subfamily IA variant 3 with 
third motif having DD or ED/haloacid dehalogenase superfamily 
subfamily IA variant 1 with third motif having Dx(3-4)D or 
Dx(3-4)E [Ruminococcus sp. CAG:55]
Length=226

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 92/178 (52%), Gaps = 9/178 (5%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAE-MGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            N+E    +  V++F E  G+ +  E + P  G    +F+  +    G+   N E      
Sbjct  15   NTEPLHYQCWVEIFKERYGIDLDYEVYKPCIGSTRLHFMNLIKENYGITFENLEVMN---  71

Query  562  FEIYLDKYAKPNSGIGFP---GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
             +I  +K  +  +  GFP   G  +++   K  G ++AVASS+ +  +   L    L + 
Sbjct  72   -QIMKEKKDEIIARDGFPEMPGVGQMLCCLKDAGYRLAVASSSPKPVITETLETLDL-MK  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FD + S D  +N KPAPD FL A+K L VP  EC+VIED+  G +AAKAAKM CI +
Sbjct  130  YFDVVTSGDEVKNPKPAPDTFLFAAKQLGVPVEECIVIEDSTNGGKAAKAAKMPCIWM  187



>ref|WP_037578896.1| haloacid dehalogenase [Streptococcus equi]
 gb|KED05107.1| haloacid dehalogenase-like hydrolase [Streptococcus equi subsp. 
ruminatorum CECT 5772]
Length=212

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +   + KPAPDIF
Sbjct  90   GAAQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVTHSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A+++L V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAELLRVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>ref|WP_021320537.1| phosphoglycolate phosphatase [Streptococcus equi]
 gb|EQB24006.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
SzS31A1]
 gb|KIS07487.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz12is]
 gb|KIS18358.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz4is]
Length=212

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +   + KPAPDIF
Sbjct  90   GATQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVAHSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A+++L V P  C+VIED   G QAAK A+M CI
Sbjct  149  LKAAELLRVNPKTCLVIEDTKHGSQAAKTAQMTCI  183



>ref|WP_003422738.1| hydrolase [Peptoclostridium difficile]
 gb|EFH05718.1| HAD hydrolase, family IA, variant 3 [Clostridium difficile NAP08]
 gb|EFH17117.1| HAD hydrolase, family IA, variant 3 [Clostridium difficile NAP07]
 emb|CCK88260.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile T5]
 emb|CCK91688.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile T20]
 emb|CCK95398.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile E1]
 emb|CCK99384.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile E10]
Length=226

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWIETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++D+   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMDREGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_022211901.1| hAD-superfamily hydrolase subfamily IA variant 3 [Clostridium 
sp. CAG:265]
 emb|CDB74638.1| hAD-superfamily hydrolase subfamily IA variant 3 [Clostridium 
sp. CAG:265]
Length=217

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 53/149 (36%), Positives = 72/149 (48%), Gaps = 13/149 (9%)
 Frame = -1

Query  703  VFAEMGVQVTVEDFAPFTGMGEAN----FLGGVANVKGVLGFNPEAAKKRFFEIYLDKYA  536
            VF + G ++T E +    G G  N    FL    +   +     E  K+ FF I      
Sbjct  28   VFEKYGYKMTKELYITVMGTGRENVIKIFLDNFGDGLPIEKMYEEKDKQLFFII------  81

Query  535  KPNSGIGFP-GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAF  359
              N GI    G  EL +  K +  K+A+ +SA R +V+  +    L  S FDAIV  D  
Sbjct  82   -ENEGIPLKEGVKELFSMLKERNYKIALGTSAKRERVEKQIKDKWLKES-FDAIVCGDDV  139

Query  358  ENLKPAPDIFLAASKILNVPPSECVVIED  272
            E  KP PDIFL A+K +NV P +C V+ED
Sbjct  140  EKGKPNPDIFLKAAKEINVKPEDCFVVED  168



>ref|WP_026047523.1| hydrolase [Streptomyces sp. AA0539]
Length=239

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 62/103 (60%), Gaps = 1/103 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FPG   LV    + GL +AVAS + R  +DA LT   +  ++    VSA+     KPAPD
Sbjct  94   FPGMARLVELAHAAGLPMAVASGSTREAIDAALTGTAVG-ALLPVRVSAEEVPRGKPAPD  152

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            +F AA+  L VPP  CVV+EDA  G+ AA AA MRC+AV + L
Sbjct  153  VFEAAAHRLGVPPQRCVVVEDAAPGVTAALAAGMRCVAVPSVL  195



>ref|WP_021385882.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile]
 gb|EQF23387.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD160]
Length=226

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWIETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++D+   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMDREGAPIK----LGVNELISFLKESGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVINSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_036626557.1| beta-phosphoglucomutase [Paenibacillus macerans]
 gb|KFN11678.1| beta-phosphoglucomutase [Paenibacillus macerans]
Length=216

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 97/182 (53%), Gaps = 13/182 (7%)
 Frame = -1

Query  697  AEMGVQVTVEDFAPFTG---MGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPN  527
            AE+G + T +D     G   M   + L  V  ++   G   E A+++    Y++  +K +
Sbjct  31   AELGFEFTAQDNEKLKGVSRMASLDILLKVGGLELEDGVKRELAERKN-GWYVEYISKMD  89

Query  526  SGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLK  347
            +    PGA + + QC+ +GLK A+ S++    V   L   GL+   FDAI+      + K
Sbjct  90   ASEILPGALDFLKQCRERGLKTALGSASKNASV--ILQNTGLT-PYFDAIIDGTRTSSAK  146

Query  346  PAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAA---AP  176
            P P++FL  ++ L VPP  CVV EDA AGI+AA+ A MRC+ + +    DT+ AA    P
Sbjct  147  PDPEVFLLGAEELGVPPEACVVFEDAEAGIEAARRAGMRCVGIGSP---DTLGAADLVVP  203

Query  175  SL  170
            SL
Sbjct  204  SL  205



>ref|WP_013381050.1| phosphatase/phosphohexomutase [Eubacterium limosum]
 gb|ADO37730.1| phosphatase/phosphohexomutase [Eubacterium limosum KIST612]
Length=218

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/179 (34%), Positives = 95/179 (53%), Gaps = 7/179 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE   ++  +D++AEMG++++ ED     G    ++      +K   GF   A +   +
Sbjct  15   DSEPDYKQIELDMYAEMGLEMSEEDAVKSMGRVTVDWW---RELKERFGFEQSAEELAEY  71

Query  559  E--IYLD-KYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            E  +YLD  ++  N      G    +   + KG ++A+ASS+    ++  L    L    
Sbjct  72   ENNLYLDFLFSDENQKTMMEGVDVFLKTLRDKGYRIAIASSSTVPAINRVLELFDLE-DA  130

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            FD  VS D     KPAPDIFL A+++LNV P +C+VIED+ +GI AAK A M+C A  +
Sbjct  131  FDVRVSGDHVAVGKPAPDIFLRAAELLNVAPEKCMVIEDSGSGILAAKRAGMQCTAYLS  189



>ref|WP_027937809.1| hydrolase [Anaeroarcus burkinensis]
Length=228

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 86/165 (52%), Gaps = 10/165 (6%)
 Frame = -1

Query  703  VFAEMGVQVTVEDFAPFTGMGEANFLGGVA---NVKGVLGFNPEAAKKRFFEIYLDKYAK  533
            +F  +G+ V  E   P+TG+    FL  +    N+   L          + E+     A+
Sbjct  33   IFRPLGIIVEAEHKKPYTGLSSHCFLADIKKQYNLSLSLEELLRRKNAAYMEM-----AR  87

Query  532  PNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFEN  353
              + + FP     V   K  G  +AVAS + +  +DA L  A L  + FD  +S+   + 
Sbjct  88   KRTHV-FPEMRTFVHLLKEHGYPLAVASGSSKEVIDAVLETADLH-NYFDVTLSSAQVKQ  145

Query  352  LKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             KPAPD+FL A+++LN PP  C+V+ED+  G++AAK A+M CIA+
Sbjct  146  GKPAPDVFLEAARLLNTPPQACLVMEDSRYGVEAAKKAQMSCIAI  190



>ref|WP_022166346.1| hAD-superfamily hydrolase subfamily IA variant 3 [Clostridium 
sp. CAG:221]
 emb|CDB15179.1| hAD-superfamily hydrolase subfamily IA variant 3 [Clostridium 
sp. CAG:221]
Length=217

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 88/176 (50%), Gaps = 13/176 (7%)
 Frame = -1

Query  709  VDVFAEMGVQVTVEDFAPFTGMGEAN----FLGGVANVKGVLGFNPEAAKKRFFEIYLDK  542
            ++VF + G ++T E +    G G  N    FL    +   +     E   + F+ I    
Sbjct  26   IEVFEKYGYKMTKELYVNVMGTGRKNVIKTFLENFGDDLPIEKMYEEKDNQLFYII----  81

Query  541  YAKPNSGIGFP-GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSAD  365
                N GI    G  EL +  K K  K+A+A+SA R +V+  +    L  S FDAIV  D
Sbjct  82   ---ENQGIPLKEGVKELFSMLKEKNYKIALATSAKRERVEKQIKDKWLKES-FDAIVCGD  137

Query  364  AFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAED  197
              E  KP+PDIFL A+K ++V P  C V+ED+ AGI+AA +  M+ I V    A D
Sbjct  138  DVEKGKPSPDIFLKAAKKIDVEPENCFVVEDSPAGIKAAFSGGMKGIHVEDLKAAD  193



>ref|WP_042400469.1| hydrolase [Clostridium sp. JCC]
Length=223

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 75/151 (50%), Gaps = 18/151 (12%)
 Frame = -1

Query  703  VFAEMGVQVTVEDFAPFTGMGEAN----FLGGVANVKGVLGFNPEAAKKRFFEIYLDKYA  536
            VF + G ++  E +A   G G  N    FL    N   +     E  K    E  +DK  
Sbjct  33   VFEKYGYKLQKEVYAEVLGTGRENVKKVFLNNYGNELPIDKMYRE--KDEDLEKAVDK--  88

Query  535  KPNSGIGFP---GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSAD  365
                  G P   GA+E+++  K+   K+A+A+SA + +    L  A +    FD IVS D
Sbjct  89   ------GIPLKQGAYEILSYLKNNNYKIALATSASKERALKQLRYADIE-KFFDVIVSRD  141

Query  364  AFENLKPAPDIFLAASKILNVPPSECVVIED  272
              +  KP PDIFL A+K LNV P+EC+VIED
Sbjct  142  DVKETKPNPDIFLKAAKKLNVNPNECIVIED  172



>ref|WP_044175857.1| 2-deoxyglucose-6-phosphatase [Photobacterium damselae]
Length=217

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 97/176 (55%), Gaps = 7/176 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            +SE   ++A V+VF ++GV++++ED     G+     +    N +   G N     +   
Sbjct  15   DSEPFWQQAQVEVFTDLGVKISIEDTHKTMGLRIDQVVEFWFNQQPWQGPNCAEVTQTIV  74

Query  559  EIY--LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
            +    L +  KP      PG  E ++ CK  GLK+A+ASS+    ++A + A  L+  +F
Sbjct  75   DRVKALVREQKPM----LPGVVEAISCCKESGLKIALASSSPMDLIEATIDALSLT-GLF  129

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            +A++SA+     KP P++++ A+  L V P  CV  ED++ G+ AAKAA+M+ IAV
Sbjct  130  EAMLSAEHLRYGKPHPEVYINAADALGVKPQHCVAFEDSVNGLLAAKAAQMKGIAV  185



>ref|WP_043038806.1| haloacid dehalogenase [Streptococcus equi]
 gb|KIS15232.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
SzAM60]
Length=212

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  90   GAVQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAEWLSVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>ref|WP_044047407.1| phosphatase [Prevotella intermedia]
Length=206

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = -1

Query  550  LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVS  371
            LD+Y +        G  + V Q K  G+K A+ +S+++ K++           +FDA+ +
Sbjct  69   LDEYERQMQYTYVDGLIDFVQQLKQNGVKTAIVTSSNKSKMENVYRQHATFKQLFDAVFT  128

Query  370  ADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTI  191
            A+ F   KP+PD +L A++ L V P++C+V ED+  G+++  AAK R I ++TT + ++I
Sbjct  129  AEDFHESKPSPDGYLTAARALGVEPTDCIVFEDSFNGLRSGLAAKARVIGLSTTNSVESI  188

Query  190  EAAAPSLIRKGISY  149
            +     +I   + Y
Sbjct  189  KEFTKEVIPNFVGY  202



>ref|WP_044513700.1| ABC transporter ATP-binding protein [Hymenobacter sp. DG25B]
 gb|AIZ64043.1| ABC transporter ATP-binding protein [Hymenobacter sp. DG25B]
Length=222

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/167 (35%), Positives = 88/167 (53%), Gaps = 2/167 (1%)
 Frame = -1

Query  700  FAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSG  521
            FAE+G+ +T E++A F G    N    +    G L  + EA   R  E++   + +  + 
Sbjct  28   FAELGISMTREEYATFLGSSTRNVYQLLKAQFG-LQEDVEALISRKRELFGVSFEESKAL  86

Query  520  IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPA  341
               PGA  L+ +    GL + +ASSA +  +    T  GL    FD +VS + F   KP 
Sbjct  87   DLLPGARALIEELFRAGLPLQLASSASKETIGRVFTRFGL-YPYFDNLVSGEDFPKSKPD  145

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE  200
            P IFL A+++  +PP EC+VIED+  G+ AAKAA M CI   +  +E
Sbjct  146  PAIFLHAARLSGMPPRECLVIEDSANGVTAAKAAGMFCIGYRSEHSE  192



>gb|AFJ07831.1| HAD hydrolase, family IA, variant 3 [Prevotella intermedia 17]
Length=216

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = -1

Query  550  LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVS  371
            LD+Y +        G  + V Q K  G+K A+ +S+++ K++           +FDA+ +
Sbjct  79   LDEYERQMQYTYVDGLIDFVQQLKQNGVKTAIVTSSNKSKMENVYRQHATFKQLFDAVFT  138

Query  370  ADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTI  191
            A+ F   KP+PD +L A++ L V P++C+V ED+  G+++  AAK R I ++TT + ++I
Sbjct  139  AEDFHESKPSPDGYLTAARALGVEPTDCIVFEDSFNGLRSGLAAKARVIGLSTTNSVESI  198

Query  190  EAAAPSLIRKGISY  149
            +     +I   + Y
Sbjct  199  KEFTKEVIPNFVGY  212



>ref|WP_038674841.1| haloacid dehalogenase [Streptococcus equi]
 gb|KIQ75970.1| haloacid dehalogenase [Streptococcus equi subsp. zooepidemicus]
 gb|KIS12046.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz57]
 gb|KIS13802.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz105]
 gb|KIS20887.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz35]
Length=212

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  90   GAVQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAEWLSVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>gb|ACG62029.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
MGCS10565]
 gb|AEJ24882.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
ATCC 35246]
 gb|AIA67861.1| haloacid dehalogenase [Streptococcus equi subsp. zooepidemicus 
CY]
Length=213

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  91   GAVQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  149

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED   G QAAKAA+M CI
Sbjct  150  LKAAEWLSVDPKTCLVIEDTKHGSQAAKAAQMTCI  184



>ref|WP_031131983.1| hydrolase [Streptomyces sp. NRRL WC-3719]
Length=229

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 72/122 (59%), Gaps = 5/122 (4%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FP    LV +  + G+ +AVAS + R  ++  L  AGLS   F A+VSA+   + KPAPD
Sbjct  87   FPEMRLLVERLHADGVPMAVASGSSRAAIETVLAGAGLS-GRFGALVSAEEVPHGKPAPD  145

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIRKGI  155
            +FL A++ L   PS CVV+EDA  G +AA AA MRC+AV    +     A AP+ +  G+
Sbjct  146  VFLEAARRLGADPSACVVVEDAPPGAEAAHAAGMRCVAVPYVPS----TARAPAFLEAGL  201

Query  154  SY  149
             +
Sbjct  202  LF  203



>ref|WP_022105032.1| hAD hydrolase family IA [Dialister sp. CAG:486]
 emb|CDA50286.1| hAD hydrolase family IA [Dialister sp. CAG:486]
Length=215

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  511  PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDI  332
            PG  E++    + G+ +A+ SS  R ++++NL+ +GL+ S F A+VS D   + KPAPDI
Sbjct  87   PGCREILASLHACGIPMAIGSSGRRAQIESNLSVSGLT-SYFSAVVSGDEVLHGKPAPDI  145

Query  331  FLAASKILNVPPSECVVIED  272
            FL A+K L VPP++C V ED
Sbjct  146  FLLAAKRLGVPPADCYVFED  165



>ref|WP_009610953.1| phosphatase [Caldanaerobacter subterraneus]
 gb|AAM25162.1| predicted phosphatase/phosphohexomutase [Caldanaerobacter subterraneus 
subsp. tengcongensis MB4]
 gb|EEB75430.1| haloacid dehalogenase-like hydrolase, putative [Caldanaerobacter 
subterraneus subsp. pacificus DSM 12653]
Length=224

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 80/161 (50%), Gaps = 6/161 (4%)
 Frame = -1

Query  748  CACNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKK  569
               +SE    +   ++F E+GV++T E+   F G   + ++      +  L  + E   +
Sbjct  12   VMIDSEPVHLKLERELFRELGVEITEEEHMTFVG-SSSYYMWEKIKERFNLKESVEELVR  70

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDA-NLTAAGLSL-  395
            R  + YLD        I  PG  ELV +   +  K+AVASS+    +D   L    L+L 
Sbjct  71   RDRKRYLDHVLSTGEIIPVPGIQELVKKLFEREYKLAVASSS---PIDVIELVVQKLNLK  127

Query  394  SMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            + FD +VS D  +  KP PDIFL  ++ L V P ECVVIED
Sbjct  128  NFFDMLVSGDYVKKSKPYPDIFLYTAEKLRVKPEECVVIED  168



>ref|WP_015940279.1| haloacid dehalogenase [Chloroflexus aggregans]
 gb|ACL24420.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Chloroflexus 
aggregans DSM 9485]
Length=227

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 83/163 (51%), Gaps = 9/163 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFF  560
            ++E P+  +  +++AE GV ++V D+A   G   A F      V  V   +P  A++   
Sbjct  16   DTETPALHSWQEIYAEYGVTLSVHDWAVTLG-ANAGFDAHAHLVALVRERDPLLAEQLIA  74

Query  559  E---IYLDKYAKPNSGIG----FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGL  401
            E   I   + A+ ++        PG  EL+ +  + GL  AVASS+ R  V+  L    +
Sbjct  75   ERDLILARRQARKDALSADQPLLPGVAELLAEAHTAGLPCAVASSSSRRWVEGWLRRLDV  134

Query  400  SLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
                F  IV+AD     KPAPD+FL A+  L VPP+ C+V+ED
Sbjct  135  -YHAFTTIVTADDVAATKPAPDLFLTAATRLGVPPNACLVLED  176



>ref|WP_042680670.1| hypothetical protein [Anaerosalibacter sp. ND1]
Length=215

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/177 (32%), Positives = 91/177 (51%), Gaps = 10/177 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVA---NVKGVLGFNPEAAKK  569
            +SE       +DV  + G++ + ED+  + G  +           N+K  L +  +  + 
Sbjct  15   DSEIIHYEVFMDVSRKHGIESSFEDYNKYVGSTDEAIYSAFKEKYNLKEDLDYLIKEHQD  74

Query  568  RFFEIY-LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
            RF EI  + K  +P  G+      EL+ +  ++G K+A+ASSA  + +D  L    +  +
Sbjct  75   RFMEILDMKKDIEPIKGVK-----ELIIEFHNRGYKLALASSAPYMNIDKVLDLFNIE-T  128

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
             FD  +S +  E  KP P IFL A+K L + P EC+VIED+  G+ AAK A M+C+ 
Sbjct  129  YFDIRISGEDLEQGKPHPGIFLNAAKFLKLNPKECLVIEDSKNGVLAAKRAGMKCLG  185



>ref|WP_028905267.1| phosphatase [Prevotella intermedia]
Length=206

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -1

Query  550  LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVS  371
            LD+Y +        G  + V Q K KG+K A+ +S+++ K++           +FDA+ +
Sbjct  69   LDEYERQMQYTYVDGLTDFVQQLKQKGVKTAIVTSSNKSKMENVYRQHATFKQLFDAVFT  128

Query  370  ADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTI  191
            A+ F   KP+PD +L A++ L V P++C+V ED+  G+++  AAK + I ++TT + ++I
Sbjct  129  AEDFHESKPSPDGYLTAARALGVEPTDCIVFEDSFNGLRSGLAAKAQVIGLSTTNSVESI  188

Query  190  EAAAPSLIRKGISY  149
            +     +I   + Y
Sbjct  189  KEFTKEVIPNFVGY  202



>ref|WP_012679218.1| haloacid dehalogenase [Streptococcus equi]
 emb|CAW93046.1| haloacid dehalogenase-like hydrolase [Streptococcus equi subsp. 
equi 4047]
Length=212

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 64/95 (67%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  90   GAAQLIKHLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED+  G QAAKAA+M CI
Sbjct  149  LKAAEWLSVDPKTCLVIEDSKHGSQAAKAAQMTCI  183



>ref|WP_011957985.1| haloacid dehalogenase [Roseiflexus sp. RS-1]
 gb|ABQ91642.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Roseiflexus 
sp. RS-1]
Length=221

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 90/177 (51%), Gaps = 16/177 (9%)
 Frame = -1

Query  730  EPSRRAAVDVFAEMGVQV--TVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFE  557
            E  RR   D+  E  +    T + + P+   GE   L GV         + EA ++   E
Sbjct  27   EQYRRYGADLRPERWMHGLGTTDGYDPY---GELESLTGVI-------LDREALRREHRE  76

Query  556  IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAI  377
             Y+   A+       PG  EL+   + +G+++AVASSA R  V+  L    +  S     
Sbjct  77   RYVALCAQQPLQ---PGVRELIVAARKRGIRLAVASSASREWVEGWLEHHRIRDSFHCVR  133

Query  376  VSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
              +D    +KPAPD+FL+A+  L+V P  CVV+ED+  G++AA+AA MRCIAV   L
Sbjct  134  TRSDGL-RVKPAPDLFLSAAACLDVAPESCVVLEDSPNGMRAAEAAGMRCIAVPVAL  189



>ref|WP_030889858.1| hydrolase [Streptomyces sp. NRRL F-5053]
Length=248

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 80/155 (52%), Gaps = 8/155 (5%)
 Frame = -1

Query  676  TVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKKRFFEIYLDKYAKPNSGIGFPGA  503
            T E+ A F G+G    L  +    G+     E  A K R    YLD  A       FP  
Sbjct  42   TWEEHARFIGIGTRETLETLRREHGLAASVEELLAEKNRH---YLDLAADGTEV--FPEM  96

Query  502  FELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLA  323
             +LV +  +  + +AVAS + R  +D  L A GL   +F   VSA+     KP PD+FL 
Sbjct  97   RKLVERLHAAEVPLAVASGSSRAAIDTVLAAGGLD-GLFPVRVSAEEVRAGKPEPDVFLE  155

Query  322  ASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            A++ L VPP  CVV+EDA  G +AA+ A MRC+AV
Sbjct  156  AARRLGVPPERCVVLEDAPPGAEAARRAGMRCVAV  190



>ref|WP_022449833.1| hAD-superfamily hydrolase subfamily IA variant 3 [Roseburia sp. 
CAG:303]
 emb|CDE53161.1| hAD-superfamily hydrolase subfamily IA variant 3 [Roseburia sp. 
CAG:303]
Length=226

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -1

Query  511  PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDI  332
            PGA E V + K  G  +AVASS+ R K+  N+   G++   FD IVS    E+ KP PDI
Sbjct  91   PGAAECVREWKQAGYLLAVASSSKREKILQNIKRLGIA-DCFDRIVSGMELEHPKPNPDI  149

Query  331  FLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
            FL A+K+L V P EC+VIED+  G++AA +A M C+ 
Sbjct  150  FLEAAKLLEVKPEECLVIEDSGNGVKAAVSAGMACLG  186



>ref|WP_028436013.1| hydrolase [Streptomyces sp. TAA486]
Length=227

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 57/99 (58%), Gaps = 1/99 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FPG   LV Q       +AVAS + R  +DA L  +GL+  +    VSA+   + KP PD
Sbjct  91   FPGMRSLVEQLHGAAYPLAVASGSSRAAIDAVLEGSGLA-PLLPVRVSAEEVAHGKPEPD  149

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            IFL A++ L VPP  CV +EDA  G  AA  A MRC+AV
Sbjct  150  IFLEAARRLGVPPRRCVALEDAAPGADAAHRAGMRCVAV  188



>ref|WP_043025540.1| haloacid dehalogenase [Streptococcus equi]
 gb|KIS08817.1| phosphoglycolate phosphatase [Streptococcus equi subsp. zooepidemicus 
Sz5]
Length=212

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  90   GAVQLIKYLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAEWLSVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>ref|WP_012678251.1| haloacid dehalogenase [Streptococcus equi]
 emb|CAW99885.1| haloacid dehalogenase-like hydrolase [Streptococcus equi subsp. 
zooepidemicus]
Length=212

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 63/95 (66%), Gaps = 1/95 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            GA +L+    +KG ++AVASS+ +  +  NLTA GL L  F+ +VS +     KPAPDIF
Sbjct  90   GAVQLIKYLHAKGYRLAVASSSPKADIIRNLTALGL-LDCFEVLVSGEEVARSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCI  224
            L A++ L+V P  C+VIED   G QAAKAA+M CI
Sbjct  149  LKAAEWLSVDPKTCLVIEDTKHGSQAAKAAQMTCI  183



>ref|WP_026762227.1| haloacid dehalogenase [Selenomonas artemidis]
Length=216

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 55/81 (68%), Gaps = 1/81 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
             PGA E++   +++G++++ ASS+  ++++ NLT +GL    FD +V  D   + KPAPD
Sbjct  86   MPGAREILAYFRAEGVRISTASSSTTVQIEKNLTQSGLR-DYFDVVVGGDHVAHGKPAPD  144

Query  334  IFLAASKILNVPPSECVVIED  272
            IFL A++ + VPP++C V ED
Sbjct  145  IFLLAAERIGVPPADCYVFED  165



>ref|WP_027890959.1| haloacid dehalogenase [Meiothermus chliarophilus]
Length=221

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/176 (32%), Positives = 94/176 (53%), Gaps = 6/176 (3%)
 Frame = -1

Query  742  CNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLG-FNPEAAKKR  566
             ++E+    A    +A  G ++T++D+ P+ G  +  F    A+++  +G F+ EA  + 
Sbjct  13   LDTEQAEYTAWTRTYARYGGELTLQDYLPWVGTADPVF-DPYAHLEAQIGPFDREAFDRE  71

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
              E     YA        PG  + + Q +S GLK+AVASS+    V  +L    L    F
Sbjct  72   RRE---KLYALLAELQPLPGVLDWLEQARSLGLKLAVASSSSAHWVLGHLEQHRLH-EFF  127

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            + +++ +  E  KP P +FL A++ L   P+ECV +ED+L G++AAKAA M  +AV
Sbjct  128  EHVITREHVERTKPDPALFLKAAEALGATPAECVAVEDSLNGVKAAKAAGMYAVAV  183



>ref|WP_027757414.1| hydrolase [Streptomyces sp. CNH099]
Length=228

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 98/198 (49%), Gaps = 13/198 (7%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEA-AKKR  566
            N  E  RR    V A  GV   T ED A F G+G    L  +    G+     E  A+K 
Sbjct  23   NYYEAGRR----VLARHGVPDFTWEDHAGFLGVGTRETLRTLRARYGLAAPVAELLAEKN  78

Query  565  FFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMF  386
               + L + A       +P   +L     + G   AVAS + R  ++A L AAGL   +F
Sbjct  79   AEYVRLARAATE----AYPQMRKLAEMLYAAGCPTAVASGSSRAAIEAVLPAAGLD-GLF  133

Query  385  DAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT--  212
              +VSA+     KP PD+FLAA++ L V P++C V+EDA  G +AA+ A MRC+AV    
Sbjct  134  TTLVSAEEVARGKPEPDVFLAAARRLGVRPADCTVVEDAPPGWEAARRAGMRCVAVPYLP  193

Query  211  TLAEDTIEAAAPSLIRKG  158
              A++ + A A  + R G
Sbjct  194  EQADEAVAAGAGLVFRGG  211



>gb|EQG55870.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00145]
Length=216

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 86/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  7    DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYDEKTK  66

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P   I   G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  67   NMIE--FMERKGAP---IKL-GVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  119

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  120  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  177



>ref|WP_022619260.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile]
 emb|CCL27188.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T11]
 emb|CCL31160.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E15]
Length=226

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_021376252.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile]
 gb|EQE83786.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD69]
Length=226

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYNEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERQGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPKNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_030874787.1| hydrolase [Streptomyces sp. NRRL S-1868]
Length=248

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 81/155 (52%), Gaps = 8/155 (5%)
 Frame = -1

Query  676  TVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKKRFFEIYLDKYAKPNSGIGFPGA  503
            T E+ A F G+G    L  +    G+     E  A K R    YLD  A  +    FP  
Sbjct  42   TWEEHARFIGIGTRETLETLRREHGLAAPVEELLAEKNRH---YLDLAA--DGTEVFPEM  96

Query  502  FELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLA  323
             +LV +  +  + +AVAS + R  +D  L A GL   +F   VSA+     KP PD+FL 
Sbjct  97   RKLVERLHAAEVPLAVASGSSRAAIDTVLAAGGLD-GLFPVRVSAEEVRAGKPEPDVFLE  155

Query  322  ASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            A++ L VPP  CVV+EDA  G +AA+ A MRC+AV
Sbjct  156  AARRLGVPPERCVVLEDAPPGAEAARRAGMRCVAV  190



>gb|ELQ83199.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Streptomyces 
rimosus subsp. rimosus ATCC 10970]
Length=212

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/169 (36%), Positives = 87/169 (51%), Gaps = 9/169 (5%)
 Frame = -1

Query  715  AAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKKRFFEIYLD  545
            A   V A  GV   T ED   F G+G    L  +     +     +  A K R    YL+
Sbjct  10   ATRSVLARHGVTGFTWEDHTRFIGIGSRETLATLRREHAIDAPLDDLLADKNR---AYLE  66

Query  544  KYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSAD  365
            + A+ ++ + FP   + V    + G  +AVAS + R  ++A L   GL  +    +VSA+
Sbjct  67   R-ARAHTEV-FPEMRKFVELLHAAGHPLAVASGSSRHAIEAVLGGTGLD-AQLTVLVSAE  123

Query  364  AFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
                 KPAPDIFL A++ L+ PP ECVV+EDA  G +AA  A MRC+A+
Sbjct  124  EVGQGKPAPDIFLEAARRLDAPPQECVVLEDAPPGAEAAHRAGMRCVAI  172



>ref|WP_041734454.1| HAD family hydrolase [Ruminiclostridium thermocellum]
Length=225

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  YLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIV  374
            Y+  Y + N     PG FEL+     +G+  AVA+S +R + +  LT AG+    FDAIV
Sbjct  79   YVLDYIEKNGMPVKPGLFELLDYLDHRGIMKAVATSTERKRTEKYLTLAGIR-ERFDAIV  137

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
              D  E  KP PDIFL A++     P EC+V+ED+  GI+AA  AKM  + +      D 
Sbjct  138  CGDEVERGKPEPDIFLEAARRTGKRPEECIVLEDSANGIKAASRAKMFPVLIPDMRRPDE  197

Query  193  IE  188
            +E
Sbjct  198  VE  199



>gb|ABN52015.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum ATCC 27405]
Length=227

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  YLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIV  374
            Y+  Y + N     PG FEL+     +G+  AVA+S +R + +  LT AG+    FDAIV
Sbjct  81   YVLDYIEKNGMPVKPGLFELLDYLDHRGIMKAVATSTERKRTEKYLTLAGIR-ERFDAIV  139

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
              D  E  KP PDIFL A++     P EC+V+ED+  GI+AA  AKM  + +      D 
Sbjct  140  CGDEVERGKPEPDIFLEAARRTGKRPEECIVLEDSANGIKAASRAKMFPVLIPDMRRPDE  199

Query  193  IE  188
            +E
Sbjct  200  VE  201



>ref|WP_009752830.1| haloacid dehalogenase [Selenomonas sp. oral taxon 137]
 gb|EFR40537.1| HAD hydrolase, family IA, variant 3 [Selenomonas sp. oral taxon 
137 str. F0430]
Length=216

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
             PG  E++   +++G++++ ASS+  ++++ NLT +GL    FD IV  D   + KPAPD
Sbjct  86   MPGTREILAYFRAEGVRISTASSSTTVQIEKNLTQSGLR-DYFDVIVGGDHVAHGKPAPD  144

Query  334  IFLAASKILNVPPSECVVIED  272
            IFL A++ + VPP++C V ED
Sbjct  145  IFLLAAERIGVPPADCYVFED  165



>ref|WP_019393780.1| MULTISPECIES: hypothetical protein [Bacillus]
Length=219

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/181 (34%), Positives = 91/181 (50%), Gaps = 17/181 (9%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVL---GFNPEAAKK  569
            +SE   R    DVF ++ +QV  E         + +F+GG A  K  +    F+   + +
Sbjct  16   DSEPIYRSWNKDVFKKLKIQVDEE--------TQLSFVGGTAKRKWTILKDKFSLSPSVE  67

Query  568  RFF----EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGL  401
                   EI+  K     S + FP    L+ + K   +  A+ASS+++ K+   L    L
Sbjct  68   ELICLQNEIFSQKEWAFKSLL-FPAVLPLLQELKEHSIPTALASSSNKKKISDVLDQCEL  126

Query  400  SLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
              + FD ++S + FE  KP PDIFL A++ L VP S CVVIED+  G+ AAK A M C+ 
Sbjct  127  R-AYFDEVISGEDFERGKPDPDIFLHAAEKLEVPTSNCVVIEDSYNGLTAAKRAGMHCVG  185

Query  220  V  218
            V
Sbjct  186  V  186



>ref|WP_020384906.1| hypothetical protein [Kribbella catacumbae]
Length=216

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 79/159 (50%), Gaps = 10/159 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTG--MGEANFLGGVANVKGVLGFNPEAAKKR  566
            +SE    R  + +  E+G   T+ED     G  +G+A  +       G     PE   +R
Sbjct  16   DSEPEWARVQIGLLTELGAIWTIEDCMSLVGSDLGDAVKVWMTRIPAG--AIEPEELAER  73

Query  565  FFEIYLDKYAKPNSGIGF-PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
               +Y +       G+   PGA EL+T  +S G+  A+ S++ R+ +DA L+   L   +
Sbjct  74   ---MYGEVVRALKEGVALRPGALELLTALRSAGIPCALVSASYRVMIDAVLS--HLPPDL  128

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            FD IV+ D   N KP P+ +L A+  L V P+ C+VIED
Sbjct  129  FDVIVAGDEVRNGKPHPEPYLTAAAELRVDPANCIVIED  167



>ref|WP_037294841.1| HAD family hydrolase [Ruminiclostridium thermocellum]
Length=225

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  YLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIV  374
            Y+  Y + N     PG FEL+     +G+  AVA+S +R + +  LT AG+    FDAIV
Sbjct  79   YVLDYIEKNGMPVKPGLFELLDYLDHRGIMKAVATSTERKRTEKYLTLAGIR-ERFDAIV  137

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
              D  E  KP PDIFL A++     P EC+V+ED+  GI+AA  AKM  + +      D 
Sbjct  138  CGDEVERGKPEPDIFLEAARRTGKRPEECIVLEDSANGIKAASRAKMFPVLIPDIRRPDE  197

Query  193  IE  188
            +E
Sbjct  198  VE  199



>ref|WP_004624246.1| HAD-superfamily hydrolase [[Clostridium] termitidis]
 gb|EMS73330.1| HAD-superfamily hydrolase [ [[Clostridium] termitidis CT1112]
Length=216

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 67/97 (69%), Gaps = 3/97 (3%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM-FDAIVSADAFENLKPAPDI  332
            G  EL+   K +G+ + +ASS+ R  ++  +   GL +   FDA++S +  EN KPAPDI
Sbjct  90   GIPELIDDLKGRGIYIGLASSSSREFIE--MVLKGLHIYHNFDAVISGEEVENSKPAPDI  147

Query  331  FLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
            FL A+++L V P+EC+V+ED+  G++AAKAA M+CIA
Sbjct  148  FLKAAEVLKVAPAECIVLEDSGNGVKAAKAAGMKCIA  184



>ref|WP_013786947.1| phosphatase [Thermoanaerobacterium xylanolyticum]
 gb|AEF16185.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Thermoanaerobacterium 
xylanolyticum LX-11]
Length=218

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 80/154 (52%), Gaps = 19/154 (12%)
 Frame = -1

Query  706  DVFAEMGVQVTVEDFAPFTGMGEA---NFLGGVANVKGVLGFNPEAAKKRFFEIYLDKY-  539
            D+F E+G  ++ E+   F G        ++    NV   +    E  +KR+F+ Y+ K+ 
Sbjct  26   DIFKEIGANISFEEHISFVGTTSHYMWEYVKNKCNVPFTVEELVEMDRKRYFD-YISKHD  84

Query  538  --AKPNSGIGFPGAFELVTQCKSKGLKVAVASSA--DRIKVDANLTAAGLSL-SMFDAIV  374
               KP  G+      ELV +   + +++AVASS+  D I++        L L + FD +V
Sbjct  85   DAVKPIVGVD-----ELVKELHKRNMRLAVASSSPIDVIEI----VVKRLKLENYFDELV  135

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            S D  +  KP PDIFL A++ LNV P  C+VIED
Sbjct  136  SGDFVKRSKPYPDIFLYAAEKLNVAPERCIVIED  169



>ref|WP_028458715.1| haloacid dehalogenase [Chloroflexus sp. Y-396-1]
Length=227

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 86/164 (52%), Gaps = 11/164 (7%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGM-----GEANFLGGVANVKGVLGFNPEAA  575
            ++E P+ ++  +++AE G  ++V+D+A   G        A+ +  +      L     AA
Sbjct  16   DTETPALQSWQEIYAEYGETLSVDDWAVTLGANRGFDAHAHLVALLRKRDPRLAEEVAAA  75

Query  574  KKRFF---EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAG  404
            +       ++  D  +   S +  PG  EL+ + ++ GL  AVASS+ R  V+  L    
Sbjct  76   RDNILARRQMRKDVLSARQSLL--PGVAELLAEARASGLPCAVASSSSRQWVEGWLQRLN  133

Query  403  LSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            +  S F  +V+AD     KPAPD+FL A++ LN+PPS C+V+ED
Sbjct  134  VR-SAFAVVVTADDVIATKPAPDLFLTAAQRLNLPPSACLVLED  176



>gb|EEU02433.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum DSM 2360]
 gb|EFB39162.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum JW20]
 gb|ADU74504.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum DSM 1313]
 gb|EIC05388.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum YS]
 gb|EIC10623.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum AD2]
 emb|CDG35475.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Ruminiclostridium 
thermocellum BC1]
Length=227

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 67/122 (55%), Gaps = 1/122 (1%)
 Frame = -1

Query  553  YLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIV  374
            Y+  Y + N     PG FEL+     +G+  AVA+S +R + +  LT AG+    FDAIV
Sbjct  81   YVLDYIEKNGMPVKPGLFELLDYLDHRGIMKAVATSTERKRTEKYLTLAGIR-ERFDAIV  139

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
              D  E  KP PDIFL A++     P EC+V+ED+  GI+AA  AKM  + +      D 
Sbjct  140  CGDEVERGKPEPDIFLEAARRTGKRPEECIVLEDSANGIKAASRAKMFPVLIPDIRRPDE  199

Query  193  IE  188
            +E
Sbjct  200  VE  201



>gb|KJF63674.1| hydrolase [Peptoclostridium difficile]
Length=226

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYNEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPKNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_032920597.1| hydrolase [Streptomyces rimosus]
Length=220

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            +SE     A   V A  GV   T ED   F G+G    L  +     +     +  A K 
Sbjct  10   DSEPNYFEATRSVLARHGVTGFTWEDHTRFIGIGSRETLATLRREHAIDAPLDDLLADKN  69

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R    YL++ A+ ++ + FP   + V    + G  +AVAS + R  ++A L   GL  + 
Sbjct  70   R---AYLER-ARAHTEV-FPEMRKFVELLHAAGHPLAVASGSSRHAIEAVLGGTGLD-AQ  123

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
               +VSA+     KPAPDIFL A++ L+ PP ECVV+EDA  G +AA  A MRC+A+
Sbjct  124  LTVLVSAEEVGQGKPAPDIFLEAARRLDAPPQECVVLEDAPPGAEAAHRAGMRCVAI  180



>ref|WP_009658403.1| haloacid dehalogenase [Selenomonas sp. FOBRC9]
 gb|EJP31215.1| HAD hydrolase, family IA, variant 3 [Selenomonas sp. FOBRC9]
Length=216

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
             PG  E++   +++G++++ ASS+  ++++ NLT +GL    FD IV  D   + KPAPD
Sbjct  86   MPGVREILAYFRAEGVRISTASSSTTVQIEKNLTQSGLR-DYFDVIVGGDHVAHGKPAPD  144

Query  334  IFLAASKILNVPPSECVVIED  272
            IFL A++ + VPP++C V ED
Sbjct  145  IFLLAAERIGVPPADCYVFED  165



>ref|WP_003426722.1| hydrolase [Peptoclostridium difficile]
 gb|EHJ32945.1| HAD hydrolase, family IA, variant 3 [Peptoclostridium difficile 
050-P50-2011]
 gb|EHJ33282.1| HAD hydrolase, family IA, variant 3 [Peptoclostridium difficile 
002-P50-2011]
 gb|EQG17546.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile DA00065]
 gb|EQK20988.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P71]
 gb|EQK30129.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P74]
 emb|CCL03239.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile E13]
 emb|CCL08233.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile CD002]
Length=226

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ N+      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTNIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  CFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPKNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_031458377.1| haloacid dehalogenase [Chloroflexus sp. MS-G]
Length=227

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 11/164 (7%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGM-----GEANFLGGVANVKGVLGFNPEAA  575
            ++E P+ ++  +++AE G  ++V+D+A   G        A+ +  +      L     AA
Sbjct  16   DTETPALQSWQEIYAEYGETLSVDDWAVTLGANKGFDAHAHLVALLRKRDPRLAEEVAAA  75

Query  574  KKRFF---EIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAG  404
            +       +   D  +   S +  PG  EL+T+  + GL  AVASS+ R  V+  L    
Sbjct  76   RDTILARRQQRKDVLSTRQSLL--PGVAELLTEAYASGLPCAVASSSSRQWVEGWLQRLN  133

Query  403  LSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
            +  S F  +V+AD     KPAPD+FL A++ LN+PPS C+V+ED
Sbjct  134  VR-SAFAVVVTADDVAATKPAPDLFLTAARRLNLPPSVCLVLED  176



>ref|WP_041444645.1| phosphatase [Syntrophobotulus glycolicus]
Length=215

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 3/164 (2%)
 Frame = -1

Query  700  FAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSG  521
              + GV++T E+ + + G+        +    G+     E   K+ +   L    +    
Sbjct  28   LQDYGVEITNEELSKYVGISNPVMWSELREKYGLAAAVEELLAKQMYYKKLLFGGRELQC  87

Query  520  IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPA  341
            I   G   L+   K  GLK+ +ASS+ R  ++  +   GL+   F+A+VS +  E  KPA
Sbjct  88   I--EGIESLLRNLKHSGLKIGLASSSPREFIEIIINNLGLA-GYFEAVVSGEEVERSKPA  144

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            PD+FL A+++L V PS+C+VIED+  G++AAKAA M+CI    T
Sbjct  145  PDVFLRAAELLKVNPSDCMVIEDSEHGVKAAKAAGMKCIGYLNT  188



>gb|ADY55297.1| HAD-superfamily hydrolase, subfamily IA, variant 3 [Syntrophobotulus 
glycolicus DSM 8271]
Length=218

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 87/164 (53%), Gaps = 3/164 (2%)
 Frame = -1

Query  700  FAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSG  521
              + GV++T E+ + + G+        +    G+     E   K+ +   L    +    
Sbjct  31   LQDYGVEITNEELSKYVGISNPVMWSELREKYGLAAAVEELLAKQMYYKKLLFGGRELQC  90

Query  520  IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPA  341
            I   G   L+   K  GLK+ +ASS+ R  ++  +   GL+   F+A+VS +  E  KPA
Sbjct  91   I--EGIESLLRNLKHSGLKIGLASSSPREFIEIIINNLGLA-GYFEAVVSGEEVERSKPA  147

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            PD+FL A+++L V PS+C+VIED+  G++AAKAA M+CI    T
Sbjct  148  PDVFLRAAELLKVNPSDCMVIEDSEHGVKAAKAAGMKCIGYLNT  191



>ref|WP_030321939.1| hydrolase [Streptomyces sp. NRRL B-3229]
Length=228

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 93/194 (48%), Gaps = 23/194 (12%)
 Frame = -1

Query  700  FAEMGVQVTVEDFAPFTGMGEANFLGG------VANVKGVLGFNPEAAK------KRFFE  557
            + E G Q+  E   P  G  +     G      VA  K + G     A+      +R+ E
Sbjct  24   YYEAGRQLLAEHGVPDFGWADHERYVGISTRETVARWKSLYGLRASVAELLADKNRRYLE  83

Query  556  IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAI  377
            +     A+  + + +P     V    ++G+ +AVAS + R  ++A L   GL  +    +
Sbjct  84   L-----ARAATRV-YPEMRRFVELLAAEGVPMAVASGSSREAIEAILAGTGLD-AYLRTV  136

Query  376  VSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAED  197
            VSAD   + KPAPDIFL A++ L   PS+CVV+EDA  G  AA AA MRC+A+    A  
Sbjct  137  VSADEVAHGKPAPDIFLEAARRLGAAPSDCVVLEDAAPGAAAAHAAGMRCVAIPYVPA--  194

Query  196  TIEAAAPSLIRKGI  155
              +A AP     G+
Sbjct  195  --QADAPDFAHAGL  206



>ref|WP_030616031.1| hydrolase [Streptomyces fulvoviolaceus]
Length=240

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 101/203 (50%), Gaps = 19/203 (9%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEA-----  578
            +SE     A+  + AE GV   T      + G+   + L    ++K + G  P       
Sbjct  19   DSEPNYYEASRQILAEHGVLDFTWAQHERYVGI---STLETTVHLKELYGLRPSVDELLA  75

Query  577  -AKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGL  401
               +R+ E  L + + P     +P   + V    ++G+ +AVAS +    +DA LT  GL
Sbjct  76   DTNRRYLE--LARASTP----AYPEMRKFVELLAAEGVPMAVASGSSPEAIDAILTGTGL  129

Query  400  SLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
              +    +VSAD     KPAPD+FL A++ L   P++CVV+EDA  G  AA AA MRCIA
Sbjct  130  G-TYLRTLVSADEVPRGKPAPDVFLEAARQLGADPADCVVLEDAAPGAAAAHAAGMRCIA  188

Query  220  VTTTLAE-DTIE-AAAPSLIRKG  158
            +    A+ D  E A A  L+R+G
Sbjct  189  IPYVAAQADAPEFATAGLLLRRG  211



>ref|WP_030643153.1| hydrolase [Streptomyces rimosus]
Length=232

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 91/177 (51%), Gaps = 9/177 (5%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            +SE     A   V A  GV   T ED   F G+G    L  +     +     +  A K 
Sbjct  22   DSEPNYFEATRSVLARHGVTGFTWEDHTRFIGIGSRETLATLRREHAIDAPLDDLLADKN  81

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R    YL++ A+ ++ + FP   + V    + G  +AVAS + R  ++A L + GL  + 
Sbjct  82   R---AYLER-ARAHTEV-FPEMRKFVELLHAAGHPLAVASGSSRHAIEAVLGSTGLD-AQ  135

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
               +VSA+     KPAPDIFL A++ L+ PP ECVV+EDA  G +AA  A MRC+A+
Sbjct  136  LTVLVSAEEVGQGKPAPDIFLEAARRLDAPPQECVVLEDAPPGAEAAHRAGMRCVAI  192



>ref|WP_018385426.1| hypothetical protein [Streptomyces vitaminophilus]
Length=239

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 91/189 (48%), Gaps = 7/189 (4%)
 Frame = -1

Query  715  AAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKY  539
            A   V A  GV   T E    F G+G    L  +    G LG   +       + YL + 
Sbjct  26   ATRQVLAAHGVHGFTWERHTDFIGIGTRETLDALRAEHG-LGTPVDVLLAEKNDCYL-RL  83

Query  538  AKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAF  359
            A+ ++ + FPG   LV      G ++AVAS +    +D  L   GL        VSA+  
Sbjct  84   ARRSTRV-FPGMRTLVELLHGAGHRLAVASGSSPTTIDLVLGTTGLG-PWIPCRVSAEEV  141

Query  358  ENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV--TTTLAEDTIEA  185
            E  KPAPD+FL A++ L V P ECVV+EDA  G +AA  A MRC+AV      A+D   A
Sbjct  142  ERGKPAPDVFLEAARRLGVAPRECVVVEDAPPGARAAHRAGMRCLAVPYLPEQADDPAFA  201

Query  184  AAPSLIRKG  158
             A  L+ +G
Sbjct  202  TAGLLVHEG  210



>ref|WP_038654139.1| hypothetical protein [Mucinivorans hirudinis]
 emb|CDN31271.1| Beta-phosphoglucomutase [Mucinivorans hirudinis]
Length=214

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 88/168 (52%), Gaps = 18/168 (11%)
 Frame = -1

Query  688  GVQVTVEDFAPFTGMGEANFLGGVANV----KGVLGFNPEAAKKRFFEIYLDKYA---KP  530
            G+    E    F GMG ++    V  +    + VL +  E       ++Y D Y+   KP
Sbjct  32   GIDFPPEKVNSFFGMGNSDIFRSVMGLDITDEQVLEYAEEKE-----QLYRDLYSPTIKP  86

Query  529  NSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENL  350
             +G+       L+   ++KG+K+AV SSA R  VD  L   G+    FDAI   D     
Sbjct  87   LAGL-----ISLLQDLRAKGIKIAVGSSAMRKNVDFVLDECGIR-PYFDAISDGDMVAKA  140

Query  349  KPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            KP P IFL A++++N+ P EC+V ED+ AG++AA+ A M+ +AV T+ 
Sbjct  141  KPDPSIFLLAAELMNLKPEECLVFEDSFAGVEAARRAGMKVVAVATSF  188



>ref|WP_019093269.1| HAD family hydrolase [Pseudomonas fluorescens]
Length=231

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFE--NLKPA  341
             PGA ELV   K   + +AV +S+ +I      T  G   ++FD IV+AD  E    KPA
Sbjct  95   MPGAQELVRHLKEHRIPIAVGTSSSQISFGEKTTRHGDWFALFDTIVTADDPEVTAAKPA  154

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIR  164
            PDIFL A++ L V P+EC+V ED+  G+ AA+AA M  IAV      D+  A A  +IR
Sbjct  155  PDIFLTAARRLGVAPAECLVFEDSPFGVTAARAAGMSVIAVPDPAMADSKFAHAHGIIR  213



>ref|WP_022214734.1| hAD hydrolase family IA variant 3 [Blautia sp. CAG:237]
 emb|CDB76741.1| hAD hydrolase family IA variant 3 [Blautia sp. CAG:237]
Length=219

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 63/137 (46%), Gaps = 21/137 (15%)
 Frame = -1

Query  622  GVANV----KGVLGFNPEAAKKRFFEIY-----LDKYAKPNSGIGF-----------PGA  503
            GVA++    +  LG N    ++ FFE Y      DKY K  S +             PG 
Sbjct  31   GVADIEETCRACLGINATVTREIFFERYGQDFPYDKYKKEMSDLFHANAAGGKLPKKPGI  90

Query  502  FELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLA  323
             EL+   + + +K AVASS  R  V   L   GL LS FD IV  D     KP PDI+L 
Sbjct  91   RELLEYLRRENIKTAVASSTRRDLVTRELEEGGL-LSYFDEIVCGDMVSRSKPEPDIYLE  149

Query  322  ASKILNVPPSECVVIED  272
            A + L   P +C  IED
Sbjct  150  ACRRLQERPEDCYAIED  166



>ref|WP_030179613.1| MULTISPECIES: hydrolase [Streptomyces]
Length=232

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 90/177 (51%), Gaps = 9/177 (5%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQ-VTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            +SE     A   V A  GV   T ED   F G+G    L  +     +     +  A K 
Sbjct  22   DSEPNYFEATRSVLARHGVTGFTWEDHTRFIGIGSRETLATLRREHAIDAPLDDLLADKN  81

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R    YL++ A+ ++ + FP   + V    + G  +AVAS + R  ++A L   GL  + 
Sbjct  82   R---AYLER-ARAHTEV-FPEMRKFVELLHAAGHPLAVASGSSRHAIEAVLGGTGLD-AQ  135

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
               +VSA+     KPAPDIFL A++ L+ PP ECVV+EDA  G +AA  A MRC+A+
Sbjct  136  LTVLVSAEEVGQGKPAPDIFLEAARRLDAPPQECVVLEDAPPGAEAAHRAGMRCVAI  192



>ref|WP_007714331.1| hydrolase [[Clostridium] asparagiforme]
 gb|EEG53805.1| HAD hydrolase, family IA, variant 3 [ [[Clostridium asparagiforme] 
DSM 15981]
Length=215

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  592  FNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLT  413
            F     +KR+ + YL+++  P      PG   L+   +  G K A+A+S       A L 
Sbjct  66   FKHRGERKRYMDAYLEEHGLPVK----PGLGRLLGYLRENGYKTALATSTHAETAGAYLK  121

Query  412  AAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
             AG+    FD  V  D  E  KP PDI+L A+K+L +PP EC+V+ED
Sbjct  122  IAGVE-EYFDCKVFGDMVERGKPNPDIYLRAAKLLGIPPEECLVLED  167



>ref|WP_024884987.1| hydrolase [Streptomyces sp. CNH189]
Length=231

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/120 (42%), Positives = 70/120 (58%), Gaps = 2/120 (2%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FP     V +   +G+++AVAS +    +DA L+  GL  +    +VSAD   + KPAPD
Sbjct  92   FPQMRTFVERLAGEGVRLAVASGSSAEAIDAILSGTGLD-AYLRTVVSADEVPHGKPAPD  150

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAE-DTIEAAAPSLIRKG  158
            +FL A++ L   P++CVV+EDA  G  AA AA MRCIAV    A+ D  E A   L+ +G
Sbjct  151  VFLEAARRLGAQPADCVVVEDAAPGAAAAHAAGMRCIAVPYVAAQADAPEFATAGLLLRG  210



>ref|WP_008976305.1| HAD family hydrolase [Coprococcus sp. HPP0048]
 gb|EGC74662.1| hypothetical protein HMPREF0490_01542 [Lachnospiraceae bacterium 
6_1_37FAA]
 gb|EGG86412.1| hypothetical protein HMPREF0987_01370 [Lachnospiraceae bacterium 
9_1_43BFAA]
Length=230

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 4/115 (3%)
 Frame = -1

Query  610  VKGVLG--FNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADR  437
            +KG+ G  F+  A ++R  EI  +  AK    I  PG  E +   + KG K+AVA++ DR
Sbjct  72   LKGIYGETFDYVAVRERRKEIMAEHLAKNGVEIK-PGVKETLNYLREKGYKLAVATATDR  130

Query  436  IKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
             + +A L   G++  MFD IV A+  EN KP PDI+L A   + V    CV +ED
Sbjct  131  ERAEAYLDEIGIT-EMFDRIVCANMVENGKPMPDIYLYACDQIGVKAEACVAVED  184



>ref|WP_024998184.1| phosphatase [Prevotella falsenii]
Length=207

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/134 (30%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = -1

Query  550  LDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVS  371
            LD+Y +        G  + V + K  G+K A+ +S+++ K++           +FDA+ +
Sbjct  69   LDEYERQMPYTYVDGFTDFVKRLKQNGVKTAIVTSSNKAKMENVYRRHASFKQLFDAVFT  128

Query  370  ADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTI  191
            A+ F   KP+PD +L A++ L V P++C+V ED+  G+++  AAK R + ++TT  E++I
Sbjct  129  AEDFHESKPSPDGYLTAARALGVQPTDCIVFEDSFNGLRSGLAAKARVVGLSTTNLEESI  188

Query  190  EAAAPSLIRKGISY  149
            +     +I   + Y
Sbjct  189  KEFTKEVIPNFVGY  202



>gb|EPD65884.1| HAD hydrolase, family IA [Coprococcus sp. HPP0048]
Length=213

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 64/115 (56%), Gaps = 4/115 (3%)
 Frame = -1

Query  610  VKGVLG--FNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADR  437
            +KG+ G  F+  A ++R  EI  +  AK    I  PG  E +   + KG K+AVA++ DR
Sbjct  55   LKGIYGETFDYVAVRERRKEIMAEHLAKNGVEIK-PGVKETLNYLREKGYKLAVATATDR  113

Query  436  IKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
             + +A L   G++  MFD IV A+  EN KP PDI+L A   + V    CV +ED
Sbjct  114  ERAEAYLDEIGIT-EMFDRIVCANMVENGKPMPDIYLYACDQIGVKAEACVAVED  167



>ref|WP_030673163.1| hydrolase [Streptomyces sp. NRRL B-1347]
Length=227

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 99/200 (50%), Gaps = 13/200 (7%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE---AAK  572
            +SE     A   + AE GV   T +D   + G+     L     + G+    P+      
Sbjct  19   DSEPNYFEAGRQLLAEQGVTDFTWQDHERYVGISTQETLARWKELYGLSAPLPDLLAEKN  78

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
            +R+ E+     A+ ++ + +P     V      G+ +AVAS + R  ++A L   GL  +
Sbjct  79   RRYLEL-----ARVSTRV-YPQMAAFVELLHEAGVPMAVASGSSRAAIEAILEGTGLD-A  131

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV--  218
                 VSAD     KPAPD+FLAA+++L   P+ CVV+EDA+ G  AAKAA MRC+A+  
Sbjct  132  RLKTYVSADEVARGKPAPDVFLAAAELLGAEPARCVVLEDAVPGALAAKAAGMRCVAIPY  191

Query  217  TTTLAEDTIEAAAPSLIRKG  158
                A+D   A A  L+R G
Sbjct  192  VPAQADDPAFATADFLVRGG  211



>ref|WP_027437140.1| hypothetical protein [Lachnospira multipara]
Length=220

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 61/101 (60%), Gaps = 1/101 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            G FEL+   K  GLK AVA+S  R     NLT+ G +    D I   D  E+ KPAPDIF
Sbjct  90   GLFELLDFIKEAGLKCAVATSTRRESAFKNLTSIG-AYDYLDGIAYGDEIEHSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            L A+ I+ V P EC+VIED++ GI+A  AA M+ + V  T+
Sbjct  149  LKAAGIVAVKPEECIVIEDSINGIKAGHAANMKVVHVPDTI  189



>ref|WP_006417787.1| HAD hydrolase, family IA, variant 3 [Eremococcus coleocola]
 gb|EFR31655.1| HAD hydrolase, family IA, variant 3 [Eremococcus coleocola ACS-139-V-Col8]
Length=212

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 93/189 (49%), Gaps = 10/189 (5%)
 Frame = -1

Query  703  VFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNS  524
            V A+ GV V +     + G         +     VL    +    R F  Y ++    + 
Sbjct  25   VLADHGVDVDLSYIDQYRGRSNPETWQEIIADFSVLDQASDYYIDRVFS-YREEIVARDG  83

Query  523  GIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKP  344
             I      EL+     KG +++VASS+   +++  + A G+  S F+ +V+ +A    KP
Sbjct  84   IIPCDHILELLNAWHGKGYRMSVASSSPMSEIERTMDALGIR-SYFEHLVTGEAVAQSKP  142

Query  343  APDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVT--------TTLAEDTIE  188
            APDIFL ++K++N+ P +C+VIED+  G+QAAK A M CIA           +LA++ +E
Sbjct  143  APDIFLYSAKLMNLEPKDCIVIEDSSHGVQAAKLAGMYCIAYVDPHEPAQDVSLADEVVE  202

Query  187  AAAPSLIRK  161
                 L RK
Sbjct  203  DYRDLLDRK  211



>ref|WP_019635430.1| beta-phosphoglucomutase [Paenibacillus fonticola]
Length=220

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 69/128 (54%), Gaps = 3/128 (2%)
 Frame = -1

Query  553  YLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIV  374
            Y++  +K +     PGA E +  C+  G+K A+ S++        L   GL+   FDAI+
Sbjct  81   YVEAISKMDHSEILPGALEFLKACRDNGIKTALGSASKNAMT--ILDNTGLT-PYFDAII  137

Query  373  SADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDT  194
                  N KP P++FL  +  L+VPP +CVV EDA AG++AA  A MRC+ V +      
Sbjct  138  DGTHTTNAKPDPEVFLLGAAALSVPPGQCVVFEDAEAGVEAAHRAGMRCVGVGSPATLGQ  197

Query  193  IEAAAPSL  170
             EA  PSL
Sbjct  198  AEAVVPSL  205



>ref|WP_023589956.1| hydrolase [Streptomyces thermolilacinus]
Length=227

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 1/99 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FP    LV +  + G+ +AVAS + R  ++A L   GLS   F  +VSA+   + KP PD
Sbjct  87   FPEMRLLVERLHADGVPMAVASGSSRAAIEAVLAGTGLS-GYFRVLVSAEEVPHGKPEPD  145

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            +FL A++ L   P+ECVV+EDA  G +AA AA MRC+AV
Sbjct  146  VFLEAARRLGADPAECVVVEDAPPGAEAAHAAGMRCVAV  184



>ref|WP_037646448.1| hydrolase [Streptomyces hygroscopicus]
Length=228

 Score = 72.0 bits (175),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 84/158 (53%), Gaps = 15/158 (9%)
 Frame = -1

Query  676  TVEDFAPFTGMGEANFLGGVANVKGVLGFNPE-----AAKKRFFEIYLDKYAKPNSGIGF  512
            T E+   F G+G    L     ++G  G +       A K R    YL+  A   +   F
Sbjct  41   TWEEHIEFIGIGTRETL---ETLRGRYGIDAPVEELLAVKNRH---YLELAATTEA---F  91

Query  511  PGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDI  332
            P    LV +  + G  +AVAS + R  + + L A GL  ++    VSA+     KP PD+
Sbjct  92   PAMRALVERLSAAGHPLAVASGSSRSAIASALKATGLE-ALLPVQVSAEDVGRGKPEPDV  150

Query  331  FLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            FLAA+++L V P+ECVVIEDA  G++AA+ A MRCIAV
Sbjct  151  FLAAARLLAVDPAECVVIEDAGPGVEAARRAGMRCIAV  188



>ref|WP_003175550.1| HAD family hydrolase [Pseudomonas fluorescens]
 gb|EFQ62024.1| HAD-superfamily hydrolase subfamily IA, variant [Pseudomonas 
fluorescens WH6]
Length=228

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = -1

Query  520  IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFE--NLK  347
            +G PGA  LV   K+  + +AV +S+ R       T      S+FD IV+AD  E    K
Sbjct  92   LGMPGAEALVRHLKAHNIPIAVGTSSSRHSFGHKTTLHREWFSLFDTIVTADDPEVGAAK  151

Query  346  PAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLI  167
            PAPDIFL A++ L V P +C+V ED+  G+ AAKAA M  IAV      D+    A  +I
Sbjct  152  PAPDIFLTAARRLGVAPRDCLVFEDSPFGVTAAKAAHMTAIAVPDEAMADSKYQHADQII  211

Query  166  RK  161
            RK
Sbjct  212  RK  213



>ref|WP_033265533.1| hydrolase [Streptomyces lydicus]
Length=235

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 78/143 (55%), Gaps = 8/143 (6%)
 Frame = -1

Query  580  AAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGL  401
            A K R   +YL+  A+ ++ + FP    LV    + G  +AVAS + R  ++A L   GL
Sbjct  80   AGKNR---VYLE-LARAHTEV-FPEMRTLVEHLAAAGHPMAVASGSSRAAIEAVLAGTGL  134

Query  400  SLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
              ++   +VSA+   + KPAPD+FL A++ L   P+ CVV+EDA  G  AA  A MRCIA
Sbjct  135  D-ALLTTVVSAEEVAHGKPAPDVFLEAARRLGADPATCVVLEDAAPGALAAHRAGMRCIA  193

Query  220  V--TTTLAEDTIEAAAPSLIRKG  158
            V      AED   A A  L R G
Sbjct  194  VPYVAGTAEDPAFAHAGLLFRDG  216



>gb|AIA90665.1| CAZy families GH65 protein, partial [uncultured Nostoc sp.]
Length=162

 Score = 70.9 bits (172),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 50/162 (31%), Positives = 78/162 (48%), Gaps = 9/162 (6%)
 Frame = -1

Query  751  WCACNSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLG--FNPEA  578
            W A ++E   R+A + VF    + ++ ED  PF G         + ++KGV    ++   
Sbjct  1    WDAFDTEPLHRQAWLSVFFTENIIISEEDLIPFNGAAPWRVASQITSLKGVTADPYSLAG  60

Query  577  AKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLS  398
             KK+  E +L       + I    A  ++ + K K   +A+ + ++R  VD  L    L+
Sbjct  61   RKKQIIEKWLQ-----TAEIRILPAMRILLEWKDKK-PLALGTGSERSTVDILLNRFDLT  114

Query  397  LSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
               F  IVSAD  +N KPA D FL  +  L+VPP  C+V ED
Sbjct  115  -RYFTTIVSADRIKNHKPAADTFLLCASELHVPPECCLVFED  155



>gb|EST59051.1| 2-deoxyglucose-6-phosphatase [Proteus hauseri ZMd44]
Length=226

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 92/180 (51%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAP-FTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE   ++A  +VFAE+GV +++    P   G+     +          G + + AK++ 
Sbjct  24   DSEPFWQQAEHEVFAELGVDLSLASAMPDMVGLRINEVIDLWYRASPWQGVSKQEAKQKM  83

Query  562  FE--IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
                + L +  KP      PG    +  CKS GLK+A+AS++    ++  L    +    
Sbjct  84   VSRVVKLVEETKP----LLPGVEHALELCKSSGLKIALASASPDFMLERVLELFNIR-HY  138

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            F A+VSAD   + KP P+++L A+K LN+ P  CV +ED+  G+ A K A+MR I V  T
Sbjct  139  FSAVVSADELPHSKPHPEVYLNAAKALNLDPIHCVSLEDSRNGMIACKGARMRSIVVPAT  198



>ref|WP_021418251.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile]
 gb|EQJ15435.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P11]
Length=226

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ ++      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTDIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVRGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_036913260.1| 2-deoxyglucose-6-phosphatase [Proteus hauseri]
Length=222

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 92/180 (51%), Gaps = 8/180 (4%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAP-FTGMGEANFLGGVANVKGVLGFNPEAAKKRF  563
            +SE   ++A  +VFAE+GV +++    P   G+     +          G + + AK++ 
Sbjct  20   DSEPFWQQAEHEVFAELGVDLSLASAMPDMVGLRINEVIDLWYRASPWQGVSKQEAKQKM  79

Query  562  FE--IYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
                + L +  KP      PG    +  CKS GLK+A+AS++    ++  L    +    
Sbjct  80   VSRVVKLVEETKP----LLPGVEHALELCKSSGLKIALASASPDFMLERVLELFNIR-HY  134

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTT  209
            F A+VSAD   + KP P+++L A+K LN+ P  CV +ED+  G+ A K A+MR I V  T
Sbjct  135  FSAVVSADELPHSKPHPEVYLNAAKALNLDPIHCVSLEDSRNGMIACKGARMRSIVVPAT  194



>ref|WP_027630786.1| phosphatase [[Clostridium] cellobioparum]
Length=220

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 65/94 (69%), Gaps = 3/94 (3%)
 Frame = -1

Query  499  ELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM-FDAIVSADAFENLKPAPDIFLA  323
            EL+   K +G+ + +ASS+ R  ++  +   GL +   FD ++S +  EN KPAPDIFL 
Sbjct  93   ELIDDLKGRGIYIGLASSSSREFIE--MVLKGLHIYHNFDVVISGEEVENSKPAPDIFLK  150

Query  322  ASKILNVPPSECVVIEDalagiqaakaAKMRCIA  221
            A+++L V P+EC+V+ED+  G++AAKAA M+CIA
Sbjct  151  AAEVLKVAPAECIVLEDSGNGVKAAKAAGMKCIA  184



>ref|WP_015327467.1| beta-phosphoglucomutase [Halobacteroides halobius]
 gb|AGB41751.1| beta-phosphoglucomutase [Halobacteroides halobius DSM 5150]
Length=219

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 13/147 (9%)
 Frame = -1

Query  694  EMGVQVTVEDFAPFTGMGEAN----FLGGVANVKGVLGFNPEAAKKR-FFEIYLDKYAKP  530
            E G+  T ED     G+  +      LG   +      F     +K  +++ YL +  + 
Sbjct  33   EEGISFTREDNEQLRGVSRSKSLELLLGDYIDNYTKEEFQEMMDRKNGYYQEYLTEMGEE  92

Query  529  NSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM-FDAIVSADAFEN  353
            +     PGA EL+ + K +GLK+A+AS++     +A     GL ++  F+ I    + EN
Sbjct  93   DL---LPGARELLDEIKERGLKMAIASAS----RNAKTVLKGLDITQEFNTISDGYSVEN  145

Query  352  LKPAPDIFLAASKILNVPPSECVVIED  272
             KPAPDIFL  +K L V P ECVV+ED
Sbjct  146  AKPAPDIFLHTAKKLGVKPEECVVLED  172



>ref|WP_043489439.1| hydrolase [Streptomyces bingchenggensis]
Length=242

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = -1

Query  529  NSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENL  350
             S   FP     V +  + G  +AVAS + R  ++A L A GL  S+    VSA+     
Sbjct  93   TSATAFPQMRAFVERLHTAGHPLAVASGSSRAAIEAALEATGLG-SLLAVRVSAEEVGRG  151

Query  349  KPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            KP PD+FL A+++L   P+ECVV+ED+  G++AA  A MRCIAV
Sbjct  152  KPEPDVFLEAARLLGAAPAECVVVEDSAPGVEAAHRAGMRCIAV  195



>ref|WP_031556559.1| hypothetical protein [Lachnospira multipara]
Length=220

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 60/101 (59%), Gaps = 1/101 (1%)
 Frame = -1

Query  508  GAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPDIF  329
            G FEL+   K   LK AVA+S  R     NLT  G +    D I   D  E+ KPAPDIF
Sbjct  90   GLFELLDFIKEARLKCAVATSTRRESAFKNLTNIG-AYDYLDGIAYGDEIEHSKPAPDIF  148

Query  328  LAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            L A+ I+NV P EC+VIED++ GI+A  AA M+ + V  T+
Sbjct  149  LKAAGIVNVKPEECIVIEDSINGIKAGHAANMKVVHVPDTI  189



>gb|ADI05183.1| putative hydrolase [Streptomyces bingchenggensis BCW-1]
Length=246

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = -1

Query  529  NSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENL  350
             S   FP     V +  + G  +AVAS + R  ++A L A GL  S+    VSA+     
Sbjct  97   TSATAFPQMRAFVERLHTAGHPLAVASGSSRAAIEAALEATGLG-SLLAVRVSAEEVGRG  155

Query  349  KPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
            KP PD+FL A+++L   P+ECVV+ED+  G++AA  A MRCIAV
Sbjct  156  KPEPDVFLEAARLLGAAPAECVVVEDSAPGVEAAHRAGMRCIAV  199



>ref|WP_009891161.1| hydrolase [Peptoclostridium difficile]
 ref|YP_003219227.1| hydrolase [Peptoclostridium difficile R20291]
 ref|YP_006199934.1| hydrolase [Peptoclostridium difficile BI1]
 emb|CBA65203.1| putative hydrolase [Peptoclostridium difficile CD196]
 emb|CBE06301.1| putative hydrolase [Peptoclostridium difficile R20291]
 gb|EQE01877.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD3]
 gb|EQE18481.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD18]
 gb|EQE29696.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD34]
 gb|EQE56915.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD44]
 gb|EQE76330.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD51]
 gb|EQE78329.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD68]
 gb|EQF09266.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD133]
 gb|EQF44029.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD170]
 gb|EQF76047.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD211]
 gb|EQF85835.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 655]
 gb|EQF87745.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 824]
 gb|EQG03641.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 6042]
 gb|EQG07776.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 6057]
 gb|EQG27552.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile DA00126]
 gb|EQG42000.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00132]
 gb|EQG55959.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00142]
 gb|EQG74157.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00165]
 gb|EQG89947.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00191]
 gb|EQH01384.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00196]
 gb|EQH02890.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00195]
 gb|EQH07215.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00197]
 gb|EQH19304.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00212]
 gb|EQH21557.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00211]
 gb|EQH46501.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00246]
 gb|EQI04545.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y10]
 gb|EQI16197.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y41]
 gb|EQI20337.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y155]
 gb|EQI26303.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y171]
 gb|EQI33471.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y215]
 gb|EQI50495.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y270]
 gb|EQI56451.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y312]
 gb|EQI56545.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y307]
 gb|EQI78295.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y384]
 gb|EQJ19043.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P9]
 gb|EQJ22139.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P15]
 gb|EQJ39134.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P23]
 gb|EQJ70635.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P36]
 gb|EQJ77473.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P45]
 gb|EQJ87837.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P50]
 gb|EQJ89076.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P49]
 gb|EQK02562.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P59]
 gb|EQK14881.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P70]
 gb|EQK31120.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P75]
 gb|EQK49217.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F480]
 gb|EQK51267.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F525]
 gb|EQK54545.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F200]
 gb|EQK58093.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F548]
 gb|EQK64441.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F601]
 gb|EQK86119.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P31]
 gb|ERM23607.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P41]
 gb|ERM46909.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P53]
 emb|CCL35136.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile T23]
 emb|CCL38994.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E19]
 emb|CCL58437.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile T17]
 gb|EZR30549.1| hydrolase [Peptoclostridium difficile]
 emb|CDS88636.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile]
 emb|CDS89240.1| putative hydrolase [Peptoclostridium difficile]
 emb|CDS95027.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile]
Length=226

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ ++      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTDIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_037838639.1| hydrolase, partial [Streptomyces sp. NRRL S-337]
Length=229

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/199 (37%), Positives = 99/199 (50%), Gaps = 15/199 (8%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            N  E  RR    + A  GV   + E  A F G+G    L  ++   G+     E  A K 
Sbjct  28   NYYEAGRR----LLAGHGVPDFSWEQHARFIGIGTRETLEILSAECGIDAPVDELLAVKN  83

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R   +YL+  A+ ++ + FP    LV +  + G  +AVAS + R  ++A L   GL   +
Sbjct  84   R---LYLE-LARAHTEV-FPEMRRLVRRLSAAGHPMAVASGSSRAAIEAVLAGTGLD-GL  137

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV--T  215
               +VSA+     KP PD+FL A++ L V P+ECVV+EDA  G  AA  A MRCIAV   
Sbjct  138  LATVVSAEEVARGKPEPDVFLEAARRLGVAPAECVVLEDAAPGALAAARAGMRCIAVPYV  197

Query  214  TTLAEDTIEAAAPSLIRKG  158
               AED   A A  L R G
Sbjct  198  RGTAEDPGFAGAGLLFRGG  216



>ref|WP_042226659.1| phosphatase [Paenibacillus chitinolyticus]
Length=235

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 83/163 (51%), Gaps = 2/163 (1%)
 Frame = -1

Query  700  FAEMGVQVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPEAAKKRFFEIYLDKYAKPNSG  521
            F   GV V+ ED   F G+   +    + + K  + F  E       +  ++  +     
Sbjct  40   FNHFGVPVSEEDHHSFVGVTLESMWEQILD-KHRIPFALEQVLTYHKDNVMNILSGHTEL  98

Query  520  IGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPA  341
               P     ++  K K + +AVASS+ R  ++  +   GL  S FD  VS +  ++ KPA
Sbjct  99   TAMPQVERWLSWLKEKQIPIAVASSSPRPLIELIMDKTGLG-SYFDVWVSGEEVKHGKPA  157

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTT  212
            PDIFL A+ +L V PS C+VIED+  G++AAK+A MRC+ +  
Sbjct  158  PDIFLHAAGLLGVEPSSCLVIEDSRNGVKAAKSAGMRCVGIQN  200



>ref|WP_010982974.1| hydrolase [Streptomyces avermitilis]
 dbj|BAC69246.1| putative hydrolase [Streptomyces avermitilis MA-4680 = NBRC 14893]
Length=231

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 71/121 (59%), Gaps = 3/121 (2%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            +P   + V     +G+ +AVAS +    ++A LT  GL+ S    +VSAD     KPAPD
Sbjct  92   YPEMRKFVELLAGEGVPMAVASGSSPEAIEAILTGTGLA-SWLTTVVSADEVARGKPAPD  150

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV--TTTLAEDTIEAAAPSLIRK  161
            +FL A++ L V P++CVV+EDA  G  AA AA+MRCIA+      A+D   A A  L+R 
Sbjct  151  VFLEAARRLGVSPADCVVLEDAAPGAAAAHAARMRCIAIPYVAAQADDPAFATAGLLVRG  210

Query  160  G  158
            G
Sbjct  211  G  211



>gb|EQH98119.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F314]
 gb|EQI64485.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y343]
Length=216

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 57/178 (32%), Positives = 86/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ ++      ++    E  K
Sbjct  7    DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTDIYDSSVPIIDLYDEKTK  66

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P   I   G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  67   NMIE--FMERKGAP---IKL-GVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  119

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  120  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPQNCIVIEDSPMGVEAAYNGGIRCINV  177



>ref|WP_014678796.1| beta-phosphoglucomutase [Solitalea canadensis]
 gb|AFD05568.1| beta-phosphoglucomutase [Solitalea canadensis DSM 3403]
Length=220

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 89/186 (48%), Gaps = 23/186 (12%)
 Frame = -1

Query  694  EMGVQVTVEDFAPFTGMGEANFLGGVANVKGVL----GFNPEAAKKRFFEIYLDKYAKPN  527
            E+G  +T  D     G+     L  + ++ GV          A KK  +  YL+   K +
Sbjct  32   ELGFDITEADNEQLRGVSRMECLRIILSIGGVSVSADQLYDLAEKKNNW--YLEYVQKMD  89

Query  526  SGIGFPGAFELVTQCKSKGLKVAVASSAD-------RIKVDANLTAAGLSLSMFDAIVSA  368
                 PGA E +   +  GLKVA+AS++        R+K+D          +++DA+V  
Sbjct  90   EHEILPGAAEFIQAARESGLKVAIASASKNAGIILRRVKLD----------TVYDALVDG  139

Query  367  DAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIE  188
            +     KP PDIFL +++ LNV P  C+V EDA++GIQAA  A MR I + + +      
Sbjct  140  NTVNRSKPNPDIFLRSARELNVDPENCIVFEDAISGIQAAHNAGMRSIGIGSDIMLKNAH  199

Query  187  AAAPSL  170
               PSL
Sbjct  200  MVVPSL  205



>ref|WP_011060169.1| HAD family hydrolase [Pseudomonas protegens]
 gb|AAY91137.1| HAD hydrolase, family IA, variant 3 [Pseudomonas protegens Pf-5]
 gb|AGL83662.1| hypothetical protein PFLCHA0_c18800 [Pseudomonas protegens CHA0]
 dbj|BAO61240.1| HAD family hydrolase [Pseudomonas protegens Cab57]
Length=231

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 68/119 (57%), Gaps = 2/119 (2%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFE--NLKPA  341
             PGA ELV   K   + +AV +S+ ++      T  G   ++FD IV+AD  E    KPA
Sbjct  95   MPGAQELVRHLKEHRIPIAVGTSSSQMSFGEKTTRHGDWFALFDTIVTADDPEVTAAKPA  154

Query  340  PDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTLAEDTIEAAAPSLIR  164
            PDIFL A++ L V P+EC+V ED+  G+ AA+AA M  IAV      D+  A A  +IR
Sbjct  155  PDIFLTAARRLGVAPAECLVFEDSPFGVTAARAAGMSVIAVPDPAMADSKFAHAHGIIR  213



>ref|WP_009898027.1| hydrolase [Peptoclostridium difficile]
 ref|YP_001089370.1| HAD superfamily hydrolase [Peptoclostridium difficile 630]
 emb|CAJ69745.1| putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile 630]
 gb|EQE08808.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD13]
 gb|EQE15440.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD17]
 gb|EQE21496.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD21]
 gb|EQE32766.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD38]
 gb|EQE44261.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD39]
 gb|EQE52544.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD43]
 gb|EQE60228.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD45]
 gb|EQE68154.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD47]
 gb|EQE73875.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD49]
 gb|EQE90359.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD70]
 gb|EQE95231.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD109]
 gb|EQF01958.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD131]
 gb|EQF03761.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD129]
 gb|EQF13586.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD144]
 gb|EQF17946.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD149]
 gb|EQF35433.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD166]
 gb|EQF49808.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD178]
 gb|EQF51933.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD181]
 gb|EQF59503.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD200]
 gb|EQF60951.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD196]
 gb|EQF79782.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 342]
 gb|EQF94398.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 842]
 gb|EQG01316.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile 6041]
 gb|EQG17702.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile DA00062]
 gb|EQG22450.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile DA00114]
 gb|EQG33295.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile DA00128]
 gb|EQG39514.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00131]
 gb|EQG44538.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00134]
 gb|EQG50722.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00141]
 gb|EQG59311.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00149]
 gb|EQG77214.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00167]
 gb|EQG82444.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00174]
 gb|EQG92487.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00189]
 gb|EQH17343.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00210]
 gb|EQH28178.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00215]
 gb|EQH34050.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00232]
 gb|EQH34233.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00238]
 gb|EQH36197.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00216]
 gb|EQH39516.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00244]
 gb|EQH49681.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00245]
 gb|EQH59423.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00273]
 gb|EQH64180.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00256]
 gb|EQH68253.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00305]
 gb|EQH69925.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00306]
 gb|EQH74978.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00307]
 gb|EQH81571.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00313]
 gb|EQH87209.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F152]
 gb|EQI10104.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y21]
 gb|EQI21352.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y165]
 gb|EQI29499.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y184]
 gb|EQI37606.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y202]
 gb|EQI45435.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y247]
 gb|EQI54714.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y266]
 gb|EQI72016.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
Y381]
 gb|EQI78565.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P1]
 gb|EQI90340.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P3]
 gb|EQI99195.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P6]
 gb|EQJ08643.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P8]
 gb|EQJ33590.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P21]
 gb|EQJ45344.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P25]
 gb|EQJ45500.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P24]
 gb|EQJ54946.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P29]
 gb|EQJ57746.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P32]
 gb|EQJ66332.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P38]
 gb|EQJ77967.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P46]
 gb|EQJ95421.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P51]
 gb|EQK00127.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P61]
 gb|EQK04408.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P78]
 gb|EQK10921.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P69]
 gb|EQK16813.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P72]
 gb|EQK37606.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P77]
 gb|EQK68269.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD90]
 gb|EQK70784.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD92]
 gb|EQK72936.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD111]
 gb|EQK74344.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD113]
 gb|EQK81366.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD127]
 gb|EQL07166.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
CD86]
 gb|ERM24552.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P33]
 gb|ERM27453.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
DA00130]
 gb|ERM34949.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P64]
 gb|ERM41806.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
P68]
 gb|ERM45206.1| HAD hydrolase, IA, variant 1 family protein [Clostridium difficile 
F665]
 emb|CCL12520.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile E16]
 emb|CCL43198.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E24]
 emb|CCL47211.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T42]
 emb|CCL50341.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T6]
 emb|CCL54292.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E14]
 emb|CCL61966.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E9]
 emb|CCL69901.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T3]
 emb|CCL73586.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E28]
 emb|CCL77282.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E23]
 emb|CCL84621.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T19]
 emb|CCL88796.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T10]
 emb|CCL96737.1| Putative hydrolase, HAD superfamily, IA subfamily [Peptoclostridium 
difficile T61]
 emb|CEJ99487.1| putative hydrolase, HAD superfamily, IAsubfamily [Peptoclostridium 
difficile]
 gb|AJP12606.1| hydrolase [Peptoclostridium difficile 630]
Length=226

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ ++      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTDIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPKNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_024735416.1| hydrolase [Clostridiales bacterium VE202-15]
Length=215

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 56/107 (52%), Gaps = 5/107 (5%)
 Frame = -1

Query  592  FNPEAAKKRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLT  413
            F     +KR+ + YL+++  P      PG   L+   +  G K A+A+S       A L 
Sbjct  66   FKHRGERKRYMDAYLEEHGLPVK----PGLGRLLGYLRENGYKTALATSTHAETAGAYLK  121

Query  412  AAGLSLSMFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIED  272
             AG+    FD  V  D  E  KP PDI+L A+K+L +PP EC+V+ED
Sbjct  122  MAGVE-EYFDCKVFGDMVELGKPNPDIYLRAAKLLGIPPEECLVLED  167



>ref|WP_003439593.1| hydrolase [Peptoclostridium difficile]
 gb|EHJ36489.1| HAD hydrolase, family IA, variant 3 [Peptoclostridium difficile 
70-100-2010]
 gb|EQE42004.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD41]
 gb|EQE90131.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD104]
 gb|EQF66070.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD206]
 gb|EQF67336.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD201]
 gb|EQF74067.1| HAD hydrolase, IA, variant 1 family protein [Peptoclostridium 
difficile CD212]
 emb|CCL81096.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile E12]
 emb|CCL92466.1| Putative hydrolase, HAD superfamily, IA subfamily [Clostridium 
difficile T14]
Length=226

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/178 (31%), Positives = 85/178 (48%), Gaps = 11/178 (6%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGVQVTVEDFAPFTGMGEANFLGGVANVKG----VLGFNPEAAK  572
            +SE  S    ++ F + G  +T E +    G      + G+ ++      ++    E  K
Sbjct  17   DSERISLEFWMETFEKYGYTMTKEIYTSVMGRNRKGIIEGLTDIYDSSVPIIDLYDEKTK  76

Query  571  KRFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLS  392
                  ++++   P       G  EL++  K  G K+AVA+S  R +    L  A L   
Sbjct  77   NMIE--FMERKGAPIK----LGVNELISFLKENGYKMAVATSTKRERAVKRLAKANLK-D  129

Query  391  MFDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
             FDAIV  D   N KP P+IFL A+K +NV P  C+VIED+  G++AA    +RCI V
Sbjct  130  YFDAIVCGDDVVNSKPNPEIFLKAAKKINVNPKNCIVIEDSPMGVEAAYNGGIRCINV  187



>ref|WP_043271552.1| hydrolase [Streptomyces sp. CT34]
Length=222

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 90/177 (51%), Gaps = 13/177 (7%)
 Frame = -1

Query  739  NSEEPSRRAAVDVFAEMGV-QVTVEDFAPFTGMGEANFLGGVANVKGVLGFNPE--AAKK  569
            N  E  RR    + A  GV   T E  A F G+G    L  +A   G+     E  A K 
Sbjct  14   NYFEAGRR----LLAGYGVTDFTWERHARFIGIGTRETLEILAREYGIDAPVEELLAVKN  69

Query  568  RFFEIYLDKYAKPNSGIGFPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSM  389
            R   +YL+  A+ ++ + FP   ELV    + G  +AVAS + R  ++A L   GL  ++
Sbjct  70   R---VYLE-LARAHTEV-FPEMRELVALLAAGGHPMAVASGSSRAAIEAVLAGTGLD-AL  123

Query  388  FDAIVSADAFENLKPAPDIFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAV  218
               +VSA+     KP PD+FL A++ + V P  CVV+EDA  G  AA  A MRCIAV
Sbjct  124  LTTLVSAEEVPRGKPEPDVFLEAARRMGVAPGACVVLEDAAPGALAAHRAGMRCIAV  180



>ref|WP_030731854.1| hydrolase [Streptomyces sp. NRRL F-2890]
Length=240

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 61/103 (59%), Gaps = 1/103 (1%)
 Frame = -1

Query  514  FPGAFELVTQCKSKGLKVAVASSADRIKVDANLTAAGLSLSMFDAIVSADAFENLKPAPD  335
            FPG   LV    +  L +AVAS + R  +DA LT + +  ++    VSA+     KP PD
Sbjct  93   FPGMARLVELAHTARLPMAVASGSTREAIDAALTGSAVG-ALLPVRVSAEEVPRGKPEPD  151

Query  334  IFLAASKILNVPPSECVVIEDalagiqaakaAKMRCIAVTTTL  206
            +F AA++ L VPP  CVV+EDA  G+ AA  A MRC+AV + L
Sbjct  152  VFEAAARRLGVPPERCVVVEDAAPGVTAALRAGMRCVAVPSVL  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310