BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032P15

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778431.1|  PREDICTED: U-box domain-containing protein 17      303   1e-94   Nicotiana sylvestris
gb|AAP03882.1|  Avr9/Cf-9 rapidly elicited protein 276                  301   1e-93   Nicotiana tabacum [American tobacco]
ref|XP_009620922.1|  PREDICTED: U-box domain-containing protein 17      300   2e-93   Nicotiana tomentosiformis
ref|XP_008225235.1|  PREDICTED: U-box domain-containing protein 17      289   4e-89   Prunus mume [ume]
ref|XP_004293976.1|  PREDICTED: U-box domain-containing protein 17      287   3e-88   Fragaria vesca subsp. vesca
ref|XP_007025299.1|  Plant U-box 17                                     285   1e-87   
ref|XP_004485933.1|  PREDICTED: U-box domain-containing protein 1...    283   5e-87   Cicer arietinum [garbanzo]
ref|XP_008443533.1|  PREDICTED: U-box domain-containing protein 17      283   8e-87   Cucumis melo [Oriental melon]
ref|XP_010106623.1|  U-box domain-containing protein 17                 282   1e-86   Morus notabilis
ref|XP_004233034.1|  PREDICTED: U-box domain-containing protein 17      281   3e-86   Solanum lycopersicum
ref|XP_004161195.1|  PREDICTED: U-box domain-containing protein 1...    281   5e-86   
ref|XP_004147388.1|  PREDICTED: U-box domain-containing protein 1...    281   5e-86   Cucumis sativus [cucumbers]
ref|XP_006449554.1|  hypothetical protein CICLE_v10014430mg             281   6e-86   Citrus clementina [clementine]
ref|XP_003546044.1|  PREDICTED: U-box domain-containing protein 1...    280   6e-86   Glycine max [soybeans]
gb|KHN28641.1|  U-box domain-containing protein 17                      280   8e-86   Glycine soja [wild soybean]
ref|XP_006467604.1|  PREDICTED: U-box domain-containing protein 1...    279   2e-85   Citrus sinensis [apfelsine]
ref|XP_007147997.1|  hypothetical protein PHAVU_006G171900g             279   3e-85   Phaseolus vulgaris [French bean]
gb|KHN47392.1|  U-box domain-containing protein 17                      279   3e-85   Glycine soja [wild soybean]
ref|XP_002317390.2|  armadillo/beta-catenin repeat family protein       278   4e-85   Populus trichocarpa [western balsam poplar]
ref|XP_011039380.1|  PREDICTED: U-box domain-containing protein 17      278   4e-85   Populus euphratica
ref|XP_010655547.1|  PREDICTED: U-box domain-containing protein 17      278   4e-85   
gb|KDP21142.1|  hypothetical protein JCGZ_21613                         278   6e-85   Jatropha curcas
gb|AES64073.2|  plant U-box protein                                     276   3e-84   Medicago truncatula
ref|XP_003542975.1|  PREDICTED: U-box domain-containing protein 1...    276   4e-84   Glycine max [soybeans]
ref|XP_009351680.1|  PREDICTED: U-box domain-containing protein 1...    275   7e-84   Pyrus x bretschneideri [bai li]
ref|XP_002522266.1|  ubiquitin-protein ligase, putative                 274   2e-83   Ricinus communis
ref|XP_003524977.1|  PREDICTED: U-box domain-containing protein 1...    274   2e-83   Glycine max [soybeans]
ref|NP_001275105.1|  ACRE 276-like protein                              274   2e-83   Solanum tuberosum [potatoes]
ref|XP_003593822.1|  U-box domain-containing protein                    274   3e-83   
ref|XP_010052161.1|  PREDICTED: U-box domain-containing protein 17      272   1e-82   Eucalyptus grandis [rose gum]
emb|CDO96867.1|  unnamed protein product                                270   6e-82   Coffea canephora [robusta coffee]
ref|XP_009352721.1|  PREDICTED: U-box domain-containing protein 1...    270   9e-82   Pyrus x bretschneideri [bai li]
ref|XP_008383598.1|  PREDICTED: U-box domain-containing protein 1...    270   1e-81   
emb|CBI30726.3|  unnamed protein product                                266   8e-81   Vitis vinifera
ref|XP_007213625.1|  hypothetical protein PRUPE_ppa002108mg             264   1e-79   Prunus persica
ref|XP_008371510.1|  PREDICTED: U-box domain-containing protein 1...    263   2e-79   
ref|XP_011101441.1|  PREDICTED: U-box domain-containing protein 1...    262   2e-79   Sesamum indicum [beniseed]
gb|KJB66865.1|  hypothetical protein B456_010G161700                    263   4e-79   Gossypium raimondii
ref|XP_011101440.1|  PREDICTED: U-box domain-containing protein 1...    262   5e-79   Sesamum indicum [beniseed]
ref|XP_003531268.1|  PREDICTED: U-box domain-containing protein 1...    261   2e-78   Glycine max [soybeans]
ref|XP_010665507.1|  PREDICTED: U-box domain-containing protein 17      260   3e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010242129.1|  PREDICTED: U-box domain-containing protein 17      254   6e-76   Nelumbo nucifera [Indian lotus]
ref|XP_011085318.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    250   2e-74   Sesamum indicum [beniseed]
ref|XP_002305723.2|  armadillo/beta-catenin repeat family protein       249   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_011010906.1|  PREDICTED: U-box domain-containing protein 1...    248   8e-74   Populus euphratica
ref|XP_007159489.1|  hypothetical protein PHAVU_002G241800g             246   9e-73   Phaseolus vulgaris [French bean]
gb|EYU43305.1|  hypothetical protein MIMGU_mgv1a002121mg                245   1e-72   Erythranthe guttata [common monkey flower]
gb|KJB69676.1|  hypothetical protein B456_011G036500                    238   1e-69   Gossypium raimondii
ref|XP_010248377.1|  PREDICTED: U-box domain-containing protein 1...    236   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010549429.1|  PREDICTED: U-box domain-containing protein 17      235   7e-69   Tarenaya hassleriana [spider flower]
gb|ACJ85851.1|  unknown                                                 233   4e-68   Medicago truncatula
gb|KJB34910.1|  hypothetical protein B456_006G089900                    231   2e-67   Gossypium raimondii
gb|EYU28122.1|  hypothetical protein MIMGU_mgv1a027038mg                226   2e-65   Erythranthe guttata [common monkey flower]
ref|XP_009115249.1|  PREDICTED: U-box domain-containing protein 1...    226   3e-65   Brassica rapa
ref|XP_010460713.1|  PREDICTED: U-box domain-containing protein 17      225   4e-65   Camelina sativa [gold-of-pleasure]
emb|CDX94661.1|  BnaC07g09970D                                          225   4e-65   
gb|KFK44763.1|  hypothetical protein AALP_AA1G299800                    225   4e-65   Arabis alpina [alpine rockcress]
ref|XP_010478295.1|  PREDICTED: U-box domain-containing protein 1...    225   4e-65   Camelina sativa [gold-of-pleasure]
emb|CDX99816.1|  BnaC05g22380D                                          224   9e-65   
ref|XP_010499451.1|  PREDICTED: U-box domain-containing protein 17      224   9e-65   Camelina sativa [gold-of-pleasure]
emb|CDY48332.1|  BnaA09g26890D                                          224   1e-64   Brassica napus [oilseed rape]
ref|XP_006306891.1|  hypothetical protein CARUB_v10008444mg             223   4e-64   Capsella rubella
emb|CDX90186.1|  BnaA08g17980D                                          222   5e-64   
ref|XP_002890808.1|  plant U-box17                                      221   1e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_009109670.1|  PREDICTED: U-box domain-containing protein 17      220   4e-63   Brassica rapa
ref|NP_174228.1|  U-box domain-containing protein 17                    219   5e-63   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ34586.1|  unnamed protein product                                219   1e-62   Eutrema halophilum
emb|CDY43332.1|  BnaC03g59040D                                          218   2e-62   Brassica napus [oilseed rape]
ref|XP_010657066.1|  PREDICTED: U-box domain-containing protein 1...    215   2e-62   
gb|AAL36401.1|  putative arm repeat-containing protein                  217   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540527.1|  PREDICTED: U-box domain-containing protein 1...    206   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010468768.1|  PREDICTED: U-box domain-containing protein 1...    182   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010915473.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    180   6e-49   Elaeis guineensis
ref|XP_006415583.1|  hypothetical protein EUTSA_v10006853mg             177   1e-47   
ref|XP_008794161.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    163   1e-42   
ref|XP_008790028.1|  PREDICTED: U-box domain-containing protein 1...    162   2e-42   Phoenix dactylifera
ref|XP_009419314.1|  PREDICTED: U-box domain-containing protein 1...    160   7e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIB04257.1|  arm repeat-containing protein 1                         158   6e-41   Arabidopsis lyrata subsp. petraea
ref|XP_009381196.1|  PREDICTED: U-box domain-containing protein 1...    156   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408898.1|  PREDICTED: U-box domain-containing protein 1...    156   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002879489.1|  hypothetical protein ARALYDRAFT_902509             156   3e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_010925596.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...    155   5e-40   
ref|XP_009388697.1|  PREDICTED: U-box domain-containing protein 1...    155   8e-40   
gb|KEH35988.1|  Avr9/Cf-9 rapidly elicited protein, putative            141   9e-39   Medicago truncatula
gb|EMS59130.1|  U-box domain-containing protein 4                       148   7e-38   Triticum urartu
ref|XP_004951360.1|  PREDICTED: U-box domain-containing protein 4...    149   1e-37   Setaria italica
ref|XP_003636485.1|  Alkaline alpha galactosidase I                     141   2e-37   
gb|EMT02293.1|  U-box domain-containing protein 17                      146   9e-37   
gb|AFW71185.1|  hypothetical protein ZEAMMB73_432257                    145   1e-36   
dbj|BAJ96178.1|  predicted protein                                      146   2e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002451836.1|  hypothetical protein SORBIDRAFT_04g008430          144   8e-36   Sorghum bicolor [broomcorn]
ref|XP_008679814.1|  PREDICTED: U-box domain-containing protein 4       142   3e-35   Zea mays [maize]
dbj|BAG88374.1|  unnamed protein product                                140   5e-35   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046379.1|  Os02g0234300                                       140   7e-35   
gb|EEC72792.1|  hypothetical protein OsI_06476                          140   2e-34   Oryza sativa Indica Group [Indian rice]
sp|Q6EUK7.1|PUB04_ORYSJ  RecName: Full=U-box domain-containing pr...    140   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571878.1|  PREDICTED: U-box domain-containing protein 4       140   2e-34   Brachypodium distachyon [annual false brome]
emb|CDY43686.1|  BnaA04g20050D                                          138   7e-34   Brassica napus [oilseed rape]
gb|AAB97738.1|  arm repeat containing protein                           138   8e-34   Brassica napus [oilseed rape]
ref|XP_009141366.1|  PREDICTED: U-box domain-containing protein 1...    138   8e-34   Brassica rapa
emb|CAD20348.1|  ARC1 protein                                           132   1e-33   Brassica oleracea
gb|KJB66866.1|  hypothetical protein B456_010G161700                    136   2e-33   Gossypium raimondii
emb|CDY37666.1|  BnaA04g20020D                                          132   1e-31   Brassica napus [oilseed rape]
gb|ABY58019.1|  arm repeat containing protein 1                         132   1e-31   Brassica oleracea var. viridis [collards]
gb|KFK36322.1|  hypothetical protein AALP_AA4G107600                    132   1e-31   Arabis alpina [alpine rockcress]
ref|XP_006296011.1|  hypothetical protein CARUB_v10025155mg             131   2e-31   Capsella rubella
gb|KJB66867.1|  hypothetical protein B456_010G161700                    131   4e-31   Gossypium raimondii
gb|AGP76183.1|  ARC1                                                    130   5e-31   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_010509777.1|  PREDICTED: U-box domain-containing protein 1...    129   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010413765.1|  PREDICTED: U-box domain-containing protein 1...    128   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010473845.1|  PREDICTED: U-box domain-containing protein 1...    122   1e-28   
dbj|BAJ96993.1|  predicted protein                                      119   5e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AES79080.2|  raffinose synthase or seed inhibition protein Sip1    96.7    4e-20   Medicago truncatula
ref|XP_003622862.1|  Q protein                                        97.1    5e-20   
ref|NP_001168190.1|  uncharacterized protein LOC100381946             90.9    7e-19   
ref|XP_008811691.1|  PREDICTED: U-box domain-containing protein 1...  89.7    8e-17   Phoenix dactylifera
ref|XP_010907873.1|  PREDICTED: U-box domain-containing protein 1...  87.0    5e-16   Elaeis guineensis
ref|XP_001760681.1|  predicted protein                                87.0    5e-16   
ref|XP_009345217.1|  PREDICTED: U-box domain-containing protein 1...  85.5    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_001753758.1|  predicted protein                                84.7    3e-15   
ref|XP_008374218.1|  PREDICTED: U-box domain-containing protein 1...  84.0    6e-15   
gb|EPS67526.1|  hypothetical protein M569_07248                       82.8    1e-14   Genlisea aurea
ref|XP_007008909.1|  Plant U-box 13                                   82.0    2e-14   
ref|XP_008233788.1|  PREDICTED: U-box domain-containing protein 1...  81.6    3e-14   Prunus mume [ume]
ref|XP_010262331.1|  PREDICTED: U-box domain-containing protein 3...  81.6    3e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002272996.1|  PREDICTED: U-box domain-containing protein 13    81.3    4e-14   Vitis vinifera
ref|XP_008369280.1|  PREDICTED: U-box domain-containing protein 1...  80.9    5e-14   Malus domestica [apple tree]
ref|XP_007220150.1|  hypothetical protein PRUPE_ppa019674mg           80.9    5e-14   Prunus persica
ref|XP_011084885.1|  PREDICTED: U-box domain-containing protein 1...  80.9    5e-14   Sesamum indicum [beniseed]
ref|XP_010262328.1|  PREDICTED: U-box domain-containing protein 3...  80.9    6e-14   Nelumbo nucifera [Indian lotus]
ref|XP_004308949.1|  PREDICTED: U-box domain-containing protein 1...  80.1    1e-13   Fragaria vesca subsp. vesca
ref|XP_002316197.1|  hypothetical protein POPTR_0010s19330g           79.7    1e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006486527.1|  PREDICTED: U-box domain-containing protein 1...  79.7    2e-13   
ref|XP_006435778.1|  hypothetical protein CICLE_v10033932mg           79.7    2e-13   Citrus clementina [clementine]
ref|XP_011035905.1|  PREDICTED: U-box domain-containing protein 1...  79.7    2e-13   Populus euphratica
gb|KDO68908.1|  hypothetical protein CISIN_1g046850mg                 79.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_010105430.1|  U-box domain-containing protein 13               79.3    2e-13   Morus notabilis
emb|CBI25448.3|  unnamed protein product                              78.2    3e-13   Vitis vinifera
ref|XP_006393931.1|  hypothetical protein EUTSA_v10003745mg           78.6    3e-13   
ref|XP_001755474.1|  predicted protein                                78.6    4e-13   
dbj|BAB09019.1|  unnamed protein product                              78.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01345.1|  hypothetical proteins                                74.7    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|NP_201535.3|  ARM repeat superfamily protein                      78.2    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444662.1|  PREDICTED: U-box domain-containing protein 2...  77.8    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002866707.1|  armadillo/beta-catenin repeat family protein     77.8    6e-13   Arabidopsis lyrata subsp. lyrata
tpg|DAA33939.1|  TPA: E3 ubiquitin ligase                             77.8    6e-13   Medicago truncatula
ref|XP_010444664.1|  PREDICTED: U-box domain-containing protein 2...  77.8    6e-13   Camelina sativa [gold-of-pleasure]
ref|XP_008802944.1|  PREDICTED: U-box domain-containing protein 4...  77.8    6e-13   Phoenix dactylifera
ref|XP_010464193.1|  PREDICTED: U-box domain-containing protein 2...  77.8    7e-13   Camelina sativa [gold-of-pleasure]
ref|XP_010464200.1|  PREDICTED: U-box domain-containing protein 2...  77.8    7e-13   Camelina sativa [gold-of-pleasure]
gb|KJB48642.1|  hypothetical protein B456_008G079700                  77.4    9e-13   Gossypium raimondii
ref|XP_009369205.1|  PREDICTED: U-box domain-containing protein 1...  77.0    1e-12   Pyrus x bretschneideri [bai li]
gb|KHG28018.1|  U-box domain-containing 3 -like protein               77.0    1e-12   Gossypium arboreum [tree cotton]
emb|CDX81323.1|  BnaC09g07340D                                        77.0    1e-12   
ref|XP_009112371.1|  PREDICTED: U-box domain-containing protein 2...  77.0    1e-12   Brassica rapa
ref|XP_009112370.1|  PREDICTED: U-box domain-containing protein 2...  77.0    1e-12   Brassica rapa
ref|XP_007047436.1|  RING/U-box superfamily protein with ARM repe...  77.0    1e-12   Theobroma cacao [chocolate]
gb|KHG16511.1|  U-box domain-containing 3 -like protein               77.0    1e-12   Gossypium arboreum [tree cotton]
gb|KJB42276.1|  hypothetical protein B456_007G146800                  77.0    1e-12   Gossypium raimondii
emb|CDY18649.1|  BnaA09g07460D                                        76.6    1e-12   Brassica napus [oilseed rape]
gb|KJB48641.1|  hypothetical protein B456_008G079700                  76.6    1e-12   Gossypium raimondii
ref|XP_001761829.1|  predicted protein                                76.6    2e-12   
gb|AGG82490.1|  E3 ubiquitin ligase                                   76.3    2e-12   Datisca glomerata
ref|XP_006857297.1|  hypothetical protein AMTR_s00067p00049340        76.3    2e-12   
ref|XP_006280091.1|  hypothetical protein CARUB_v10025974mg           75.9    2e-12   Capsella rubella
ref|XP_008807731.1|  PREDICTED: U-box domain-containing protein 3     76.3    2e-12   Phoenix dactylifera
ref|XP_002970194.1|  hypothetical protein SELMODRAFT_61948            74.7    2e-12   
ref|XP_002978359.1|  hypothetical protein SELMODRAFT_51906            74.3    3e-12   
ref|XP_003616674.1|  U-box domain-containing protein                  75.5    3e-12   
gb|KJB11337.1|  hypothetical protein B456_001G254100                  75.5    4e-12   Gossypium raimondii
gb|KHG28942.1|  U-box domain-containing 4 -like protein               75.1    4e-12   Gossypium arboreum [tree cotton]
ref|XP_010087281.1|  U-box domain-containing protein 4                75.1    6e-12   
ref|XP_010905800.1|  PREDICTED: U-box domain-containing protein 3...  74.7    6e-12   Elaeis guineensis
gb|EPS70781.1|  hypothetical protein M569_03979                       74.3    8e-12   Genlisea aurea
ref|XP_007141746.1|  hypothetical protein PHAVU_008G222100g           74.3    8e-12   Phaseolus vulgaris [French bean]
ref|XP_007050278.1|  ARM repeat superfamily protein isoform 1         74.3    8e-12   
ref|XP_002977628.1|  ubiquitin-protein ligase, PUB17                  74.3    9e-12   Selaginella moellendorffii
ref|XP_006845980.1|  hypothetical protein AMTR_s00155p00026110        74.3    9e-12   Amborella trichopoda
ref|XP_010933040.1|  PREDICTED: U-box domain-containing protein 4...  74.3    9e-12   Elaeis guineensis
gb|KJB09961.1|  hypothetical protein B456_001G178000                  74.3    9e-12   Gossypium raimondii
ref|XP_006841267.1|  hypothetical protein AMTR_s00135p00108920        73.9    9e-12   
ref|XP_002975220.1|  ubiquitin-protein ligase, PUB17                  73.9    1e-11   Selaginella moellendorffii
ref|XP_011458009.1|  PREDICTED: U-box domain-containing protein 3     73.9    1e-11   Fragaria vesca subsp. vesca
ref|XP_010484515.1|  PREDICTED: U-box domain-containing protein 2...  73.9    1e-11   Camelina sativa [gold-of-pleasure]
gb|AAB87116.1|  hypothetical protein                                  73.9    1e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009401620.1|  PREDICTED: U-box domain-containing protein 3     73.9    1e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB11341.1|  hypothetical protein B456_001G254100                  73.9    1e-11   Gossypium raimondii
gb|KDO79024.1|  hypothetical protein CISIN_1g003348mg                 73.9    1e-11   Citrus sinensis [apfelsine]
ref|XP_006466521.1|  PREDICTED: U-box domain-containing protein 4...  73.9    1e-11   
ref|XP_007050279.1|  ARM repeat superfamily protein isoform 2         73.6    1e-11   
ref|XP_006443826.1|  hypothetical protein CICLE_v10018951mg           73.6    1e-11   
ref|XP_006426022.1|  hypothetical protein CICLE_v10024899mg           73.6    1e-11   
ref|XP_006466517.1|  PREDICTED: U-box domain-containing protein 4...  73.6    1e-11   Citrus sinensis [apfelsine]
gb|KJB09958.1|  hypothetical protein B456_001G178000                  73.6    2e-11   Gossypium raimondii
gb|KJB09962.1|  hypothetical protein B456_001G178000                  73.6    2e-11   Gossypium raimondii
gb|KJB09959.1|  hypothetical protein B456_001G178000                  73.6    2e-11   Gossypium raimondii
gb|KDO60475.1|  hypothetical protein CISIN_1g004078mg                 73.2    2e-11   Citrus sinensis [apfelsine]
gb|KDO60476.1|  hypothetical protein CISIN_1g004078mg                 73.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_011008564.1|  PREDICTED: U-box domain-containing protein 4...  73.2    2e-11   Populus euphratica
ref|XP_011013975.1|  PREDICTED: U-box domain-containing protein 4...  73.2    2e-11   Populus euphratica
ref|XP_007142063.1|  hypothetical protein PHAVU_008G249400g           73.2    2e-11   Phaseolus vulgaris [French bean]
ref|XP_010319902.1|  PREDICTED: U-box domain-containing protein 4...  73.2    2e-11   
ref|XP_011080053.1|  PREDICTED: U-box domain-containing protein 3...  72.8    2e-11   Sesamum indicum [beniseed]
ref|XP_002528322.1|  ubiquitin-protein ligase, putative               72.8    2e-11   Ricinus communis
ref|XP_007201804.1|  hypothetical protein PRUPE_ppa001702mg           72.8    2e-11   Prunus persica
ref|XP_011080054.1|  PREDICTED: U-box domain-containing protein 3...  72.8    3e-11   Sesamum indicum [beniseed]
ref|XP_006351668.1|  PREDICTED: U-box domain-containing protein 3...  72.8    3e-11   Solanum tuberosum [potatoes]
emb|CDP02559.1|  unnamed protein product                              72.8    3e-11   Coffea canephora [robusta coffee]
ref|XP_010429257.1|  PREDICTED: U-box domain-containing protein 4...  72.8    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010326171.1|  PREDICTED: U-box domain-containing protein 3     72.8    3e-11   Solanum lycopersicum
ref|XP_009614286.1|  PREDICTED: U-box domain-containing protein 3...  72.8    3e-11   Nicotiana tomentosiformis
ref|XP_009614285.1|  PREDICTED: U-box domain-containing protein 3...  72.8    3e-11   Nicotiana tomentosiformis
ref|XP_010531283.1|  PREDICTED: U-box domain-containing protein 4     72.8    3e-11   Tarenaya hassleriana [spider flower]
ref|XP_010246789.1|  PREDICTED: U-box domain-containing protein 3...  72.4    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_010472313.1|  PREDICTED: U-box domain-containing protein 4     72.4    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010935918.1|  PREDICTED: U-box domain-containing protein 3...  72.4    3e-11   Elaeis guineensis
ref|XP_006361218.1|  PREDICTED: U-box domain-containing protein 4...  72.4    3e-11   Solanum tuberosum [potatoes]
gb|KDO79032.1|  hypothetical protein CISIN_1g003348mg                 72.4    3e-11   Citrus sinensis [apfelsine]
gb|KJB11338.1|  hypothetical protein B456_001G254100                  72.0    4e-11   Gossypium raimondii
gb|EYU20039.1|  hypothetical protein MIMGU_mgv1a025209mg              72.4    4e-11   Erythranthe guttata [common monkey flower]
gb|KHN02500.1|  U-box domain-containing protein 3                     72.4    4e-11   Glycine soja [wild soybean]
ref|XP_006604491.1|  PREDICTED: U-box domain-containing protein 3...  72.4    4e-11   Glycine max [soybeans]
ref|XP_006604492.1|  PREDICTED: U-box domain-containing protein 3...  72.4    4e-11   Glycine max [soybeans]
ref|XP_006604490.1|  PREDICTED: U-box domain-containing protein 3...  72.4    4e-11   Glycine max [soybeans]
gb|KJB74380.1|  hypothetical protein B456_011G291400                  72.0    4e-11   Gossypium raimondii
gb|KDO79033.1|  hypothetical protein CISIN_1g003348mg                 72.0    4e-11   Citrus sinensis [apfelsine]
ref|XP_004138560.1|  PREDICTED: U-box domain-containing protein 1...  72.0    4e-11   
gb|KGN45800.1|  hypothetical protein Csa_6G012250                     72.0    4e-11   Cucumis sativus [cucumbers]
gb|ADQ12763.1|  ARM protein                                           68.6    4e-11   Picea jezoensis [Yeddo spruce]
ref|XP_009367853.1|  PREDICTED: U-box domain-containing protein 4...  72.0    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_006404783.1|  hypothetical protein EUTSA_v10000047mg           72.0    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009780997.1|  PREDICTED: U-box domain-containing protein 3     72.0    4e-11   Nicotiana sylvestris
gb|KDP44728.1|  hypothetical protein JCGZ_01228                       71.2    4e-11   Jatropha curcas
emb|CDY46092.1|  BnaA09g42160D                                        72.4    4e-11   Brassica napus [oilseed rape]
ref|XP_008235668.1|  PREDICTED: U-box domain-containing protein 3...  72.0    4e-11   Prunus mume [ume]
ref|XP_008235667.1|  PREDICTED: U-box domain-containing protein 3...  72.0    4e-11   Prunus mume [ume]
ref|XP_006576944.1|  PREDICTED: U-box domain-containing protein 3...  72.0    5e-11   
gb|KHN10747.1|  U-box domain-containing protein 3                     72.0    5e-11   Glycine soja [wild soybean]
ref|XP_006576943.1|  PREDICTED: U-box domain-containing protein 3...  72.0    5e-11   
emb|CDX76873.1|  BnaC08g34590D                                        72.0    5e-11   
ref|XP_004491021.1|  PREDICTED: U-box domain-containing protein 1...  72.0    5e-11   Cicer arietinum [garbanzo]
ref|XP_006576942.1|  PREDICTED: U-box domain-containing protein 3...  72.0    5e-11   Glycine max [soybeans]
ref|XP_006576941.1|  PREDICTED: U-box domain-containing protein 3...  72.0    5e-11   Glycine max [soybeans]
ref|XP_006576940.1|  PREDICTED: U-box domain-containing protein 3...  72.0    5e-11   
ref|XP_002868987.1|  hypothetical protein ARALYDRAFT_912596           70.1    5e-11   
ref|XP_010111712.1|  U-box domain-containing protein 15               72.0    5e-11   Morus notabilis
ref|XP_009367873.1|  PREDICTED: U-box domain-containing protein 4...  72.0    5e-11   Pyrus x bretschneideri [bai li]
gb|KJB43859.1|  hypothetical protein B456_007G219900                  72.0    5e-11   Gossypium raimondii
ref|XP_002524955.1|  ubiquitin-protein ligase, putative               72.0    5e-11   
ref|XP_010942970.1|  PREDICTED: U-box domain-containing protein 4...  72.0    5e-11   
ref|XP_011001054.1|  PREDICTED: U-box domain-containing protein 1...  71.6    5e-11   Populus euphratica
ref|XP_006380666.1|  hypothetical protein POPTR_0007s10280g           71.6    6e-11   
gb|KJB43858.1|  hypothetical protein B456_007G219900                  71.6    6e-11   Gossypium raimondii
gb|ADQ12754.1|  ARM protein                                           68.2    6e-11   Picea abies
ref|XP_001781593.1|  predicted protein                                71.2    6e-11   
ref|XP_006353434.1|  PREDICTED: U-box domain-containing protein 1...  71.6    6e-11   Solanum tuberosum [potatoes]
ref|XP_010942968.1|  PREDICTED: U-box domain-containing protein 4...  71.6    6e-11   
ref|XP_009117298.1|  PREDICTED: U-box domain-containing protein 4     71.6    6e-11   Brassica rapa
gb|KJB48645.1|  hypothetical protein B456_008G079700                  71.6    6e-11   Gossypium raimondii
ref|NP_179895.6|  protein PLANT U-BOX 4                               71.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189583.1|  protein PLANT U-BOX 4                            71.6    6e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010942967.1|  PREDICTED: U-box domain-containing protein 4...  71.6    6e-11   Elaeis guineensis
ref|XP_002880484.1|  armadillo/beta-catenin repeat family protein     71.6    7e-11   
ref|XP_006380663.1|  hypothetical protein POPTR_0007s10280g           71.6    7e-11   
ref|XP_004149702.1|  PREDICTED: U-box domain-containing protein 4...  71.6    7e-11   Cucumis sativus [cucumbers]
ref|XP_011463613.1|  PREDICTED: U-box domain-containing protein 4...  71.6    7e-11   Fragaria vesca subsp. vesca
ref|XP_003551670.2|  PREDICTED: U-box domain-containing protein 1...  71.2    7e-11   Glycine max [soybeans]
ref|XP_006380667.1|  hypothetical protein POPTR_0007s10280g           71.6    7e-11   
ref|XP_008457779.1|  PREDICTED: U-box domain-containing protein 4...  71.2    8e-11   Cucumis melo [Oriental melon]
ref|XP_004287978.1|  PREDICTED: U-box domain-containing protein 4...  71.2    8e-11   Fragaria vesca subsp. vesca
ref|XP_008238495.1|  PREDICTED: U-box domain-containing protein 4     71.2    8e-11   Prunus mume [ume]
gb|KDP32027.1|  hypothetical protein JCGZ_12488                       71.2    9e-11   Jatropha curcas
ref|XP_001778307.1|  predicted protein                                70.5    9e-11   
ref|XP_008441478.1|  PREDICTED: U-box domain-containing protein 1...  70.9    1e-10   Cucumis melo [Oriental melon]
ref|XP_008346169.1|  PREDICTED: U-box domain-containing protein 3...  70.9    1e-10   
ref|XP_009610326.1|  PREDICTED: U-box domain-containing protein 4...  70.9    1e-10   Nicotiana tomentosiformis
ref|XP_007144888.1|  hypothetical protein PHAVU_007G192300g           70.9    1e-10   Phaseolus vulgaris [French bean]
gb|KHN03887.1|  U-box domain-containing protein 3                     70.9    1e-10   Glycine soja [wild soybean]
ref|XP_010101417.1|  U-box domain-containing protein 3                70.9    1e-10   
ref|XP_002302042.1|  armadillo/beta-catenin repeat family protein     70.9    1e-10   
ref|XP_009367841.1|  PREDICTED: U-box domain-containing protein 4...  69.3    1e-10   
ref|XP_007144889.1|  hypothetical protein PHAVU_007G192300g           70.9    1e-10   
ref|XP_009789059.1|  PREDICTED: U-box domain-containing protein 4...  70.9    1e-10   
gb|KHG15816.1|  U-box domain-containing 3 -like protein               70.5    1e-10   
ref|XP_002311243.2|  hypothetical protein POPTR_0008s07160g           70.5    1e-10   
ref|XP_009797979.1|  PREDICTED: U-box domain-containing protein 4...  70.5    1e-10   
ref|XP_009789067.1|  PREDICTED: U-box domain-containing protein 4...  70.5    1e-10   
ref|XP_009592895.1|  PREDICTED: U-box domain-containing protein 4...  70.5    1e-10   
ref|XP_009592894.1|  PREDICTED: U-box domain-containing protein 4...  70.5    2e-10   
ref|XP_006293682.1|  hypothetical protein CARUB_v10022640mg           70.5    2e-10   
ref|XP_008451242.1|  PREDICTED: U-box domain-containing protein 3     70.5    2e-10   
ref|XP_009587727.1|  PREDICTED: U-box domain-containing protein 1...  70.1    2e-10   
ref|XP_006575440.1|  PREDICTED: U-box domain-containing protein 4...  70.1    2e-10   
ref|XP_006575441.1|  PREDICTED: U-box domain-containing protein 4...  70.1    2e-10   
ref|XP_011028816.1|  PREDICTED: U-box domain-containing protein 3...  70.1    2e-10   
ref|XP_007208336.1|  hypothetical protein PRUPE_ppa002184mg           69.7    2e-10   
gb|KHN40971.1|  U-box domain-containing protein 4                     69.7    2e-10   
ref|XP_009336148.1|  PREDICTED: U-box domain-containing protein 3...  69.7    2e-10   
ref|XP_009799470.1|  PREDICTED: U-box domain-containing protein 1...  69.7    2e-10   
gb|KEH42515.1|  armadillo/beta-catenin repeat protein                 69.7    2e-10   
gb|KHN29326.1|  U-box domain-containing protein 15                    69.3    3e-10   
ref|XP_009336069.1|  PREDICTED: U-box domain-containing protein 4...  69.7    3e-10   
ref|XP_011004045.1|  PREDICTED: U-box domain-containing protein 3...  69.7    3e-10   
ref|XP_003533598.1|  PREDICTED: U-box domain-containing protein 1...  69.3    3e-10   
ref|XP_002306856.1|  armadillo/beta-catenin repeat family protein     69.7    3e-10   
gb|EYU46447.1|  hypothetical protein MIMGU_mgv1a002302mg              69.7    3e-10   
ref|XP_008382858.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  69.7    3e-10   
gb|KEH42516.1|  armadillo/beta-catenin repeat protein                 69.3    3e-10   
ref|XP_002532036.1|  ubiquitin-protein ligase, putative               69.3    3e-10   
ref|XP_011013573.1|  PREDICTED: U-box domain-containing protein 3...  69.3    3e-10   
ref|XP_011028811.1|  PREDICTED: U-box domain-containing protein 3...  69.3    4e-10   
ref|XP_010243920.1|  PREDICTED: U-box domain-containing protein 4     68.9    4e-10   
ref|XP_004241114.1|  PREDICTED: U-box domain-containing protein 1...  68.9    4e-10   
ref|XP_008808377.1|  PREDICTED: U-box domain-containing protein 4...  68.9    5e-10   
ref|XP_002984060.1|  hypothetical protein SELMODRAFT_41798            68.6    5e-10   
ref|XP_008808379.1|  PREDICTED: U-box domain-containing protein 4...  68.9    5e-10   
ref|XP_004148950.1|  PREDICTED: U-box domain-containing protein 3...  68.9    5e-10   
ref|XP_002980963.1|  hypothetical protein SELMODRAFT_420513           66.6    5e-10   
ref|XP_011013568.1|  PREDICTED: U-box domain-containing protein 3...  68.6    6e-10   
gb|KHN08833.1|  U-box domain-containing protein 4                     66.6    6e-10   
ref|XP_002306495.2|  hypothetical protein POPTR_0005s18820g           68.6    6e-10   
ref|XP_008678334.1|  PREDICTED: U-box domain-containing protein 4...  68.6    6e-10   
ref|XP_002976653.1|  hypothetical protein SELMODRAFT_105398           68.2    6e-10   
ref|XP_002973199.1|  hypothetical protein SELMODRAFT_99101            68.2    7e-10   
gb|KFK32931.1|  hypothetical protein AALP_AA6G307900                  68.2    7e-10   
ref|XP_011025265.1|  PREDICTED: U-box domain-containing protein 4...  68.6    7e-10   
ref|XP_006282265.1|  hypothetical protein CARUB_v10028542mg           68.2    7e-10   
ref|XP_010670739.1|  PREDICTED: U-box domain-containing protein 4     68.2    7e-10   
ref|XP_004495091.1|  PREDICTED: U-box domain-containing protein 3...  68.2    7e-10   
ref|XP_004495092.1|  PREDICTED: U-box domain-containing protein 3...  68.2    7e-10   
ref|XP_006843717.1|  hypothetical protein AMTR_s00007p00217990        68.2    8e-10   
ref|XP_011083032.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  68.2    8e-10   
ref|XP_008678335.1|  PREDICTED: U-box domain-containing protein 4...  68.2    8e-10   
ref|NP_001060820.1|  Os08g0110500                                     68.2    8e-10   
gb|KEH42514.1|  armadillo/beta-catenin repeat protein                 67.8    9e-10   
ref|XP_006596458.1|  PREDICTED: U-box domain-containing protein 4...  67.0    9e-10   
ref|XP_002960080.1|  hypothetical protein SELMODRAFT_75609            67.8    9e-10   
ref|XP_009402804.1|  PREDICTED: U-box domain-containing protein 4...  68.2    9e-10   
ref|XP_009357795.1|  PREDICTED: U-box domain-containing protein 1...  67.8    9e-10   
ref|XP_008339570.1|  PREDICTED: U-box domain-containing protein 1...  67.8    9e-10   
ref|XP_002863798.1|  binding protein                                  67.8    1e-09   
gb|EEC82795.1|  hypothetical protein OsI_27558                        67.8    1e-09   
ref|XP_004972465.1|  PREDICTED: U-box domain-containing protein 4...  67.8    1e-09   
ref|XP_009785565.1|  PREDICTED: U-box domain-containing protein 1...  67.8    1e-09   
ref|XP_010679334.1|  PREDICTED: U-box domain-containing protein 3...  67.8    1e-09   
ref|XP_010679335.1|  PREDICTED: U-box domain-containing protein 3...  67.8    1e-09   
gb|AFW61428.1|  putative ARM repeat-containing protein containing...  67.4    1e-09   
ref|XP_002965709.1|  ubiquitin-protein ligase, PUB12                  67.4    1e-09   
ref|XP_002971622.1|  ubiquitin-protein ligase, PUB12                  67.4    1e-09   
ref|XP_002989344.1|  hypothetical protein SELMODRAFT_235743           67.0    1e-09   
gb|KDP26522.1|  hypothetical protein JCGZ_17680                       67.4    1e-09   
gb|EYU23288.1|  hypothetical protein MIMGU_mgv1a001434mg              67.4    1e-09   
ref|XP_011082322.1|  PREDICTED: U-box domain-containing protein 4...  67.4    1e-09   
ref|XP_006341792.1|  PREDICTED: U-box domain-containing protein 4...  67.4    1e-09   
ref|XP_006659047.1|  PREDICTED: U-box domain-containing protein 4...  67.4    1e-09   
emb|CDP03751.1|  unnamed protein product                              67.4    1e-09   
ref|XP_002444901.1|  hypothetical protein SORBIDRAFT_07g001110        67.4    2e-09   
ref|XP_008648363.1|  PREDICTED: U-box domain-containing protein 4     67.4    2e-09   
ref|XP_006473917.1|  PREDICTED: U-box domain-containing protein 1...  67.0    2e-09   
ref|XP_009369475.1|  PREDICTED: U-box domain-containing protein 3...  67.0    2e-09   
ref|XP_006435360.1|  hypothetical protein CICLE_v10003715mg           67.0    2e-09   
ref|XP_006403398.1|  hypothetical protein EUTSA_v10003163mg           67.0    2e-09   
ref|XP_010314681.1|  PREDICTED: U-box domain-containing protein 4...  67.0    2e-09   
ref|XP_007139800.1|  hypothetical protein PHAVU_008G059800g           67.0    2e-09   
ref|XP_006495051.1|  PREDICTED: U-box domain-containing protein 1...  67.0    2e-09   
ref|XP_010234999.1|  PREDICTED: U-box domain-containing protein 4...  67.0    2e-09   
ref|XP_003562601.2|  PREDICTED: U-box domain-containing protein 4...  67.0    2e-09   
gb|EMS61710.1|  U-box domain-containing protein 4                     67.0    2e-09   
gb|EMT16948.1|  U-box domain-containing protein 4                     67.0    2e-09   
dbj|BAJ92958.1|  predicted protein                                    67.0    2e-09   
ref|XP_009369474.1|  PREDICTED: U-box domain-containing protein 3...  67.0    2e-09   
gb|KCW84733.1|  hypothetical protein EUGRSUZ_B01548                   67.0    2e-09   
gb|KCW84732.1|  hypothetical protein EUGRSUZ_B01548                   66.6    2e-09   
gb|KCW84731.1|  hypothetical protein EUGRSUZ_B01548                   66.6    2e-09   
ref|XP_009394995.1|  PREDICTED: U-box domain-containing protein 4...  66.6    3e-09   
emb|CDJ26521.1|  unnamed protein product                              66.6    3e-09   
ref|XP_009394994.1|  PREDICTED: U-box domain-containing protein 4...  66.6    3e-09   
gb|KDO64708.1|  hypothetical protein CISIN_1g006669mg                 66.2    3e-09   
emb|CDP13988.1|  unnamed protein product                              66.2    3e-09   
gb|KHG28766.1|  U-box domain-containing 15 -like protein              66.2    3e-09   
ref|XP_010039247.1|  PREDICTED: U-box domain-containing protein 3...  66.6    3e-09   
gb|KEH23933.1|  armadillo/beta-catenin repeat protein                 66.2    3e-09   
ref|XP_009630244.1|  PREDICTED: U-box domain-containing protein 1...  66.2    3e-09   
gb|KJB32737.1|  hypothetical protein B456_005G258700                  66.2    3e-09   
ref|XP_009139209.1|  PREDICTED: U-box domain-containing protein 3...  66.2    3e-09   
gb|EEE55766.1|  hypothetical protein OsJ_04318                        66.2    3e-09   
ref|XP_010039237.1|  PREDICTED: U-box domain-containing protein 3...  66.2    3e-09   
ref|NP_001045017.2|  Os01g0884400                                     66.2    3e-09   
gb|KDO64707.1|  hypothetical protein CISIN_1g006669mg                 66.2    3e-09   
ref|XP_010039241.1|  PREDICTED: U-box domain-containing protein 3...  66.2    3e-09   
emb|CDY64696.1|  BnaA04g27690D                                        66.2    3e-09   
ref|XP_003573506.2|  PREDICTED: U-box domain-containing protein 4...  66.2    4e-09   
gb|EPS73954.1|  hypothetical protein M569_00792                       65.9    4e-09   
gb|AJN91234.1|  U-box/armadillo repeat containing E3 ligase           65.9    4e-09   
ref|XP_002510676.1|  Spotted leaf protein, putative                   65.9    5e-09   
dbj|BAB10475.1|  arm repeat containing protein                        65.9    5e-09   
ref|XP_001772291.1|  predicted protein                                65.5    5e-09   
emb|CDX73449.1|  BnaC08g25540D                                        65.5    5e-09   
ref|NP_199049.2|  U-box domain-containing protein 15                  65.5    5e-09   
ref|XP_010693078.1|  PREDICTED: U-box domain-containing protein 1...  65.5    5e-09   
dbj|BAD43348.1|  arm repeat containing protein                        65.5    5e-09   
ref|XP_003518436.1|  PREDICTED: U-box domain-containing protein 1...  65.5    5e-09   
ref|XP_010652375.1|  PREDICTED: U-box domain-containing protein 3     65.5    5e-09   
gb|EEC71911.1|  hypothetical protein OsI_04691                        65.9    5e-09   
ref|XP_010922712.1|  PREDICTED: U-box domain-containing protein 1...  65.5    5e-09   
emb|CDY02891.1|  BnaC04g25950D                                        65.5    5e-09   
ref|XP_010105768.1|  U-box domain-containing protein 11               65.5    6e-09   
ref|XP_010552723.1|  PREDICTED: U-box domain-containing protein 11    65.5    6e-09   
emb|CDX78262.1|  BnaA09g34570D                                        65.5    6e-09   
ref|XP_009116155.1|  PREDICTED: U-box domain-containing protein 3     65.5    6e-09   
ref|XP_006448286.1|  hypothetical protein CICLE_v10014584mg           65.1    6e-09   
ref|XP_004493781.1|  PREDICTED: U-box domain-containing protein 3...  65.1    7e-09   
ref|XP_009797524.1|  PREDICTED: U-box domain-containing protein 1...  65.1    7e-09   
ref|XP_010935272.1|  PREDICTED: U-box domain-containing protein 15    65.1    7e-09   
ref|XP_010516017.1|  PREDICTED: U-box domain-containing protein 3...  65.1    7e-09   
ref|XP_006828720.1|  hypothetical protein AMTR_s00001p00030110        65.1    7e-09   
ref|XP_006403535.1|  hypothetical protein EUTSA_v10010139mg           65.1    7e-09   
emb|CBI33734.3|  unnamed protein product                              65.1    7e-09   
ref|XP_007045104.1|  U-box domain-containing protein 10               65.1    8e-09   
ref|XP_010556057.1|  PREDICTED: U-box domain-containing protein 15    65.1    8e-09   
ref|XP_009395374.1|  PREDICTED: U-box domain-containing protein 1...  65.1    8e-09   
ref|XP_006403537.1|  hypothetical protein EUTSA_v10010139mg           65.1    8e-09   
ref|XP_006403536.1|  hypothetical protein EUTSA_v10010139mg           65.1    8e-09   
ref|XP_008802759.1|  PREDICTED: protein spotted leaf 11-like          65.1    8e-09   
emb|CBI26916.3|  unnamed protein product                              64.7    9e-09   
ref|XP_006645135.1|  PREDICTED: U-box domain-containing protein 4...  65.1    9e-09   
gb|ADE77566.1|  unknown                                               64.3    9e-09   
ref|XP_010066634.1|  PREDICTED: U-box domain-containing protein 11    64.7    9e-09   
ref|XP_010555859.1|  PREDICTED: U-box domain-containing protein 3     64.7    9e-09   
ref|XP_002280520.1|  PREDICTED: U-box domain-containing protein 11    64.7    1e-08   
ref|XP_007041623.1|  U-box domain-containing protein 15 isoform 1     64.7    1e-08   
ref|XP_001765686.1|  predicted protein                                64.7    1e-08   
ref|XP_010442159.1|  PREDICTED: U-box domain-containing protein 1...  64.7    1e-08   
ref|XP_007041624.1|  Plant U-Box 15 isoform 2                         64.3    1e-08   
ref|XP_009410518.1|  PREDICTED: U-box domain-containing protein 1...  64.7    1e-08   
ref|XP_010259497.1|  PREDICTED: U-box domain-containing protein 1...  64.3    1e-08   
ref|XP_009113439.1|  PREDICTED: U-box domain-containing protein 15    64.3    1e-08   
emb|CDY68037.1|  BnaA09g53450D                                        64.3    1e-08   
ref|XP_008448190.1|  PREDICTED: U-box domain-containing protein 15    64.3    1e-08   
gb|KJB15967.1|  hypothetical protein B456_002G206200                  64.3    1e-08   
gb|KEH30893.1|  armadillo/beta-catenin repeat protein                 64.3    1e-08   
ref|XP_011035017.1|  PREDICTED: U-box domain-containing protein 1...  64.3    1e-08   
ref|XP_008340022.1|  PREDICTED: U-box domain-containing protein 1...  64.3    1e-08   
ref|XP_010031182.1|  PREDICTED: U-box domain-containing protein 1...  64.3    1e-08   
ref|XP_002301921.1|  hypothetical protein POPTR_0002s01090g           64.3    1e-08   
gb|AIU34701.1|  Arm1                                                  63.9    1e-08   
dbj|BAK03073.1|  predicted protein                                    63.9    1e-08   
dbj|BAJ93866.1|  predicted protein                                    63.9    1e-08   
ref|XP_010494171.1|  PREDICTED: U-box domain-containing protein 15    64.3    1e-08   
emb|CAB77599.1|  putative protein                                     64.3    1e-08   
gb|KHG04395.1|  U-box domain-containing 15 -like protein              64.3    1e-08   
gb|KJB15966.1|  hypothetical protein B456_002G206200                  63.9    1e-08   
gb|KEH30892.1|  armadillo/beta-catenin repeat protein                 64.3    1e-08   
ref|XP_010920613.1|  PREDICTED: protein spotted leaf 11-like          64.3    1e-08   
gb|KJB15965.1|  hypothetical protein B456_002G206200                  64.3    1e-08   
ref|XP_008221130.1|  PREDICTED: U-box domain-containing protein 15    64.3    1e-08   
ref|XP_010266170.1|  PREDICTED: U-box domain-containing protein 15    64.3    1e-08   
ref|XP_002526006.1|  E3 ubiquitin ligase PUB14, putative              63.9    2e-08   
emb|CBI37755.3|  unnamed protein product                              64.3    2e-08   
gb|KCW84729.1|  hypothetical protein EUGRSUZ_B01548                   63.9    2e-08   
ref|XP_010504303.1|  PREDICTED: U-box domain-containing protein 3...  64.3    2e-08   
gb|KCW84730.1|  hypothetical protein EUGRSUZ_B01548                   63.9    2e-08   
ref|XP_010427195.1|  PREDICTED: U-box domain-containing protein 3     64.3    2e-08   
ref|XP_003607915.1|  U-box domain-containing protein                  63.9    2e-08   
emb|CDX95193.1|  BnaC09g16770D                                        63.9    2e-08   
ref|NP_191039.2|  U-box domain-containing protein 3                   63.9    2e-08   
dbj|BAC43212.1|  unknown protein                                      63.9    2e-08   
ref|XP_011000894.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
ref|XP_004292907.1|  PREDICTED: U-box domain-containing protein 15    63.9    2e-08   
ref|XP_011038670.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
ref|XP_002283956.2|  PREDICTED: U-box domain-containing protein 4     63.9    2e-08   
tpg|DAA44667.1|  TPA: putative ARM repeat-containing protein cont...  63.9    2e-08   
ref|XP_009407188.1|  PREDICTED: U-box domain-containing protein 3...  63.9    2e-08   
gb|KHG13616.1|  U-box domain-containing 2 -like protein               63.9    2e-08   
gb|EAZ20925.1|  hypothetical protein OsJ_36575                        63.9    2e-08   
ref|XP_009396584.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
ref|XP_002313587.2|  hypothetical protein POPTR_0009s16740g           63.9    2e-08   
ref|XP_010503261.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
ref|XP_011040788.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
gb|KHN43042.1|  U-box domain-containing protein 10                    63.9    2e-08   
ref|XP_002878000.1|  armadillo/beta-catenin repeat family protein     63.9    2e-08   
ref|XP_003555889.1|  PREDICTED: U-box domain-containing protein 1...  63.9    2e-08   
ref|XP_004154583.1|  PREDICTED: LOW QUALITY PROTEIN: U-box domain...  63.9    2e-08   
ref|XP_002279546.1|  PREDICTED: U-box domain-containing protein 15    63.5    2e-08   
ref|XP_007157719.1|  hypothetical protein PHAVU_002G092600g           63.9    2e-08   
ref|XP_008647602.1|  PREDICTED: uncharacterized protein LOC100502...  63.9    2e-08   
ref|XP_003528526.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
ref|XP_011075713.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
ref|XP_004140059.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
ref|XP_011070638.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
emb|CAN59900.1|  hypothetical protein VITISV_002888                   63.5    2e-08   
ref|XP_010274639.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
emb|CDM85478.1|  unnamed protein product                              63.5    2e-08   
ref|NP_001078286.1|  U-box domain-containing protein 3                63.5    2e-08   
ref|XP_003624019.1|  U-box domain-containing protein                  63.5    2e-08   
ref|XP_008454770.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
ref|XP_010271953.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   
gb|KHN32252.1|  U-box domain-containing protein 10                    63.5    2e-08   
ref|XP_002311496.2|  hypothetical protein POPTR_0008s12760g           63.5    2e-08   
ref|XP_009334180.1|  PREDICTED: U-box domain-containing protein 1...  63.5    2e-08   



>ref|XP_009778431.1| PREDICTED: U-box domain-containing protein 17 [Nicotiana sylvestris]
Length=726

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++DG VEALAGLLR+GS RGKKDAVTALFNLSTHTENCARMI+SGA+ ALVGAL
Sbjct  519  YKKQIAKEDGAVEALAGLLREGSPRGKKDAVTALFNLSTHTENCARMIESGAITALVGAL  578

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  579  GSEGVAEEAAGALALIVRQPIGAAAVGNEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  638

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAPALA LLQ+LLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA
Sbjct  639  GGGAAATERVLKAPALASLLQTLLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA  698

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSAT RD+TFA DVSV MSISVPVL
Sbjct  699  FAGNSATVRDSTFAGDVSVSMSISVPVL  726



>gb|AAP03882.1| Avr9/Cf-9 rapidly elicited protein 276 [Nicotiana tabacum]
Length=726

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++DG VEALAGLLR+GS RGKKDAVTALFNLSTHTENCARMI+ GA+ ALVGAL
Sbjct  519  YKKQIAKEDGAVEALAGLLREGSPRGKKDAVTALFNLSTHTENCARMIELGAITALVGAL  578

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  579  GSEGVAEEAAGALALIVRQPIGAAAVGNEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  638

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAPALA LLQ+LLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA
Sbjct  639  GGGAAATERVLKAPALASLLQTLLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA  698

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSAT RD+TFA DVSV MSISVPVL
Sbjct  699  FAGNSATVRDSTFAGDVSVSMSISVPVL  726



>ref|XP_009620922.1| PREDICTED: U-box domain-containing protein 17 [Nicotiana tomentosiformis]
Length=726

 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++DG VEALAGLLR+GS RGKKDAVTALFNLSTHTENCARMI+SGAV ALVGAL
Sbjct  519  YKKQIAKEDGAVEALAGLLREGSPRGKKDAVTALFNLSTHTENCARMIESGAVTALVGAL  578

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  579  GSEGVAEEAAGALALIVRQPIGAAAVGNEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  638

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG  ATERVLKAPALA LLQ+LLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA
Sbjct  639  GGGATATERVLKAPALASLLQTLLFTGTKRARRKAASLARVFQRCEHASMHYGGLGVGYA  698

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD+TFA DVSV MSISVPVL
Sbjct  699  FAGNSAPVRDSTFAGDVSVSMSISVPVL  726



>ref|XP_008225235.1| PREDICTED: U-box domain-containing protein 17 [Prunus mume]
Length=716

 Score =   289 bits (739),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 197/209 (94%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G +EALAGLLR+G+ RGKKDAVTALFNLSTHTENCARM+++GAV ALV AL
Sbjct  508  YKKRIADEEGAIEALAGLLREGTPRGKKDAVTALFNLSTHTENCARMVEAGAVTALVSAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALAL+VRQPIGA AVGKE+ AVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALVVRQPIGAKAVGKEDMAVAGLVGMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+ A+MH+GGLGVGY
Sbjct  628  SGGAAATERVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENAAAMHFGGLGVGY  687

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            AFAGNSA  RD++FASDV+V MSISVPVL
Sbjct  688  AFAGNSAANRDSSFASDVAVPMSISVPVL  716



>ref|XP_004293976.1| PREDICTED: U-box domain-containing protein 17 [Fragaria vesca 
subsp. vesca]
Length=722

 Score =   287 bits (734),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 177/209 (85%), Positives = 193/209 (92%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G +EALAGLL  G+ RGKKDAVTALFNLSTHTENCARMI++GAV ALV AL
Sbjct  514  YKKRIADEEGAIEALAGLLLHGTQRGKKDAVTALFNLSTHTENCARMIEAGAVTALVSAL  573

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G +GVAEEAAGALALIVRQP+GA AV KEE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  574  GIDGVAEEAAGALALIVRQPLGAKAVAKEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  633

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGGLGVGY  143
            SGG AATERV+KAP+LAGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS MH+GGLGVGY
Sbjct  634  SGGAAATERVVKAPSLAGLLQTLLFTGTKRARRKAASLARVFQRCENASTMHFGGLGVGY  693

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            AFAGNSA  RDT+F  DVSVQMSISVPVL
Sbjct  694  AFAGNSAANRDTSFVGDVSVQMSISVPVL  722



>ref|XP_007025299.1| Plant U-box 17 [Theobroma cacao]
 gb|EOY27921.1| Plant U-box 17 [Theobroma cacao]
Length=719

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++ G VEALAGLLR G+ RGKKDAVTALFNLSTHTENCARMI++ AV ALVGAL
Sbjct  512  YKKRIADEGGAVEALAGLLRVGTPRGKKDAVTALFNLSTHTENCARMIEARAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVGKEE AVAGL+ MMRCGTP+GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVAGLVAMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVLKAP+LAGLLQ+LLFTGTKRARRKAASLARVFQRCE+  +H+GGLGVGYA
Sbjct  632  SGGSAATERVLKAPSLAGLLQTLLFTGTKRARRKAASLARVFQRCENPPLHFGGLGVGYA  691

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNS T RD++FA DVSV MSISVPVL
Sbjct  692  FAGNSTTNRDSSFADDVSVPMSISVPVL  719



>ref|XP_004485933.1| PREDICTED: U-box domain-containing protein 17-like [Cicer arietinum]
Length=715

 Score =   283 bits (725),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++ G +EALAGLL+DG+ RGKKDAVTALFNLSTHTENC RMI++GAV ALV AL
Sbjct  508  YKKIIADETGAIEALAGLLQDGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVAAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP GA AV  +E AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPFGAKAVVNQEEAVAGLIGMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPAL GLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  628  SGGSAATERVVKAPALGGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FA NSA TRDT+FA DVSV MSISVPVL
Sbjct  688  FASNSAQTRDTSFAGDVSVPMSISVPVL  715



>ref|XP_008443533.1| PREDICTED: U-box domain-containing protein 17 [Cucumis melo]
Length=715

 Score =   283 bits (723),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIAE+ G VEALAGLLRDG+ RGKKDAVTALFNLSTHT+NC +MI++GAV ALVGAL
Sbjct  508  YKKRIAEEGGAVEALAGLLRDGTPRGKKDAVTALFNLSTHTDNCVQMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP+GA AV KEE AVAGLI MMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPVGAEAVAKEERAVAGLIAMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A TE+V KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEH +MHYGGLGVGYA
Sbjct  628  SGGAATTEQVFKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHVTMHYGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            +A NSA++R+T+FAS+VSV +SISVPV+
Sbjct  688  YASNSASSRETSFASEVSVPISISVPVV  715



>ref|XP_010106623.1| U-box domain-containing protein 17 [Morus notabilis]
 gb|EXC10953.1| U-box domain-containing protein 17 [Morus notabilis]
Length=715

 Score =   282 bits (722),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++ G +EALAGLLR+G+ RGKKDAVTALFNLSTHT+NC RMI++ AV ALV AL
Sbjct  508  YKKRIADEQGAIEALAGLLREGTPRGKKDAVTALFNLSTHTDNCVRMIEARAVTALVSAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTPKGKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPIGAEAVGNEEMAVAGLIGMMRCGTPKGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+V+KAPALAGLLQ+LLFTGTKRARRKAASLAR FQRCE+A MH+GGLGVGYA
Sbjct  628  SGGAATKEKVVKAPALAGLLQTLLFTGTKRARRKAASLAREFQRCENAIMHFGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSATTRD+ FA DVSV MSISVPVL
Sbjct  688  FAGNSATTRDSGFAGDVSVPMSISVPVL  715



>ref|XP_004233034.1| PREDICTED: U-box domain-containing protein 17 [Solanum lycopersicum]
Length=724

 Score =   281 bits (720),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 175/208 (84%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK++IA++DG VEALAGLLR+GS RGKKDAVTALFNLSTHT+NCARMI+SGAV ALVGAL
Sbjct  517  YKRQIAKEDGAVEALAGLLREGSPRGKKDAVTALFNLSTHTDNCARMIESGAVTALVGAL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQ +GA AVG EE AVAGLI MMRCGTP+GKENAVAALLELCR
Sbjct  577  GSEGVAEEAAGALALIVRQQVGATAVGNEEMAVAGLIAMMRCGTPRGKENAVAALLELCR  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAP+LA LLQ+LLFTGTKRARRKAASLARVFQRCEHA++HY G GVGYA
Sbjct  637  GGGAAATERVLKAPSLASLLQTLLFTGTKRARRKAASLARVFQRCEHAAVHYSGFGVGYA  696

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD+TF  DVSV MSISVPVL
Sbjct  697  FAGNSAAARDSTFPGDVSVSMSISVPVL  724



>ref|XP_004161195.1| PREDICTED: U-box domain-containing protein 17-like [Cucumis sativus]
Length=715

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIAE+ G VEALAGLLRDG+ RGKKDAVTALFNLSTHT+NC +MI++GAV ALVGAL
Sbjct  508  YKKRIAEEGGAVEALAGLLRDGTPRGKKDAVTALFNLSTHTDNCVQMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP+GA AV K+E AVAGLI MMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPVGAEAVAKQERAVAGLIAMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A TE+V KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEH +MHYGGLGVGYA
Sbjct  628  SGGAATTEQVFKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHVTMHYGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            +A NSA+ R+T FAS+VSV +SISVPV+
Sbjct  688  YASNSASNRETNFASEVSVPISISVPVV  715



>ref|XP_004147388.1| PREDICTED: U-box domain-containing protein 17-like [Cucumis sativus]
 gb|KGN65604.1| hypothetical protein Csa_1G467720 [Cucumis sativus]
Length=715

 Score =   281 bits (718),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIAE+ G VEALAGLLRDG+ RGKKDAVTALFNLSTHT+NC +MI++GAV ALVGAL
Sbjct  508  YKKRIAEEGGAVEALAGLLRDGTPRGKKDAVTALFNLSTHTDNCVQMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP+GA AV K+E AVAGLI MMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPVGAEAVAKQERAVAGLIAMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A TE+V KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEH +MHYGGLGVGYA
Sbjct  628  SGGAATTEQVFKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHVTMHYGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            +A NSA+ R+T FAS+VSV +SISVPV+
Sbjct  688  YASNSASNRETNFASEVSVPISISVPVV  715



>ref|XP_006449554.1| hypothetical protein CICLE_v10014430mg [Citrus clementina]
 gb|ESR62794.1| hypothetical protein CICLE_v10014430mg [Citrus clementina]
Length=715

 Score =   281 bits (718),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++ G VEALA LLR G+ RGKKDAVTALFNLSTHT+NC RMI++GAV ALVGAL
Sbjct  508  YKKKIADESGAVEALATLLRSGTPRGKKDAVTALFNLSTHTDNCVRMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG+EE AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  568  GHEGVAEEAAGALALIVRQPIGAAAVGEEEMAVTGLVGMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG +ATERVLKAPAL GLLQ+LLFTGTKRARRKAASLARVFQRCE+A++H+GGLGVGYA
Sbjct  628  SGGASATERVLKAPALVGLLQALLFTGTKRARRKAASLARVFQRCENAALHFGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD++F  DVSV MSISVPVL
Sbjct  688  FAGNSAANRDSSFTPDVSVPMSISVPVL  715



>ref|XP_003546044.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=716

 Score =   280 bits (717),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA + G VEALAGLL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  511  YKKIIAGEIGAVEALAGLLQEGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVGAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AV  EE+AVAGLIGMMRCGTP+GKEN VAALLELCR
Sbjct  571  GNEGVAEEAAGALALIVRQPIGAKAVVNEESAVAGLIGMMRCGTPRGKENVVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEHAS+HYGGLG+GYA
Sbjct  631  SGGAAATERVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHASVHYGGLGIGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            FAGNS TTRDT+FA DVSV MSISV
Sbjct  691  FAGNSTTTRDTSFAGDVSVPMSISV  715



>gb|KHN28641.1| U-box domain-containing protein 17 [Glycine soja]
Length=713

 Score =   280 bits (717),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA + G VEALAGLL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  508  YKKIIAGEIGAVEALAGLLQEGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AV  EE+AVAGLIGMMRCGTP+GKEN VAALLELCR
Sbjct  568  GNEGVAEEAAGALALIVRQPIGAKAVVNEESAVAGLIGMMRCGTPRGKENVVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEHAS+HYGGLG+GYA
Sbjct  628  SGGAAATERVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHASVHYGGLGIGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            FAGNS TTRDT+FA DVSV MSISV
Sbjct  688  FAGNSTTTRDTSFAGDVSVPMSISV  712



>ref|XP_006467604.1| PREDICTED: U-box domain-containing protein 17-like [Citrus sinensis]
 gb|KDO77933.1| hypothetical protein CISIN_1g038217mg [Citrus sinensis]
Length=715

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++ G VEALA LLR G+ RGKKDAVTALFNLSTHT+NC RMI++GAV ALVGAL
Sbjct  508  YKKKIADESGAVEALATLLRLGTPRGKKDAVTALFNLSTHTDNCVRMIEAGAVTALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG+EE AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  568  GHEGVAEEAAGALALIVRQPIGAAAVGEEEMAVTGLVGMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG +ATERVLKAPAL GLLQ+LLFTGTKRARRKAASLARVFQRCE+A++H+GGLGVGYA
Sbjct  628  SGGASATERVLKAPALVGLLQALLFTGTKRARRKAASLARVFQRCENAALHFGGLGVGYA  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD++F  DVSV MSISVPVL
Sbjct  688  FAGNSAANRDSSFTPDVSVPMSISVPVL  715



>ref|XP_007147997.1| hypothetical protein PHAVU_006G171900g [Phaseolus vulgaris]
 gb|ESW19991.1| hypothetical protein PHAVU_006G171900g [Phaseolus vulgaris]
Length=716

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++ G VEALAGLL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  511  YKKIIADEIGAVEALAGLLQEGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVGAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AV  EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  571  GNEGVAEEAAGALALIVRQPIGAKAVVNEEAAVAGLIGMMRCGTPRGKENAVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEHAS+ YGGLGVGYA
Sbjct  631  SGGSAATERVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHASLPYGGLGVGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            FA NS TTRDT+FA DVSV MSISV
Sbjct  691  FASNSTTTRDTSFAGDVSVPMSISV  715



>gb|KHN47392.1| U-box domain-containing protein 17 [Glycine soja]
Length=716

 Score =   279 bits (713),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++   VEALAGLL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALV AL
Sbjct  511  YKKIIADEMRAVEALAGLLQEGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVSAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGV+EEAAGALALIVRQPIGA AV  EE+AVAGLIGMMRCGTP+GKENAVAA+LELCR
Sbjct  571  GNEGVSEEAAGALALIVRQPIGAKAVVNEESAVAGLIGMMRCGTPRGKENAVAAMLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCEHA++HYGGLGVGYA
Sbjct  631  SGGAAATERVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCEHATLHYGGLGVGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            FA NS TTRDT+FA DVSV MSISV
Sbjct  691  FASNSNTTRDTSFAGDVSVPMSISV  715



>ref|XP_002317390.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE98002.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=717

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G VEALAGLLR G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  510  YKKRIADEEGAVEALAGLLRAGTPRGKKDAVTALFNLSTHTENCLRMIEAGAVTALVGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  570  GNEGVAEEAAGALALIVRQPIGAKAVGGEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG  ATE+VLKAPAL GLLQSLLFTGTKRARRKAASLARVFQRCE+ S+H+GGLG GYA
Sbjct  630  SGGTVATEKVLKAPALWGLLQSLLFTGTKRARRKAASLARVFQRCENYSLHFGGLGAGYA  689

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD++F ++VSV +SISVPVL
Sbjct  690  FAGNSAPNRDSSFVNEVSVPVSISVPVL  717



>ref|XP_011039380.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
 ref|XP_011039381.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
 ref|XP_011039382.1| PREDICTED: U-box domain-containing protein 17 [Populus euphratica]
Length=717

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 190/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G VEALAGLLR G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  510  YKKRIADEEGAVEALAGLLRAGTPRGKKDAVTALFNLSTHTENCLRMIEAGAVTALVGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  570  GNEGVAEEAAGALALIVRQPIGAKAVGGEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG  ATE+VLKAPAL GLLQSLLFTGTKRARRKAASLARVFQRCE+ S+H+GGLG GYA
Sbjct  630  SGGTVATEKVLKAPALWGLLQSLLFTGTKRARRKAASLARVFQRCENYSLHFGGLGAGYA  689

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RD++F ++VSV +SISVPVL
Sbjct  690  FAGNSAPNRDSSFVNEVSVPVSISVPVL  717



>ref|XP_010655547.1| PREDICTED: U-box domain-containing protein 17 [Vitis vinifera]
Length=714

 Score =   278 bits (712),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++ G VEALAGLLR+G+ RG+KDAVTALFNLSTHT+NCARM+ SGAV ALV AL
Sbjct  507  YKKRIADEGGAVEALAGLLREGTPRGRKDAVTALFNLSTHTDNCARMVASGAVTALVAAL  566

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVR+PIGA AVG+EE AVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  567  GTEGVAEEAAGALALIVRRPIGAEAVGREEMAVAGLLGMMRCGTPRGKENAVAALLELCR  626

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVLKAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+A++H+GGLGVGYA
Sbjct  627  SGGTAATERVLKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENAALHFGGLGVGYA  686

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FA NS+   D +F+S+VS+QM ISVPVL
Sbjct  687  FARNSSANTDASFSSEVSMQMPISVPVL  714



>gb|KDP21142.1| hypothetical protein JCGZ_21613 [Jatropha curcas]
Length=717

 Score =   278 bits (711),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 191/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++ G VEALAGLLR G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALVGAL
Sbjct  510  YKKKIADEVGAVEALAGLLRVGTPRGKKDAVTALFNLSTHTENCTRMIEAGAVTALVGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQ  GA AVGKEE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  570  GNEGVAEEAAGALALIVRQSTGAEAVGKEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVL+APALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+ ++H+GGLG GYA
Sbjct  630  SGGAAATERVLRAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENYALHFGGLGAGYA  689

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            +AGNSAT+RD++F  DVSV MSISVPVL
Sbjct  690  YAGNSATSRDSSFVGDVSVPMSISVPVL  717



>gb|AES64073.2| plant U-box protein [Medicago truncatula]
Length=720

 Score =   276 bits (706),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++ G VEALAGLL+DG+ RGKKDAVTALFNLSTHT+NC RMI++GAV ALV AL
Sbjct  512  YKKIIADETGAVEALAGLLQDGTPRGKKDAVTALFNLSTHTDNCVRMIEAGAVTALVEAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGA+ALIVRQP GA A+  +E AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGAIALIVRQPFGAKALVNQEEAVAGLIGMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPA+AGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  632  SGGSAATERVVKAPAIAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  691

Query  139  FAGNSATTRDTTFAS-DVSVQMSISVPVL  56
            FA NSA TRD++FA+ DVSV MSISVPV+
Sbjct  692  FASNSAQTRDSSFAAGDVSVPMSISVPVI  720



>ref|XP_003542975.1| PREDICTED: U-box domain-containing protein 17-like isoform 1 
[Glycine max]
Length=716

 Score =   276 bits (705),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 187/205 (91%), Gaps = 0/205 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++   VEALAGLL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALV AL
Sbjct  511  YKKIIADEMRAVEALAGLLQEGTPRGKKDAVTALFNLSTHTENCVRMIEAGAVTALVSAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGV+EEAAGALALIVRQPIGA AV  EE+AVAGLIGMMRCGTP+GKENAVAA+LELCR
Sbjct  571  GNEGVSEEAAGALALIVRQPIGAKAVVNEESAVAGLIGMMRCGTPRGKENAVAAMLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPALA LLQ+LLFTGTKRARRKAASLARVFQRCEHA++HYGGLGVGYA
Sbjct  631  SGGAAATERVVKAPALARLLQTLLFTGTKRARRKAASLARVFQRCEHATLHYGGLGVGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            FA NS TTRDT+FA DVSV MSISV
Sbjct  691  FASNSNTTRDTSFAGDVSVPMSISV  715



>ref|XP_009351680.1| PREDICTED: U-box domain-containing protein 17-like [Pyrus x bretschneideri]
Length=717

 Score =   275 bits (703),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++GG+EALAGLLR+G+ RGKKDAVTALFNLSTHTENC RMI++GAV AL+ AL
Sbjct  509  YKKRIADEEGGIEALAGLLREGTPRGKKDAVTALFNLSTHTENCMRMIEAGAVTALLSAL  568

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPI A AV KE+ A+AGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  569  GNEGVAEEAAGALALIVRQPIAAKAVAKEDIALAGLIGMMRCGTPRGKENAVAALLELCR  628

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
             GG AATERV+KAPALAGLLQ LLFTGTKRARRKAASLARVFQRCE+ A+MH+GGLGVGY
Sbjct  629  CGGAAATERVVKAPALAGLLQMLLFTGTKRARRKAASLARVFQRCENAAAMHFGGLGVGY  688

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            A AGNS   RD++F  DVSV MSISVPVL
Sbjct  689  ALAGNSTANRDSSFVGDVSVPMSISVPVL  717



>ref|XP_002522266.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF40124.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=719

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++ G +EALAGLL  G+ RGKKDAVTALFNLSTHTENCARMI +GAV ALVGAL
Sbjct  512  YKKRIADEGGAIEALAGLLGVGTSRGKKDAVTALFNLSTHTENCARMIKAGAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP+GA AVG EE AVAGLIGMMRCG+P+GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGALALIVRQPVGAEAVGSEEMAVAGLIGMMRCGSPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVL+AP LAGL+Q+LLFTGTKRARRKAASLARVFQR E+ ++H+GGLG GYA
Sbjct  632  SGGAAATERVLRAPTLAGLIQTLLFTGTKRARRKAASLARVFQRRENHALHFGGLGAGYA  691

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSATTRDT+F  DVSV MSISVPVL
Sbjct  692  FAGNSATTRDTSFVGDVSVPMSISVPVL  719



>ref|XP_003524977.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=715

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 171/209 (82%), Positives = 191/209 (91%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+  G VEALA LL++G+ RGKKDAVTALFNLSTHTENC RMI++GAV A+V AL
Sbjct  507  YKKRIADNVGAVEALAWLLQEGTQRGKKDAVTALFNLSTHTENCLRMIEAGAVKAMVVAL  566

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQP+GA AV +EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  567  GNEGVAEEAAGALALIVRQPVGAMAVVREEAAVAGLIGMMRCGTPRGKENAVAALLELCR  626

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV++APAL GLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGY+
Sbjct  627  SGGAAATERVVRAPALVGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYS  686

Query  139  FAGNSATTRD-TTFASDVSVQMSISVPVL  56
            FA +SA+TR+ TTF SDVS+ MSISVPVL
Sbjct  687  FASDSASTRNTTTFVSDVSLPMSISVPVL  715



>ref|NP_001275105.1| ACRE 276-like protein [Solanum tuberosum]
 gb|ABK96801.1| ACRE 276-like protein [Solanum tuberosum]
Length=724

 Score =   274 bits (701),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/208 (83%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK++IA++DG VEALAGLLR+GS RGKKDAVTALFNLSTHT+NCARMI+ GAV ALVGAL
Sbjct  517  YKRQIAKEDGAVEALAGLLREGSPRGKKDAVTALFNLSTHTDNCARMIECGAVTALVGAL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQ +GA AVG EETAVAGLI MMRCGTP+GKENAVAALLEL R
Sbjct  577  GSEGVAEEAAGALALIVRQQVGATAVGNEETAVAGLIAMMRCGTPRGKENAVAALLELRR  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAP+LA LLQ+LLFTGTKRARRKAASLARVFQRCEHAS+HY G GVGYA
Sbjct  637  GGGAAATERVLKAPSLASLLQTLLFTGTKRARRKAASLARVFQRCEHASVHYSGFGVGYA  696

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            F+GNSA  RD+TF  DVSV  SISVPVL
Sbjct  697  FSGNSAAARDSTFPGDVSVSRSISVPVL  724



>ref|XP_003593822.1| U-box domain-containing protein [Medicago truncatula]
Length=737

 Score =   274 bits (700),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 189/207 (91%), Gaps = 1/207 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++ G VEALAGLL+DG+ RGKKDAVTALFNLSTHT+NC RMI++GAV ALV AL
Sbjct  512  YKKIIADETGAVEALAGLLQDGTPRGKKDAVTALFNLSTHTDNCVRMIEAGAVTALVEAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGA+ALIVRQP GA A+  +E AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGAIALIVRQPFGAKALVNQEEAVAGLIGMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPA+AGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  632  SGGSAATERVVKAPAIAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  691

Query  139  FAGNSATTRDTTFAS-DVSVQMSISVP  62
            FA NSA TRD++FA+ DVSV MSISVP
Sbjct  692  FASNSAQTRDSSFAAGDVSVPMSISVP  718



>ref|XP_010052161.1| PREDICTED: U-box domain-containing protein 17 [Eucalyptus grandis]
 gb|KCW76066.1| hypothetical protein EUGRSUZ_D00434 [Eucalyptus grandis]
Length=718

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++   VEALAGLLR+G+ RGKKDAVTALFNLSTH ENC +MI++GAVNALVGAL
Sbjct  511  YKKRIADEGNAVEALAGLLREGTPRGKKDAVTALFNLSTHAENCLKMIEAGAVNALVGAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAEEAAGALALIVRQP+GA AVGKE +A++GLIGMMRCGTP+GKENAVAALLELCR
Sbjct  571  GNEVVAEEAAGALALIVRQPMGAEAVGKENSAISGLIGMMRCGTPRGKENAVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            +GG AATERV+KAPAL GLLQSL FTGTKRARRKAASLARVFQRCE+AS+H+GGLGVGYA
Sbjct  631  TGGSAATERVVKAPALDGLLQSLFFTGTKRARRKAASLARVFQRCENASLHFGGLGVGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNS   RD+ F +DVSV++SI V VL
Sbjct  691  FAGNSTANRDSGFGNDVSVRISIPVSVL  718



>emb|CDO96867.1| unnamed protein product [Coffea canephora]
Length=721

 Score =   270 bits (690),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 184/196 (94%), Gaps = 0/196 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA +DG VEALAGLLR+G+ RGKKDAVTALFNLSTHT+NC RMIDSGAV ALVGAL
Sbjct  514  YKKRIALEDGAVEALAGLLREGTPRGKKDAVTALFNLSTHTDNCVRMIDSGAVTALVGAL  573

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            GCEGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTP+ KENAVAALLELCR
Sbjct  574  GCEGVAEEAAGALALIVRQPIGAEAVGNEEKAVAGLIGMMRCGTPRAKENAVAALLELCR  633

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AA E+VLKAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  634  SGGAAAAEKVLKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  693

Query  139  FAGNSATTRDTTFASD  92
            FAGNSAT+R+ +F+S+
Sbjct  694  FAGNSATSREISFSSE  709



>ref|XP_009352721.1| PREDICTED: U-box domain-containing protein 17-like [Pyrus x bretschneideri]
Length=717

 Score =   270 bits (689),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 170/209 (81%), Positives = 190/209 (91%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++GG+EALAGLLR+G+ RGKKDAVTAL+NLSTHTENC RMI++GAV ALV AL
Sbjct  509  YKKRIADEEGGIEALAGLLREGTPRGKKDAVTALYNLSTHTENCTRMIEAGAVTALVSAL  568

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALAL+VRQ +GA AV KEE AVAGLIGMMR GTP+GKENAVAALLELCR
Sbjct  569  GNEGVAEEAAGALALVVRQHVGAKAVAKEEMAVAGLIGMMRGGTPRGKENAVAALLELCR  628

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
            SGG AATE V+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+ A+MH+GGLGVGY
Sbjct  629  SGGAAATEMVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENAAAMHFGGLGVGY  688

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            A AGNSA  RD++F  DVSV +SISVPVL
Sbjct  689  ALAGNSAANRDSSFVGDVSVPLSISVPVL  717



>ref|XP_008383598.1| PREDICTED: U-box domain-containing protein 17-like [Malus domestica]
Length=717

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 189/209 (90%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++GG+EALAGLLR+G+ RGKKDAVTAL+NLSTHTENC RMI++GAV ALV AL
Sbjct  509  YKKRIADEEGGIEALAGLLREGTPRGKKDAVTALYNLSTHTENCTRMIEAGAVTALVSAL  568

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAEEAAGALAL+VRQPIGA AV  E+ AVAGLIGMMR GTP+GKENAVAALLELCR
Sbjct  569  GNEVVAEEAAGALALVVRQPIGAKAVANEDLAVAGLIGMMRGGTPRGKENAVAALLELCR  628

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
            SGG AATE V+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+ A+MH+GGLGVGY
Sbjct  629  SGGTAATEMVVKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENAAAMHFGGLGVGY  688

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            A AGNSA  RD++F  +VSV +SISVPVL
Sbjct  689  ALAGNSAANRDSSFVGEVSVPLSISVPVL  717



>emb|CBI30726.3| unnamed protein product [Vitis vinifera]
Length=649

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -2

Query  667  IAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgceg  488
            IA++ G VEALAGLLR+G+ RG+KDAVTALFNLSTHT+NCARM+ SGAV ALV ALG EG
Sbjct  412  IADEGGAVEALAGLLREGTPRGRKDAVTALFNLSTHTDNCARMVASGAVTALVAALGTEG  471

Query  487  vaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGE  308
            VAEEAAGALALIVR+PIGA AVG+EE AVAGL+GMMRCGTP+GKENAVAALLELCRSGG 
Sbjct  472  VAEEAAGALALIVRRPIGAEAVGREEMAVAGLLGMMRCGTPRGKENAVAALLELCRSGGT  531

Query  307  AATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYAFAGN  128
            AATERVLKAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+A++H+GGLGVGYAFA N
Sbjct  532  AATERVLKAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENAALHFGGLGVGYAFARN  591

Query  127  SATTRDTTFASDVSVQMSISVP  62
            S+   D +F+S+VS+QM ISVP
Sbjct  592  SSANTDASFSSEVSMQMPISVP  613



>ref|XP_007213625.1| hypothetical protein PRUPE_ppa002108mg [Prunus persica]
 gb|EMJ14824.1| hypothetical protein PRUPE_ppa002108mg [Prunus persica]
Length=716

 Score =   264 bits (674),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 176/209 (84%), Positives = 198/209 (95%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G +EALAGLLR+G+ RGKKDAVTALFNLSTHTENC+RMI++GAV ALV AL
Sbjct  508  YKKRIADEEGAIEALAGLLREGTPRGKKDAVTALFNLSTHTENCSRMIEAGAVTALVSAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALAL+VRQPIGA AVGKE+TAVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  568  GNEGVAEEAAGALALVVRQPIGAKAVGKEDTAVAGLVGMMRCGTPRGKENAVAALLELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
            SGG AATERV+KAPALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+ A++H+GGLGVGY
Sbjct  628  SGGAAATERVVKAPALAGLLQALLFTGTKRARRKAASLARVFQRCENAAAIHFGGLGVGY  687

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            AFAGNSA  RD++FASDV+V MSISVPVL
Sbjct  688  AFAGNSAANRDSSFASDVAVPMSISVPVL  716



>ref|XP_008371510.1| PREDICTED: U-box domain-containing protein 17-like [Malus domestica]
Length=719

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 168/209 (80%), Positives = 183/209 (88%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA++ GG+EALA LLR+G+ RGKKDAVTALFNLSTHTENC RMI++GAV ALV AL
Sbjct  511  YKKRIADEXGGIEALAELLREGTPRGKKDAVTALFNLSTHTENCMRMIEAGAVTALVSAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALAL+VRQPIGA  V KE+ AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  571  GNEGVAEEAAGALALVVRQPIGAKEVAKEDIAVAGLIGMMRCGTPRGKENAVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGGLGVGY  143
             GG AATERV+KAPALAGLLQ LLFTGTKRARRKAASLARVFQRCE  A+MH+GG GVGY
Sbjct  631  CGGAAATERVVKAPALAGLLQMLLFTGTKRARRKAASLARVFQRCEXAAAMHFGGPGVGY  690

Query  142  AFAGNSATTRDTTFASDVSVQMSISVPVL  56
            A AGNS   RD++F  DVSV M ISV VL
Sbjct  691  ALAGNSTANRDSSFVGDVSVPMPISVHVL  719



>ref|XP_011101441.1| PREDICTED: U-box domain-containing protein 17 isoform X2 [Sesamum 
indicum]
Length=645

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++ G VEALAGLLR+G+ RGKKDAVTALFNLSTHTENCARMI+SGA+ ALVGAL
Sbjct  438  YKKQIAQEGGAVEALAGLLREGTARGKKDAVTALFNLSTHTENCARMIESGAITALVGAL  497

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            GCEGV+EEAAGALALIVRQP+GA AV KEE AVAGL GMMRCGTP+GKENAVAALLELCR
Sbjct  498  GCEGVSEEAAGALALIVRQPVGAEAVAKEEMAVAGLTGMMRCGTPRGKENAVAALLELCR  557

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAPALA LLQSLLFTGTKRARRKAASLARVFQRCE+AS+H+GGLGVGYA
Sbjct  558  GGGAAATERVLKAPALASLLQSLLFTGTKRARRKAASLARVFQRCENASLHFGGLGVGYA  617

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RDT+FA DV + +SISVPVL
Sbjct  618  FAGNSAEPRDTSFAGDVGMPVSISVPVL  645



>gb|KJB66865.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=720

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 185/209 (89%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+Q G +EALAGLLR G+ RGKKDAVTALFNLSTH++N ARMI+ GAV ALVGAL
Sbjct  512  YKKRIADQGGAIEALAGLLRVGTPRGKKDAVTALFNLSTHSDNYARMIEVGAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVGKEE AVAGLI MMRCGT +GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVAGLITMMRCGTARGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVL APALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+H+GGLGVGYA
Sbjct  632  SGGAAATERVLGAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHFGGLGVGYA  691

Query  139  FAGNS-ATTRDTTFASDVSVQMSISVPVL  56
            FAGNS    RD  F  DVS+ MSISV VL
Sbjct  692  FAGNSTPPNRDPRFTDDVSMPMSISVQVL  720



>ref|XP_011101440.1| PREDICTED: U-box domain-containing protein 17 isoform X1 [Sesamum 
indicum]
Length=719

 Score =   262 bits (670),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 176/208 (85%), Positives = 192/208 (92%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA++ G VEALAGLLR+G+ RGKKDAVTALFNLSTHTENCARMI+SGA+ ALVGAL
Sbjct  512  YKKQIAQEGGAVEALAGLLREGTARGKKDAVTALFNLSTHTENCARMIESGAITALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            GCEGV+EEAAGALALIVRQP+GA AV KEE AVAGL GMMRCGTP+GKENAVAALLELCR
Sbjct  572  GCEGVSEEAAGALALIVRQPVGAEAVAKEEMAVAGLTGMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG AATERVLKAPALA LLQSLLFTGTKRARRKAASLARVFQRCE+AS+H+GGLGVGYA
Sbjct  632  GGGAAATERVLKAPALASLLQSLLFTGTKRARRKAASLARVFQRCENASLHFGGLGVGYA  691

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAGNSA  RDT+FA DV + +SISVPVL
Sbjct  692  FAGNSAEPRDTSFAGDVGMPVSISVPVL  719



>ref|XP_003531268.1| PREDICTED: U-box domain-containing protein 17-like [Glycine max]
Length=715

 Score =   261 bits (666),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 184/209 (88%), Gaps = 1/209 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+  G VEALA LL+ G+ RGKKDAVTALFNLSTHTENC RMI++GAV A+V AL
Sbjct  507  YKKRIADNVGAVEALAWLLQKGTQRGKKDAVTALFNLSTHTENCLRMIEAGAVKAMVVAL  566

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAEEAAGAL LIVRQP+GA AV +EE A+ GLIGMMRCGTP+GKENAVAALLELCR
Sbjct  567  GNEVVAEEAAGALVLIVRQPVGAMAVVREEAAITGLIGMMRCGTPRGKENAVAALLELCR  626

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AAT+RV++ PALAGLLQ+LLFTGTKRARRKAASLARVFQR E+AS+HY GLGVGYA
Sbjct  627  SGGAAATQRVVRVPALAGLLQTLLFTGTKRARRKAASLARVFQRRENASLHYAGLGVGYA  686

Query  139  FAGNSATTRDT-TFASDVSVQMSISVPVL  56
            FA +SA+TR+T TF SDVS+ MSISV VL
Sbjct  687  FASDSASTRNTATFVSDVSLPMSISVSVL  715



>ref|XP_010665507.1| PREDICTED: U-box domain-containing protein 17 [Beta vulgaris 
subsp. vulgaris]
Length=718

 Score =   260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 2/208 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G VEALA LLRDG+ RGKKDA+TALFNLSTHT NCARMI+SGAV A+VGA+
Sbjct  509  YKKRIADENGAVEALANLLRDGTPRGKKDAITALFNLSTHTGNCARMIESGAVAAVVGAV  568

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGV+EEAAGALALIVRQP GA A+G+EE AVAGL+GMMRCGTP+ KENAVAALLELCR
Sbjct  569  GVEGVSEEAAGALALIVRQPAGAEALGREEMAVAGLLGMMRCGTPRAKENAVAALLELCR  628

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVLKAPALAGLLQ+LLFTGTKRARRKAASLARVFQR E+A++HYGGLGVGY 
Sbjct  629  SGG-AATERVLKAPALAGLLQTLLFTGTKRARRKAASLARVFQRRENAALHYGGLGVGYQ  687

Query  139  FAGNSATTRDTT-FASDVSVQMSISVPV  59
             AGNS T RDTT F  DVSV MSISVPV
Sbjct  688  LAGNSTTNRDTTSFVGDVSVPMSISVPV  715



>ref|XP_010242129.1| PREDICTED: U-box domain-containing protein 17 [Nelumbo nucifera]
Length=717

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 185/211 (88%), Gaps = 3/211 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRI  ++G VEALAGLLR+GSLRGKKDAVTALFNLSTH+ENC RMI+SGAV ALVGAL
Sbjct  507  YKKRITSEEGAVEALAGLLREGSLRGKKDAVTALFNLSTHSENCERMIESGAVTALVGAL  566

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGAAAVG EE AV GLIGMMR GTPKGKENAVAALLELCR
Sbjct  567  GTEGVAEEAAGALALIVRQPIGAAAVGNEELAVTGLIGMMRRGTPKGKENAVAALLELCR  626

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCE-HASMHYG--GLGV  149
            SGG A T+RV +APALA LLQ+LLFTGTKRARRKAASLARV QRCE  A+M  G  G+GV
Sbjct  627  SGGIATTQRVARAPALASLLQTLLFTGTKRARRKAASLARVCQRCEATAAMPMGGWGVGV  686

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPVL  56
            GY FAGNSA+ R ++FA DVSV +SISVPVL
Sbjct  687  GYPFAGNSASDRSSSFAGDVSVPVSISVPVL  717



>ref|XP_011085318.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
17-like [Sesamum indicum]
Length=719

 Score =   250 bits (638),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA+++  ++ALAGLL +G+ RGK+DAVTALFNL THTENCARMIDSGA+ AL+GAL
Sbjct  512  YKKQIAQEEWAIKALAGLLTEGTPRGKRDAVTALFNLCTHTENCARMIDSGAITALIGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            GCEGV+EEAA  LAL V QP+GA  V KEE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  572  GCEGVSEEAAVXLALTVPQPLGAEVVAKEEKAVAGLIGMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATE V+KAPALAGLLQSLLFTGTKRARRKAASLARVFQRCE+AS H+GGLG+GY 
Sbjct  632  SGGAAATEMVVKAPALAGLLQSLLFTGTKRARRKAASLARVFQRCENASRHFGGLGLGYG  691

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            +A NSA  RDT+F+SDV++ MSISVPVL
Sbjct  692  YAENSAVARDTSFSSDVAMPMSISVPVL  719



>ref|XP_002305723.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE86234.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=717

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G VEALAGLLR G+ RGKKDAVTALFNLSTHTENC RMI++GA+ ALVGAL
Sbjct  510  YKKRIADEEGAVEALAGLLRKGTPRGKKDAVTALFNLSTHTENCVRMIEAGAIAALVGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  570  GKEGVAEEAAGALALIVRQPIGAKAVGGEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG  ATE+VLKAPALAGLLQSLLFTGTKRARRKAASLARVFQRC +  + +GGLG GYA
Sbjct  630  SGGTDATEKVLKAPALAGLLQSLLFTGTKRARRKAASLARVFQRCGNYPLQFGGLGAGYA  689

Query  139  FAGNSATTRD  110
            FAGNSA  RD
Sbjct  690  FAGNSAANRD  699



>ref|XP_011010906.1| PREDICTED: U-box domain-containing protein 17-like [Populus euphratica]
Length=717

 Score =   248 bits (634),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 160/190 (84%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+++G VEALAGLLR G+ RGKKDAVTALFNLSTHTENC RMI++GA+ ALVGAL
Sbjct  510  YKKRIADEEGAVEALAGLLRKGTPRGKKDAVTALFNLSTHTENCVRMIEAGAIAALVGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVG EE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  570  GKEGVAEEAAGALALIVRQPIGAKAVGGEEMAVAGLIGMMRCGTPRGKENAVAALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG  ATE+VLKAPALAGLLQSLLFTGTKRARRKAASLARVFQRC +  + +GGLG GYA
Sbjct  630  SGGTDATEKVLKAPALAGLLQSLLFTGTKRARRKAASLARVFQRCGNYPLQFGGLGAGYA  689

Query  139  FAGNSATTRD  110
            FAGNSA  RD
Sbjct  690  FAGNSAANRD  699



>ref|XP_007159489.1| hypothetical protein PHAVU_002G241800g [Phaseolus vulgaris]
 gb|ESW31483.1| hypothetical protein PHAVU_002G241800g [Phaseolus vulgaris]
Length=711

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+  G VEALA LL  G+ RGKKDAVTALFNLSTHTENC RMI++GAV A+V AL
Sbjct  506  YKKRIADNVGAVEALAWLLLQGTQRGKKDAVTALFNLSTHTENCLRMIEAGAVKAMVVAL  565

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGV EEAAGALALIVRQPIGA AV  EE AV GL+G+MRCGTP+GKENAVAALLELCR
Sbjct  566  GNEGVFEEAAGALALIVRQPIGAMAVVGEEAAVGGLLGIMRCGTPRGKENAVAALLELCR  625

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV++APALAGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  626  SGGAAATERVVRAPALAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  685

Query  139  FAGNSATTRDTT  104
            FA +SA+TR+TT
Sbjct  686  FASDSASTRNTT  697



>gb|EYU43305.1| hypothetical protein MIMGU_mgv1a002121mg [Erythranthe guttata]
Length=711

 Score =   245 bits (625),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 176/208 (85%), Gaps = 7/208 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK+IAE+D  +EALA LLR+G+ RGKKDAVTALFNLSTH ENC RMI+SGA+  LV AL
Sbjct  511  FKKQIAEEDYAIEALASLLRNGTPRGKKDAVTALFNLSTHIENCGRMIESGAITVLVEAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGV+EE+AGALALIVRQ +GA AV KEE AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  571  DFEGVSEESAGALALIVRQRLGAEAVAKEEKAVAGLIGMMRCGTPRGKENAVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AA ERV+KAPA+ GLLQSLLFTGTKRARRKAASLARVFQRCE+  +H+GGLGVGYA
Sbjct  631  SGGAAALERVVKAPAMVGLLQSLLFTGTKRARRKAASLARVFQRCENGWLHFGGLGVGYA  690

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            FAG+    RDT       + ++ISVPV+
Sbjct  691  FAGDLDVNRDT-------MSVAISVPVV  711



>gb|KJB69676.1| hypothetical protein B456_011G036500 [Gossypium raimondii]
Length=711

 Score =   238 bits (606),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 177/206 (86%), Gaps = 8/206 (4%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+Q G VEALA LLR G+ RGKKDAVTALFNL+TH +NC+RMI++GAV ALVGAL
Sbjct  512  YKKRIADQGGAVEALAELLRVGTPRGKKDAVTALFNLATHADNCSRMIEAGAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AVGKEETAV+GLI MMRCGTP+GKENAVAALLE CR
Sbjct  572  GNEGVAEEAAGALALIVRQPIGAEAVGKEETAVSGLIAMMRCGTPRGKENAVAALLEFCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            +GG AAT RVLKAPA+A LLQ+LLFTGTKRARRKAASLARVFQ+CE+A+  +GG GVGY 
Sbjct  632  TGGAAATRRVLKAPAMASLLQTLLFTGTKRARRKAASLARVFQKCENATSRFGGSGVGYP  691

Query  139  FAGNSATTRDTTFASDVS-VQMSISV  65
            FA NS T       +DVS V MSISV
Sbjct  692  FASNSTT-------NDVSVVPMSISV  710



>ref|XP_010248377.1| PREDICTED: U-box domain-containing protein 17-like [Nelumbo nucifera]
Length=712

 Score =   236 bits (602),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRI  ++G VE+LAGLLR+GSLRGKKDAVTALFNLSTH+ENC RMI+SGAV ALVGAL
Sbjct  505  YKKRITSEEGAVESLAGLLREGSLRGKKDAVTALFNLSTHSENCERMIESGAVTALVGAL  564

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALALIVRQPIGA AV  EE AV+GLIGMMR GTPKGKENAVAALLELCR
Sbjct  565  GTEGVAEEAAGALALIVRQPIGAEAVENEELAVSGLIGMMRRGTPKGKENAVAALLELCR  624

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A T+RV +APALA LLQSLLFTGTKRARRKAASLARV QRCE A++   G GVGYA
Sbjct  625  SGGTATTQRVARAPALASLLQSLLFTGTKRARRKAASLARVCQRCEAAALPMEGYGVGYA  684

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            F GNSA+ R + FA DVSV +SISVPVL
Sbjct  685  FVGNSASDRSSNFAGDVSVPVSISVPVL  712



>ref|XP_010549429.1| PREDICTED: U-box domain-containing protein 17 [Tarenaya hassleriana]
Length=714

 Score =   235 bits (600),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 4/208 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  +G +EALA LL++G+ RGKKDAVTAL+N+STH ENC+RM++SG V ALV AL
Sbjct  511  YKKRIAGVEGCIEALALLLKNGTPRGKKDAVTALYNISTHVENCSRMVESGGVAALVVAL  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQP+GA A+G+EE+AV GLI MMRCGTP+GKENAVAALLELCR
Sbjct  571  SNEGVAEEAAGALALMVRQPLGARAIGREESAVTGLIAMMRCGTPRGKENAVAALLELCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+V++APALAGL+Q+LLFTGTKRARRKAASLARVFQRCE+ ++  GGLG    
Sbjct  631  SGGAAVAEKVVRAPALAGLIQTLLFTGTKRARRKAASLARVFQRCENGALRSGGLG----  686

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            F+GNS   RD  F +DVSV +SISVPVL
Sbjct  687  FSGNSNGNRDGGFTTDVSVPISISVPVL  714



>gb|ACJ85851.1| unknown [Medicago truncatula]
Length=692

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA++ G VEALAGLL+DG+ RGKKDAVTALFNLST T+NC RMI++GAV ALV AL
Sbjct  512  YKKIIADETGAVEALAGLLQDGTPRGKKDAVTALFNLSTRTDNCVRMIEAGAVTALVEAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGA+ALIVRQP GA A+  +E AVAGLIGMMRCGTP+GKENAVAALLELCR
Sbjct  572  GNEGVAEEAAGAIALIVRQPFGAKALVNQEEAVAGLIGMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERV+KAPA+AGLLQ+LLFTGTKRARRKAASLARVFQRCE+AS+HYGGLGVGYA
Sbjct  632  SGGSAATERVVKAPAIAGLLQTLLFTGTKRARRKAASLARVFQRCENASLHYGGLGVGYA  691

Query  139  F  137
             
Sbjct  692  L  692



>gb|KJB34910.1| hypothetical protein B456_006G089900 [Gossypium raimondii]
Length=711

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 171/205 (83%), Gaps = 6/205 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KKRIA+Q+G +EALAGLLR G+ RGKKDAV ALFNLSTHT+NCARMI + AV  LVGAL
Sbjct  512  FKKRIADQEGAIEALAGLLRVGTSRGKKDAVMALFNLSTHTDNCARMIKARAVAELVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALALIVRQPIGA AVGKEE AV+ LI MMRCGTP+GKENAVAALLELCR
Sbjct  572  QNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVSRLITMMRCGTPRGKENAVAALLELCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATERVLK PALAGLLQ+LLFTGTKRARRKAASLARVF RCE+ S+H  G      
Sbjct  632  SGGAAATERVLKTPALAGLLQTLLFTGTKRARRKAASLARVFHRCENTSLHPSG------  685

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
            F   ++TT  +TF  DVSV MS+SV
Sbjct  686  FRNGNSTTNISTFGGDVSVPMSLSV  710



>gb|EYU28122.1| hypothetical protein MIMGU_mgv1a027038mg [Erythranthe guttata]
Length=700

 Score =   226 bits (575),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 165/208 (79%), Gaps = 17/208 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK+RIA+++G +EALA LLR+G+ RGKKDAVTALFNLSTH ENCARMIDSGA+ AL+GAL
Sbjct  510  YKRRIAQENGAIEALAALLREGTPRGKKDAVTALFNLSTHDENCARMIDSGAIQALIGAL  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            GCE V EEAAGALALI RQ IGA AVGKEE AVAGL  +MRCGTP+ KENAV ALLELCR
Sbjct  570  GCEVVFEEAAGALALIARQSIGAEAVGKEEMAVAGLTEVMRCGTPRAKENAVVALLELCR  629

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AATE+V+KAPALA LL  LLFTGTKRARRKAASLARV QRCEHAS H+GGL VG  
Sbjct  630  SGGAAATEKVVKAPALANLLHGLLFTGTKRARRKAASLARVVQRCEHASFHFGGLDVG--  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
                    RD  F         ISVPVL
Sbjct  688  -------PRDMNFP--------ISVPVL  700



>ref|XP_009115249.1| PREDICTED: U-box domain-containing protein 17-like [Brassica 
rapa]
Length=704

 Score =   226 bits (575),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 170/209 (81%), Gaps = 5/209 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEAL+ LLR+G+ RGKKDAVTAL+NLSTH +NC RMI+ G V +LVGAL
Sbjct  500  YKKRIAFTDHCVEALSSLLRNGTPRGKKDAVTALYNLSTHPDNCGRMIEGGGVTSLVGAL  559

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+VRQ +GA A+G+EE AV GL+GMMRCGT +GKENAVAALLELCR
Sbjct  560  KNDVVSEEAAGALALLVRQSLGAEAIGREEGAVTGLMGMMRCGTARGKENAVAALLELCR  619

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AA E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR EHA+M  G    GY 
Sbjct  620  SGGAAAAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRREHAAMRSG----GYG  675

Query  139  FAGNSATTRD-TTFASDVSVQMSISVPVL  56
            F GN    RD   F +DVSV MSISVPVL
Sbjct  676  FVGNVNENRDGGNFTTDVSVPMSISVPVL  704



>ref|XP_010460713.1| PREDICTED: U-box domain-containing protein 17 [Camelina sativa]
Length=725

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  520  YKKRIAIVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  579

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  580  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVTGLMGMMRCGTPRGKENAVAALLELCR  639

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  640  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  695

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GNS   RD +F +DVSV   +SISVPVL
Sbjct  696  FVGNSNGNRDGSFTTDVSVPISISISVPVL  725



>emb|CDX94661.1| BnaC07g09970D [Brassica napus]
Length=711

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 175/211 (83%), Gaps = 7/211 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RM++ G V++LVGAL
Sbjct  505  YKKRIASVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMVEGGGVSSLVGAL  564

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL++RQP+GA A+GKEE AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  565  KSEGVAEEAAGALALLMRQPLGAEAIGKEEAAVTGLMGMMRCGTPRGKENAVAALLELCR  624

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG A  ERVL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  625  GGGAAVAERVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  680

Query  139  FAGNSATTRD-TTFASDVSVQM--SISVPVL  56
            F GN   TRD  +F +DVSV M  SISVPVL
Sbjct  681  FVGNGNGTRDGGSFTTDVSVPMSISISVPVL  711



>gb|KFK44763.1| hypothetical protein AALP_AA1G299800 [Arabis alpina]
Length=719

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 175/208 (84%), Gaps = 4/208 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  516  YKKQIAIVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  575

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  576  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVTGLMGMMRCGTPRGKENAVAALLELCR  635

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  636  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  691

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            F GN+   RD  + +DVSV +SISVPVL
Sbjct  692  FVGNTNGNRDGGYTTDVSVPISISVPVL  719



>ref|XP_010478295.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=725

 Score =   225 bits (574),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  520  YKKRIAIVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  579

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  580  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVTGLMGMMRCGTPRGKENAVAALLELCR  639

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  640  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  695

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GNS   RD +F +DVSV   +SISVPVL
Sbjct  696  FVGNSNGNRDGSFTTDVSVPISISISVPVL  725



>emb|CDX99816.1| BnaC05g22380D [Brassica napus]
Length=724

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 169/209 (81%), Gaps = 5/209 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEAL+ LLR+G+ RGKKDAVTAL+NLSTH +NC RMI+ G V++LV AL
Sbjct  520  YKKRIAFTDHCVEALSSLLRNGTPRGKKDAVTALYNLSTHPDNCGRMIEGGGVSSLVVAL  579

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+VRQ +GA A+G+EE AV GL+GMMRCGT +GKENAVAALLELCR
Sbjct  580  KNDVVSEEAAGALALLVRQSLGAEAIGREEGAVTGLMGMMRCGTARGKENAVAALLELCR  639

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AA ERVL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR EHA+M  G    GY 
Sbjct  640  SGGAAAAERVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRREHAAMRSG----GYG  695

Query  139  FAGNSATTRD-TTFASDVSVQMSISVPVL  56
            F  N    RD   F +DVSV MSISVPVL
Sbjct  696  FVVNVNENRDGGNFTTDVSVPMSISVPVL  724



>ref|XP_010499451.1| PREDICTED: U-box domain-containing protein 17 [Camelina sativa]
Length=724

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGK+DAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  519  YKKRIAIVDQCVEALASLLQNGTPRGKRDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  578

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  579  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVTGLMGMMRCGTPRGKENAVAALLELCR  638

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  639  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  694

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GNS   RD +F +DVSV   +SISVPVL
Sbjct  695  FVGNSNGNRDGSFTTDVSVPISISISVPVL  724



>emb|CDY48332.1| BnaA09g26890D [Brassica napus]
Length=704

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 169/209 (81%), Gaps = 5/209 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEAL+ LLR+G+ RGKKDAVTAL+NLSTH +NC RMI  G V++LVGAL
Sbjct  500  YKKRIAFTDHCVEALSSLLRNGTPRGKKDAVTALYNLSTHPDNCGRMIQGGGVSSLVGAL  559

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+VRQ +GA A+G+EE AV GL+GMMRCGT +GKENAVAALLELCR
Sbjct  560  KNDVVSEEAAGALALLVRQSLGAEAIGREEGAVTGLMGMMRCGTARGKENAVAALLELCR  619

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG AA E+VL+ PA+AGLLQ+LLFTGTKRARRKAASLARVFQR EHA+M  G    GY 
Sbjct  620  SGGAAAAEKVLRVPAIAGLLQTLLFTGTKRARRKAASLARVFQRREHAAMRSG----GYG  675

Query  139  FAGNSATTRD-TTFASDVSVQMSISVPVL  56
            F GN    RD   F +DVSV MSISVPVL
Sbjct  676  FVGNVNENRDGGNFTTDVSVPMSISVPVL  704



>ref|XP_006306891.1| hypothetical protein CARUB_v10008444mg [Capsella rubella]
 gb|EOA39789.1| hypothetical protein CARUB_v10008444mg [Capsella rubella]
Length=720

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  515  YKKRIAVVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  574

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AV GL+GMMRCGTP+GKENAVAALLELC+
Sbjct  575  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVTGLMGMMRCGTPRGKENAVAALLELCK  634

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  635  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  690

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GNS   RD +F +DVSV   +SISVPVL
Sbjct  691  FVGNSNGNRDGSFTNDVSVPISISISVPVL  720



>emb|CDX90186.1| BnaA08g17980D [Brassica napus]
Length=713

 Score =   222 bits (566),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 173/211 (82%), Gaps = 7/211 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH ENC+RMI+ G V++LVGAL
Sbjct  507  YKKRIAMADQCVEALASLLQNGTPRGKKDAVTALYNLSTHPENCSRMIEGGGVSSLVGAL  566

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  567  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVTGLMGMMRCGTPRGKENAVAALLELCR  626

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG A  ERVL+APA+AG+LQ+LLFTGTKRARRKAASLARVFQR EHA+M  G    GY 
Sbjct  627  RGGAAVAERVLRAPAIAGVLQTLLFTGTKRARRKAASLARVFQRREHAAMRAG----GYG  682

Query  139  FAGNSATTRD-TTFASDVSVQM--SISVPVL  56
            F G+    RD   F +DVSV M  SISVPVL
Sbjct  683  FVGDVNGNRDGGNFTTDVSVPMSISISVPVL  713



>ref|XP_002890808.1| plant U-box17 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67067.1| plant U-box17 [Arabidopsis lyrata subsp. lyrata]
Length=722

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 176/210 (84%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  517  YKKQIAVVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  577  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVAGLMGMMRCGTPRGKENAVAALLELCR  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G     Y 
Sbjct  637  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----VYG  692

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GNS   RD +F +DVSV   +SISVPVL
Sbjct  693  FVGNSNGNRDGSFTTDVSVPISISISVPVL  722



>ref|XP_009109670.1| PREDICTED: U-box domain-containing protein 17 [Brassica rapa]
Length=719

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 172/211 (82%), Gaps = 7/211 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH ENC+RMI+ G V++LVGAL
Sbjct  513  YKKRIAMADQCVEALASLLQNGTPRGKKDAVTALYNLSTHPENCSRMIEGGGVSSLVGAL  572

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+GMMRCG P+GKENAVAALLELCR
Sbjct  573  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVTGLMGMMRCGRPRGKENAVAALLELCR  632

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG A  ERVL+APA+AG+LQ+LLFTGTKRARRKAASLARVFQR EHA+M  G    GY 
Sbjct  633  RGGAAVAERVLRAPAIAGVLQTLLFTGTKRARRKAASLARVFQRREHAAMRAG----GYG  688

Query  139  FAGNSATTRD-TTFASDVSVQM--SISVPVL  56
            F G+    RD   F +DVSV M  SISVPVL
Sbjct  689  FVGDVNGNRDGGNFTTDVSVPMSISISVPVL  719



>ref|NP_174228.1| U-box domain-containing protein 17 [Arabidopsis thaliana]
 sp|Q9C7R6.1|PUB17_ARATH RecName: Full=U-box domain-containing protein 17; AltName: Full=Plant 
U-box protein 17 [Arabidopsis thaliana]
 gb|AAG51726.1|AC068667_5 arm repeat-containing protein, putative; 6839-9028 [Arabidopsis 
thaliana]
 gb|AAN13028.1| putative arm repeat-containing protein [Arabidopsis thaliana]
 gb|AEE31074.1| U-box domain-containing protein 17 [Arabidopsis thaliana]
Length=729

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 175/210 (83%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  524  YKKRIAIVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  583

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  584  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVAGLMGMMRCGTPRGKENAVAALLELCR  643

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G     Y 
Sbjct  644  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----VYG  699

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GN+   RD  F +DVSV   +SISVPVL
Sbjct  700  FVGNTNGNRDGGFTTDVSVPISISISVPVL  729



>dbj|BAJ34586.1| unnamed protein product [Thellungiella halophila]
Length=724

 Score =   219 bits (557),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 174/211 (82%), Gaps = 7/211 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI  G V++LVGAL
Sbjct  518  YKKRIAIVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIQGGGVSSLVGAL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  578  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVVGLMGMMRCGTPRGKENAVAALLELCR  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G    GY 
Sbjct  638  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----GYG  693

Query  139  FAGNSATTRD-TTFASDVSVQM--SISVPVL  56
            F  N+   RD  +F +DVSV M  SISVPVL
Sbjct  694  FVENTNGNRDGGSFTTDVSVPMSISISVPVL  724



>emb|CDY43332.1| BnaC03g59040D [Brassica napus]
Length=719

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 172/211 (82%), Gaps = 7/211 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH ENC+RMI+ G V++LVGAL
Sbjct  513  YKKRIAMADQCVEALASLLQNGTPRGKKDAVTALYNLSTHPENCSRMIEGGGVSSLVGAL  572

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+ MMRCGTP+GKENAVAALLELCR
Sbjct  573  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVTGLMWMMRCGTPRGKENAVAALLELCR  632

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG A  ERVL+APA+AG+LQ+LLFTGTKRARRKAASLARVFQR EHA++  G    GY 
Sbjct  633  RGGAAVAERVLRAPAIAGVLQTLLFTGTKRARRKAASLARVFQRREHAAIRAG----GYG  688

Query  139  FAGNSATTRD-TTFASDVSVQM--SISVPVL  56
            F G+    RD   F +DVSV M  SISVPVL
Sbjct  689  FVGDVNGNRDGGNFTTDVSVPMSISISVPVL  719



>ref|XP_010657066.1| PREDICTED: U-box domain-containing protein 17-like [Vitis vinifera]
Length=562

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRI +++G + ALAGLL++G+ RGKKDAVTALFNLSTH +NC+RMI++GA+ ALV A+
Sbjct  353  YKKRITDENGAISALAGLLKEGTQRGKKDAVTALFNLSTHMDNCSRMIEAGAITALVDAM  412

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEA G L ++VRQPIGA AV KEE AV  LI MMR GT +GKENAV+A+LELCR
Sbjct  413  ETEGVAEEALGVLGMLVRQPIGAQAVNKEERAVPRLIKMMRHGTSRGKENAVSAMLELCR  472

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            +GG +  ++V K PA + LL  LL+TGTKRARRKAASLARV QR E  ++ YG  GVGY 
Sbjct  473  NGGPSIIQKVAKVPAFSSLLHILLYTGTKRARRKAASLARVCQRYEAVALPYGLWGVGYT  532

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL*W  50
            F+ NS+    ++F SDVSV MSISVPVL W
Sbjct  533  FSSNSSANLGSSFTSDVSVSMSISVPVL-W  561



>gb|AAL36401.1| putative arm repeat-containing protein [Arabidopsis thaliana]
Length=729

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 174/210 (83%), Gaps = 6/210 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RM + G V++LVGAL
Sbjct  524  YKKRIAIVDQCVEALALLLQNGTPRGKKDAVTALYNLSTHPDNCSRMTEGGGVSSLVGAL  583

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AVAGL+GMMRCGTP+GKENAVAALLELCR
Sbjct  584  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVAGLMGMMRCGTPRGKENAVAALLELCR  643

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR E+A+M  G     Y 
Sbjct  644  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRRENAAMRSG----VYG  699

Query  139  FAGNSATTRDTTFASDVSV--QMSISVPVL  56
            F GN+   RD  F +DVSV   +SISVPVL
Sbjct  700  FVGNTNGNRDGGFTTDVSVPISISISVPVL  729



>ref|XP_010540527.1| PREDICTED: U-box domain-containing protein 17-like [Tarenaya 
hassleriana]
Length=710

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 170/208 (82%), Gaps = 6/208 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+IA  +G V ALA LL++G+ RGKKDAVTA++NLSTH ENC  MI+ G V ALVGAL
Sbjct  509  YKKQIAGTEGCVRALASLLQNGTPRGKKDAVTAMYNLSTHLENCGNMIEYGGVLALVGAL  568

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQP+GA A+GKEE+AV+ L+ +MRCGT +GKENAVAALL LCR
Sbjct  569  EEEGVAEEAAGALALMVRQPLGAEAIGKEESAVSRLVAVMRCGTARGKENAVAALLGLCR  628

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
            SGG A  E+V++ P+L+GL+Q +LFTGTKRARRKAASLARVF RCE+A++  GG G+   
Sbjct  629  SGGSAMAEKVVRVPSLSGLIQMILFTGTKRARRKAASLARVFHRCENAALLSGGYGI---  685

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
             AGN    R+  FA+DVSVQMSISVPVL
Sbjct  686  -AGNG--NREGGFATDVSVQMSISVPVL  710



>ref|XP_010468768.1| PREDICTED: U-box domain-containing protein 17-like, partial [Camelina 
sativa]
Length=367

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEAL  LL++G+ RGKKDAVTAL+NLSTH +NC+RMI+ G V++LVGAL
Sbjct  177  YKKRIAIVDQCVEALVSLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIEGGGVSSLVGAL  236

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKE++AV GL+GMMRC TP+GKEN VAALLELCR
Sbjct  237  KNEGVAEEAAGALALLVRQSLGAEAIGKEDSAVMGLMGMMRCVTPRGKENVVAALLELCR  296

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCE  182
            SGG A  E+VL+APA+AGLLQ+LLFTGTKRARRKAASLARVFQR +
Sbjct  297  SGGAAVAEKVLRAPAIAGLLQTLLFTGTKRARRKAASLARVFQRLQ  342



>ref|XP_010915473.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
17-like [Elaeis guineensis]
Length=729

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 131/215 (61%), Positives = 160/215 (74%), Gaps = 9/215 (4%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRI ++ G VEALA +L DGS RG+KDAV ALFNLSTH E+  RM+D GA++ALVGA+
Sbjct  517  YKKRIIDEPGAVEALANMLTDGSPRGRKDAVMALFNLSTHPESWVRMMDVGALSALVGAV  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAEEAAGALAL++++PI A AVG EE A+  L+G+MR GT KGKENAVAAL ELC+
Sbjct  577  EDEEVAEEAAGALALLMKEPIVAEAVGSEEAAIHSLMGLMRSGTAKGKENAVAALQELCQ  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG A T+RV + P+L  LLQ++LFTGTKRARRKAA LA++ QRCE  +M    LG G+A
Sbjct  637  RGGFALTQRVARMPSLGVLLQTILFTGTKRARRKAALLAKMCQRCESPAMM--ALGSGWA  694

Query  139  FAGNSATT----RDTTFAS---DVSVQMSISVPVL  56
            F   SA      R ++F S    VSV M+ISVPVL
Sbjct  695  FDHASARANPLRRSSSFGSGDVSVSVPMAISVPVL  729



>ref|XP_006415583.1| hypothetical protein EUTSA_v10006853mg [Eutrema salsugineum]
 gb|ESQ33936.1| hypothetical protein EUTSA_v10006853mg [Eutrema salsugineum]
Length=783

 Score =   177 bits (449),  Expect = 1e-47, Method: Composition-based stats.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  D  VEALA LL++G+ RGKKDAVTAL+NLSTH +NC+RMI  G V++LVGAL
Sbjct  518  YKKRIAIVDQCVEALASLLQNGTPRGKKDAVTALYNLSTHPDNCSRMIQGGGVSSLVGAL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+VRQ +GA A+GKEE+AV GL+GMMRCGTP+GKENAVAALLELCR
Sbjct  578  KNEGVAEEAAGALALLVRQSLGAEAIGKEESAVVGLMGMMRCGTPRGKENAVAALLELCR  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTG  239
            SGG A  E+VL+APA+AGLLQ+L   G
Sbjct  638  SGGAAVAEKVLRAPAIAGLLQTLCLRG  664



>ref|XP_008794161.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
17-like [Phoenix dactylifera]
Length=720

 Score =   163 bits (412),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 156/212 (74%), Gaps = 7/212 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRI ++ G VEALA +L DGS RG+KDAV ALFNLSTH ++   M+D GAV+ALVGA+
Sbjct  512  YKKRIMDEPGAVEALANMLMDGSPRGRKDAVMALFNLSTHPQSWVGMMDMGAVSALVGAV  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G +GVAEEAAGALAL+++QPI A AVG E+ A++ L+G+MR GT KGKENAVAAL E+CR
Sbjct  572  GDDGVAEEAAGALALLMKQPIVAEAVGSEDAAISSLVGLMRRGTAKGKENAVAALQEMCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG-GLGVGY  143
             GG   T+RV + PAL  L+Q++LFTGTKRARRKAA LAR+   C+ A+M +G G  V  
Sbjct  632  RGGFTLTQRVARMPALGSLIQTILFTGTKRARRKAALLARM---CQTAAMAFGSGWAVDR  688

Query  142  AFAGNSATTRDTTFAS---DVSVQMSISVPVL  56
                  +  R ++F S    V+  M+ISVPVL
Sbjct  689  TLGRTGSFRRGSSFRSGAVSVAAPMAISVPVL  720



>ref|XP_008790028.1| PREDICTED: U-box domain-containing protein 17-like [Phoenix dactylifera]
Length=734

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 151/209 (72%), Gaps = 4/209 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I ++ G VEALA +L DG  RG+KDAV ALFNLSTH E+  RM+D GAV+ALVGA+
Sbjct  521  HKKTILDEPGAVEALARMLTDGRPRGRKDAVMALFNLSTHPESWVRMMDMGAVSALVGAV  580

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              EGVAEEAAGALAL+++QPI A  VG EE A+  L+G+MR GT KGKENAVAAL ELC+
Sbjct  581  EDEGVAEEAAGALALLLKQPIVAEVVGSEEAAINSLLGLMRMGTAKGKENAVAALQELCQ  640

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG   T+RV + P+L  LL ++LFTGTKRARRKAA LA++ QRC  AS     LG G+A
Sbjct  641  RGGFVLTQRVARMPSLGALLHTILFTGTKRARRKAALLAKICQRC--ASPAAMALGSGWA  698

Query  139  FAGNSATTRDTTFASDV--SVQMSISVPV  59
                SA T D+   S    S ++S+SVPV
Sbjct  699  IDRTSAMTNDSLRRSSSFGSGEVSVSVPV  727



>ref|XP_009419314.1| PREDICTED: U-box domain-containing protein 17-like [Musa acuminata 
subsp. malaccensis]
Length=707

 Score =   160 bits (406),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 143/208 (69%), Gaps = 8/208 (4%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK+I +Q G V ALA LL  GS RGK+DAV ALFNLSTH E   RM+D GAV ALVGAL
Sbjct  508  FKKKIVDQQGAVAALANLLMQGSTRGKRDAVMALFNLSTHPECWCRMLDLGAVLALVGAL  567

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAEEAA AL L+VRQPI A AVG E+ A+  L+G+M  GTPKGKENAVAAL ELCR
Sbjct  568  RDESVAEEAAAALQLLVRQPIVAEAVGSEDAAITNLVGLMTRGTPKGKENAVAALQELCR  627

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG   T RV + PAL GL+Q++LFTGTKRARRKAA L R+ +RCE  ++       G +
Sbjct  628  RGGLPVTRRVARMPALGGLIQAILFTGTKRARRKAALLVRMCRRCESPAVMTCESSRGSS  687

Query  139  FAGNSATTRDTTFASDVSVQMSISVPVL  56
            F    A+         VSV M++ VPVL
Sbjct  688  FGSGDASV--------VSVSMAVQVPVL  707



>gb|AIB04257.1| arm repeat-containing protein 1 [Arabidopsis lyrata subsp. petraea]
Length=701

 Score =   158 bits (399),  Expect = 6e-41, Method: Composition-based stats.
 Identities = 102/211 (48%), Positives = 141/211 (67%), Gaps = 16/211 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  DG +++LA L R+G  RGKKDA+ AL+ + +H +NC++MI+SG V+A+V AL
Sbjct  504  YKKRIANVDGCIKSLASLSRNGKPRGKKDALNALYGIWSHPDNCSQMINSGGVSAIVRAL  563

Query  499  g--cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E V E AA  L ++    +GA  +G+EE+AVAGLI +MRCGTP+GKENAVA LL L
Sbjct  564  ADEEEAVTERAAVVLGVVANHSLGAETIGREESAVAGLIELMRCGTPRGKENAVATLLHL  623

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQR-CEHASMHYGGLGV  149
            C +GG    E+V+KAPAL+ L Q LL TGT RA+RKA+S   + ++ CE+ +M + G   
Sbjct  624  CINGGTVVVEKVVKAPALSDLTQKLLLTGTNRAKRKASSFLALVRKGCENTAMMWSG---  680

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPVL  56
                       R+ +F + VS+ +SI V VL
Sbjct  681  ----------NREGSFRTHVSLPISIPVSVL  701



>ref|XP_009381196.1| PREDICTED: U-box domain-containing protein 17-like [Musa acuminata 
subsp. malaccensis]
Length=723

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 151/213 (71%), Gaps = 6/213 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I ++ G V ALA LL  GS RGKKDAV ALFNLSTH ++ +RM+D GAV+ALVGAL
Sbjct  512  FKKMIVDEQGVVPALANLLMQGSSRGKKDAVMALFNLSTHPQSWSRMLDMGAVSALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAEEAAGALAL++R PI A  VG E+TA+  L+G+MR GTPKGKENAVAAL E+CR
Sbjct  572  RDECVAEEAAGALALLMRHPILAQTVGSEDTAITNLVGLMRRGTPKGKENAVAALQEMCR  631

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCE--HASMHYGGLGVG  146
              G   T++V +   L GL+Q++L TGTKRARRKAA LAR+ QRCE   A+       + 
Sbjct  632  RSGLPVTQKVARMQVLGGLIQTILLTGTKRARRKAALLARMCQRCEGPIATTLGNEWAMN  691

Query  145  YAFAGNSATTRDTTFAS---DVSVQMSISVPVL  56
            +A A  + + RD++F S    VSV M+  VPVL
Sbjct  692  HALA-RTNSLRDSSFRSGDVSVSVSMARQVPVL  723



>ref|XP_009408898.1| PREDICTED: U-box domain-containing protein 17-like [Musa acuminata 
subsp. malaccensis]
Length=729

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 116/212 (55%), Positives = 151/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK IA++ G V ALA LL  GS RGKKDAV ALFNLSTH  + + M+D GAV+ALVGAL
Sbjct  518  FKKMIADEQGAVMALANLLMQGSTRGKKDAVMALFNLSTHPGSWSPMLDMGAVSALVGAL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAEEAAGALA ++RQP  A  +G E+TA+  L+G+MR GTPKGKENAVAAL E+C+
Sbjct  578  RDECVAEEAAGALAFLMRQPFVAQTIGGEDTAITNLVGIMRRGTPKGKENAVAALQEMCQ  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGGLGVGY  143
            SGG A T++V +   L+GL++++  TGTKRARRKAA L+++ QRCE  + M +G   +  
Sbjct  638  SGGLAVTQKVARMQVLSGLIRTISLTGTKRARRKAALLSKLCQRCEAPTAMAFGNDWLAD  697

Query  142  AFAGNSATTRDTTFAS---DVSVQMSISVPVL  56
                 + + R ++F S    VSV M+I VPVL
Sbjct  698  RTLARTNSVRGSSFRSGNLSVSVSMTIQVPVL  729



>ref|XP_002879489.1| hypothetical protein ARALYDRAFT_902509 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55748.1| hypothetical protein ARALYDRAFT_902509 [Arabidopsis lyrata subsp. 
lyrata]
Length=701

 Score =   156 bits (394),  Expect = 3e-40, Method: Composition-based stats.
 Identities = 104/211 (49%), Positives = 142/211 (67%), Gaps = 16/211 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  DG +++LA L R+G  RGKKDA+ AL+ + +H +NC++MI+SG V+A+V AL
Sbjct  504  YKKRIANVDGCIKSLASLSRNGKPRGKKDALNALYGIWSHPDNCSQMINSGGVSAIVRAL  563

Query  499  g--cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E V E AA  L ++    +GA  +G+EE+AVAGLI +MRCGTP+GKENAVA LL L
Sbjct  564  ADEEEAVTERAAVVLGVVANHSLGAETIGREESAVAGLIELMRCGTPRGKENAVATLLHL  623

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaas-laRVFQRCEHASMHYGGLGV  149
            C +GG    E+V++APAL+ L Q LL TGT RA+RKA+S LA V + CE+ +M + G   
Sbjct  624  CINGGTVVVEKVVRAPALSDLTQKLLLTGTNRAKRKASSFLALVCKGCENTAMMWSG---  680

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPVL  56
                       R+ +F + VS+ +SI V VL
Sbjct  681  ----------NREGSFRTHVSLPISIPVSVL  701



>ref|XP_010925596.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 
17-like [Elaeis guineensis]
Length=720

 Score =   155 bits (393),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 152/213 (71%), Gaps = 8/213 (4%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+I ++ G VE LA +L DGS RG+KDAV ALFNLSTH ++   M+D GAV+ALVGA+
Sbjct  511  YKKKIMDEPGAVETLANMLTDGSPRGRKDAVMALFNLSTHPQSWVGMMDMGAVSALVGAV  570

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G EGVAEEAAGALAL+++QPI A AVG EE A+  L+G+MR GT KGKENAVAAL E+CR
Sbjct  571  GDEGVAEEAAGALALLMKQPIVAEAVGSEEAAINSLLGLMRRGTAKGKENAVAALHEMCR  630

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG-GLGVGY  143
             GG   T++V + PAL  L+Q++L TGTKRARRKAA L R+   C+ A M +G G  V  
Sbjct  631  RGGFTLTQKVARMPALGRLIQTILLTGTKRARRKAALLGRM---CQTAVMAFGSGWAVDR  687

Query  142  AFAGNSATTRDTTF----ASDVSVQMSISVPVL  56
              A  S   R ++F     S  +V M+ISVPVL
Sbjct  688  TLARASTLRRGSSFRSGAVSVAAVPMAISVPVL  720



>ref|XP_009388697.1| PREDICTED: U-box domain-containing protein 17-like [Musa acuminata 
subsp. malaccensis]
Length=729

 Score =   155 bits (391),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 152/212 (72%), Gaps = 4/212 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I +++G V  LA LL  GS RGKKDAV ALFNLSTH +  +RM++ GAV+AL+ AL
Sbjct  518  FKKTIVDEEGAVVGLANLLMQGSQRGKKDAVMALFNLSTHLDTWSRMLELGAVSALLEAL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAEEA GALAL++RQP+ A AVG E+ A+A L+ MMR GTPK KENAVAAL E+C+
Sbjct  578  KDESVAEEALGALALLMRQPVVAQAVGSEDAAIASLLEMMRRGTPKRKENAVAALHEMCQ  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEH-ASMHYGG-LGVG  146
             GG   T++V K P L GL+Q++LFTGTKRARRKAA LAR+ QRC+  A+M YG      
Sbjct  638  RGGLPVTQKVAKTPMLGGLIQTILFTGTKRARRKAALLARMCQRCDSPAAMVYGNEWSPS  697

Query  145  YAFAGNSATTRDTTFASDVSVQMS--ISVPVL  56
             A A +S++   +  + DVSV MS  + VPVL
Sbjct  698  RALARSSSSRGSSFRSGDVSVSMSRAVRVPVL  729



>gb|KEH35988.1| Avr9/Cf-9 rapidly elicited protein, putative [Medicago truncatula]
Length=113

 Score =   141 bits (356),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  382  MRCGTPKGKENAVAALLELCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaasla  203
            MRCGTP GKENA AALLELCRSGG AATERV+KAP +AGLLQ+ LFTGTKRARRKAASLA
Sbjct  1    MRCGTPMGKENAFAALLELCRSGGSAATERVVKAPPIAGLLQTQLFTGTKRARRKAASLA  60

Query  202  RVFQRCEHASMHYGGLGVGYAFAGNSATTRDTTFASD  92
            RVFQRCE+AS+HYGGLGVGYA A NSA TRD++FA++
Sbjct  61   RVFQRCENASLHYGGLGVGYALASNSAQTRDSSFAAE  97



>gb|EMS59130.1| U-box domain-containing protein 4 [Triticum urartu]
Length=515

 Score =   148 bits (373),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 144/211 (68%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK I  + G +E LA +L+ G+ RG+KDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  304  YKKMIMNEPGALEKLACMLKKGTPRGRKDAVMALFNLSTHAESSARMLESSAVVALIESL  363

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET ++ L+G+MR GTPKGKENAV+AL E+CR
Sbjct  364  RNDTVSEEAAGALALLMKQPSVVHLVGSSETVISSLVGLMRRGTPKGKENAVSALYEICR  423

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLG---V  149
             GG A   RV K P L  ++Q+++ TGTKRA++KA+ + ++ QR +  S    G     V
Sbjct  424  RGGSALVRRVAKIPGLNTVIQNIMLTGTKRAKKKASLIVKMCQRSQMPSAMSLGTSLRVV  483

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             ++  GNS+  R  +F S ++S  +SISV V
Sbjct  484  DHSLVGNSSLRRAASFGSGELSNPVSISVHV  514



>ref|XP_004951360.1| PREDICTED: U-box domain-containing protein 4-like [Setaria italica]
Length=733

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 143/213 (67%), Gaps = 8/213 (4%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+  RM++S AV AL+ +L
Sbjct  522  YKKKIMNEPGAVEELASMLTRGTPRGKKDAVMALFNLSTHPESSGRMLESSAVVALIESL  581

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  582  RNDTVSEEAAGALALLMKQPTIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  641

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLG----  152
             GG    +RV + P L  ++Q++  TGTKRA++KA+ + ++ QR +  S    GLG    
Sbjct  642  RGGSTLAQRVARIPGLNTVIQNITLTGTKRAKKKASLIVKMCQRSQMPSAL--GLGSTLT  699

Query  151  -VGYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             V ++  GNS   R  +F S ++S  +SISVPV
Sbjct  700  VVDHSLVGNSTLRRAASFGSGELSNPVSISVPV  732



>ref|XP_003636485.1| Alkaline alpha galactosidase I [Medicago truncatula]
Length=224

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  382  MRCGTPKGKENAVAALLELCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaasla  203
            MRCGTP GKENA AALLELCRSGG AATERV+KAP +AGLLQ+ LFTGTKRARRKAASLA
Sbjct  112  MRCGTPMGKENAFAALLELCRSGGSAATERVVKAPPIAGLLQTQLFTGTKRARRKAASLA  171

Query  202  RVFQRCEHASMHYGGLGVGYAFAGNSATTRDTTFASD  92
            RVFQRCE+AS+HYGGLGVGYA A NSA TRD++FA++
Sbjct  172  RVFQRCENASLHYGGLGVGYALASNSAQTRDSSFAAE  208



>gb|EMT02293.1| U-box domain-containing protein 17 [Aegilops tauschii]
Length=678

 Score =   146 bits (368),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 143/211 (68%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK I  + G +E LA +L+ G+ RG+KDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  467  YKKMIMNEPGALEKLACMLKKGTPRGRKDAVMALFNLSTHAESSARMLESSAVVALIESL  526

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET ++ L+G+MR GTPKGKENAV+AL E+CR
Sbjct  527  RNDTVSEEAAGALALLMKQPSVVHLVGSSETVISSLVGLMRRGTPKGKENAVSALYEICR  586

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLG---V  149
             GG     RV K P L  ++Q+++ TGTKRA++KA+ + ++ QR +  S    G     V
Sbjct  587  RGGSTLVRRVAKIPGLNTVIQNIMLTGTKRAKKKASLIVKMCQRSQMPSAMSLGTSLRVV  646

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             ++  GNS+  R  +F S ++S  +SISV V
Sbjct  647  DHSLVGNSSLRRAASFGSGELSNPVSISVHV  677



>gb|AFW71185.1| hypothetical protein ZEAMMB73_432257 [Zea mays]
Length=661

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 141/211 (67%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+  RM++S AV +L+ +L
Sbjct  450  YKKKIMNEPGAVEELASMLTKGTARGKKDAVMALFNLSTHPESSGRMLESSAVVSLIESL  509

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  510  RNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  569

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLG---V  149
             GG    +RV + P L  ++Q++  TGTKRA++KA+ + ++ QR +  S    G     V
Sbjct  570  RGGSTLAQRVARIPGLNTVMQNITLTGTKRAKKKASLIVKMCQRSQMPSALALGSTLAVV  629

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             ++  GNS   R  +F S ++S  +SISVPV
Sbjct  630  DHSLVGNSRLRRAPSFGSGELSNPVSISVPV  660



>dbj|BAJ96178.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00157.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=728

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 143/211 (68%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK I  + G +E LA +L+ G+ RG+KDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  517  YKKMIMNEPGALEKLACMLKKGTPRGRKDAVMALFNLSTHAESSARMLESSAVVALIESL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET ++ L+G+MR GTPKGKENAV+AL E+CR
Sbjct  577  RNDTVSEEAAGALALLMKQPSVVHHVGSSETVISSLVGLMRRGTPKGKENAVSALYEICR  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGL---GV  149
             GG     RV K P L  ++Q+++ TGTKRA++KA+ + ++ QR +  S    G     V
Sbjct  637  RGGSTLVRRVAKIPGLNTVIQNIMLTGTKRAKKKASLIVKMCQRSQMPSAMSLGTSLRAV  696

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             ++  GNS+  R  +F S ++S  +SISV V
Sbjct  697  DHSLVGNSSLRRAASFGSGELSNPVSISVHV  727



>ref|XP_002451836.1| hypothetical protein SORBIDRAFT_04g008430 [Sorghum bicolor]
 gb|EES04812.1| hypothetical protein SORBIDRAFT_04g008430 [Sorghum bicolor]
Length=729

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 140/211 (66%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+  RM++S AV AL+ +L
Sbjct  518  YKKKIMNEPGAVEELASMLTKGTPRGKKDAVMALFNLSTHPESSGRMLESSAVVALIESL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++Q      VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  578  RNDTVSEEAAGALALLMKQATIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGG---LGV  149
             GG    +RV + P L  ++Q++  TGTKRA++KA+ + ++ QR +  S    G     V
Sbjct  638  RGGSTLVQRVARIPGLNTVIQNITLTGTKRAKKKASLIVKMCQRSQMPSALALGSTMTVV  697

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
             ++  GNS   R  +F S ++S  +SISVPV
Sbjct  698  DHSLVGNSTLRRAASFGSGELSNPVSISVPV  728



>ref|XP_008679814.1| PREDICTED: U-box domain-containing protein 4 [Zea mays]
 gb|AFW65981.1| hypothetical protein ZEAMMB73_218525 [Zea mays]
Length=732

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 141/214 (66%), Gaps = 7/214 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK+I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+  RM++S AV AL+ +L
Sbjct  518  YKKKIMNEPGAVEELASMLTKGTPRGKKDAVMALFNLSTHPESSGRMLESSAVLALIESL  577

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPK KENAV+AL E+CR
Sbjct  578  RNDTVSEEAAGALALLMKQPTIVHLVGSSETVITSLVGLMRRGTPKCKENAVSALYEICR  637

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGGLG---  152
             GG    +RV + P L  ++Q++  TGTKRA++KA+ + ++ QR +  S +    LG   
Sbjct  638  RGGSTLAQRVARIPGLNTVIQNVTLTGTKRAKKKASLIVKMCQRSQMPSALAAAPLGSTL  697

Query  151  --VGYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              V ++  GN    R  +F S ++S  +SISVPV
Sbjct  698  TVVDHSLVGNGTLRRAASFGSEELSNPVSISVPV  731



>dbj|BAG88374.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56620.1| hypothetical protein OsJ_06003 [Oryza sativa Japonica Group]
Length=535

 Score =   140 bits (353),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  324  FKKLIMNEPGAVEELASMLTKGTSRGKKDAVMALFNLSTHPESSARMLESCAVVALIQSL  383

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  384  RNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  443

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGG--LGV  149
             GG A  +RV K P L  ++Q++   GTKRA++KA+ + ++ QR +  S M  G     V
Sbjct  444  RGGSALVQRVAKIPGLNTVIQTITLNGTKRAKKKASLIVKMCQRSQMPSAMALGSTLTVV  503

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              +  GN+   R  +F S ++S  +SISV V
Sbjct  504  DRSLVGNNTLRRAASFGSGELSNPISISVQV  534



>ref|NP_001046379.1| Os02g0234300 [Oryza sativa Japonica Group]
 dbj|BAF08293.1| Os02g0234300, partial [Oryza sativa Japonica Group]
Length=581

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  370  FKKLIMNEPGAVEELASMLTKGTSRGKKDAVMALFNLSTHPESSARMLESCAVVALIQSL  429

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  430  RNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  489

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGG--LGV  149
             GG A  +RV K P L  ++Q++   GTKRA++KA+ + ++ QR +  S M  G     V
Sbjct  490  RGGSALVQRVAKIPGLNTVIQTITLNGTKRAKKKASLIVKMCQRSQMPSAMALGSTLTVV  549

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              +  GN+   R  +F S ++S  +SISV V
Sbjct  550  DRSLVGNNTLRRAASFGSGELSNPISISVQV  580



>gb|EEC72792.1| hypothetical protein OsI_06476 [Oryza sativa Indica Group]
Length=708

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  497  FKKLIMNEPGAVEELASMLTKGTSRGKKDAVMALFNLSTHPESSARMLESCAVVALIQSL  556

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  557  RNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  616

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGG--LGV  149
             GG A  +RV K P L  ++Q++   GTKRA++KA+ + ++ QR +  S M  G     V
Sbjct  617  RGGSALVQRVAKIPGLNTVIQTITLNGTKRAKKKASLIVKMCQRSQMPSAMALGSTLTVV  676

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              +  GN+   R  +F S ++S  +SISV V
Sbjct  677  DRSLVGNNTLRRAASFGSGELSNPISISVQV  707



>sp|Q6EUK7.1|PUB04_ORYSJ RecName: Full=U-box domain-containing protein 4; AltName: Full=Plant 
U-box protein 4; Short=OsPUB4 [Oryza sativa Japonica 
Group]
 dbj|BAD27662.1| putative Avr9/Cf-9 rapidly elicited protein [Oryza sativa Japonica 
Group]
Length=728

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/211 (49%), Positives = 140/211 (66%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +KK I  + G VE LA +L  G+ RGKKDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  517  FKKLIMNEPGAVEELASMLTKGTSRGKKDAVMALFNLSTHPESSARMLESCAVVALIQSL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  577  RNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  636

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHAS-MHYGG--LGV  149
             GG A  +RV K P L  ++Q++   GTKRA++KA+ + ++ QR +  S M  G     V
Sbjct  637  RGGSALVQRVAKIPGLNTVIQTITLNGTKRAKKKASLIVKMCQRSQMPSAMALGSTLTVV  696

Query  148  GYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              +  GN+   R  +F S ++S  +SISV V
Sbjct  697  DRSLVGNNTLRRAASFGSGELSNPISISVQV  727



>ref|XP_003571878.1| PREDICTED: U-box domain-containing protein 4 [Brachypodium distachyon]
Length=731

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 137/211 (65%), Gaps = 4/211 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK I  + G +E LA +L+ G+ RGKKDAV ALFNLSTH E+  RM++S AV AL+ +L
Sbjct  520  YKKMIMNEPGALEELARMLKKGTPRGKKDAVMALFNLSTHPESSVRMLESCAVVALIESL  579

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPKGKENAV+AL E+CR
Sbjct  580  RNDTVSEEAAGALALLMKQPSVVHLVGSSETVITSLVGLMRRGTPKGKENAVSALYEICR  639

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
             GG     RV+K P    ++Q++  TGTKRA++K   + ++ QR +  S    G  +  A
Sbjct  640  RGGSTLMRRVVKIPGFNTVMQNITLTGTKRAKKKVGLIVKMCQRGQIPSAMSIGANLRTA  699

Query  139  ---FAGNSATTRDTTFAS-DVSVQMSISVPV  59
                  NS+  R  +F S ++S  +SISVPV
Sbjct  700  DRSLVANSSLRRAASFGSGELSNPISISVPV  730



>emb|CDY43686.1| BnaA04g20050D [Brassica napus]
Length=661

 Score =   138 bits (347),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +EALA +LR+G++RGKKDAV AL +L  H +NC+ M+  G V+ALVGAL
Sbjct  491  YKKAIANADGCIEALALVLRNGTVRGKKDAVYALHSLWLHPDNCSLMVKRGGVSALVGAL  550

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P+GKE A+A LL+LC 
Sbjct  551  GEEAVAEKVAWVLGVMATESLGAESIGREETVVTGLMELMRCGRPRGKEKAIATLLQLCT  610

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
            +GG   TE+V+K PALA L + LL TGT
Sbjct  611  AGGAVVTEKVVKTPALAVLTRKLLLTGT  638



>gb|AAB97738.1| arm repeat containing protein [Brassica napus]
Length=661

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +EALA +LR+G++RGKKDAV AL +L  H +NC+ M+  G V+ALVGAL
Sbjct  491  YKKAIANADGCIEALALVLRNGTVRGKKDAVYALHSLWLHPDNCSLMVKRGGVSALVGAL  550

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P+GKE A+A LL+LC 
Sbjct  551  GEEAVAEKVAWVLGVMATESLGAESIGREETVVTGLMELMRCGRPRGKEKAIATLLQLCT  610

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
            +GG   TE+V+K PALA L + LL TGT
Sbjct  611  AGGAVVTEKVVKTPALAVLTRKLLLTGT  638



>ref|XP_009141366.1| PREDICTED: U-box domain-containing protein 17-like [Brassica 
rapa]
Length=661

 Score =   138 bits (347),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +EALA +LR+G++RGKKDAV AL +L  H +NC+ M+  G V+ALVGAL
Sbjct  491  YKKAIANADGCIEALALVLRNGTVRGKKDAVYALHSLWLHPDNCSLMVKRGGVSALVGAL  550

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P+GKE A+A LL+LC 
Sbjct  551  GEEAVAEKVAWVLGVMATESLGAESIGREETVVTGLMELMRCGRPRGKEKAIATLLQLCT  610

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
            +GG   TE+V+K PALA L + LL TGT
Sbjct  611  AGGAVVTEKVVKTPALAVLTRKLLLTGT  638



>emb|CAD20348.1| ARC1 protein [Brassica oleracea]
Length=285

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +E+LA +LR+G++RGKKDAV AL +L  H +NC+ ++  G V+ALVGAL
Sbjct  121  YKKTIANADGCIESLALVLRNGTVRGKKDAVYALHSLWLHPDNCSLVVKRGGVSALVGAL  180

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P GKE A+A LL+LC 
Sbjct  181  GEESVAEKVACVLGVMATESLGAESIGREETVVTGLMELMRCGRPLGKEKAIATLLQLCT  240

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
             GG   TE+V+K PALA L + LL TGT
Sbjct  241  LGGAVVTEKVVKTPALAVLTRKLLLTGT  268



>gb|KJB66866.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=665

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 94/115 (82%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+Q G +EALAGLLR G+ RGKKDAVTALFNLSTH++N ARMI+ GAV ALVGAL
Sbjct  512  YKKRIADQGGAIEALAGLLRVGTPRGKKDAVTALFNLSTHSDNYARMIEVGAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAAL  335
            G EGVAEEAAGALALIVRQPIGA AVGKEE AVAGLI MMRCGT +GKENA A+L
Sbjct  572  GNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVAGLITMMRCGTARGKENANASL  626


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 108/234 (46%), Gaps = 39/234 (17%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMID-SGAVNALvgalgcegvaee  476
            G +  L  LL   +   ++++VTA+ NLS + +N + ++D  G + ++V  L      E 
Sbjct  436  GAIPHLCKLLSSSNPVAQENSVTAMLNLSIYDKNKSLIMDEDGCLRSIVEVLRLGLTTEA  495

Query  475  aagalaliVRQPIGAAAVGKEETA-----VAGLIGMMRCGTPKGKENAVAALLELCRSGG  311
               A A +    + A    K+  A     +  L G++R GTP+GK++AV AL  L     
Sbjct  496  RENAAATLFS--LSAVHDYKKRIADQGGAIEALAGLLRVGTPRGKKDAVTALFNLSTHSD  553

Query  310  EAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaR--------------------VFQ  191
              A  R+++  A+  L+ +L   G       A +L                         
Sbjct  554  NYA--RMIEVGAVTALVGALGNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVAGLITMM  611

Query  190  RC--------EHASMHYGGLGVGYAFAGNS-ATTRDTTFASDVSVQMSISVPVL  56
            RC         +AS+H+GGLGVGYAFAGNS    RD  F  DVS+ MSISV VL
Sbjct  612  RCGTARGKENANASLHFGGLGVGYAFAGNSTPPNRDPRFTDDVSMPMSISVQVL  665



>emb|CDY37666.1| BnaA04g20020D [Brassica napus]
Length=661

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 108/148 (73%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +EALA +LR+G++RGKKDAV AL +L  H +N + M+  G V+ALVGAL
Sbjct  491  YKKAIANADGCIEALALVLRNGTVRGKKDAVYALHSLWLHPDNYSLMVKRGGVSALVGAL  550

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EE+ V GL+ +MRCG P+GKE A+A LL+LC 
Sbjct  551  GEEAVAEKVAWVLGVMATETLGAESIGREESVVTGLMELMRCGRPRGKEKAIATLLQLCT  610

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
            +GG   TE+V+K PALA L + LL TGT
Sbjct  611  AGGAVVTEKVVKTPALAVLTRKLLLTGT  638



>gb|ABY58019.1| arm repeat containing protein 1 [Brassica oleracea var. viridis]
Length=663

 Score =   132 bits (331),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +E+LA +LR+G++RGKKDAV AL +L  H +NC+ ++  G V+ALVGAL
Sbjct  493  YKKTIANADGCIESLALVLRNGTVRGKKDAVYALHSLWLHPDNCSLVVKRGGVSALVGAL  552

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P GKE A+A LL+LC 
Sbjct  553  GEESVAEKVACVLGVMATESLGAESIGREETVVTGLMELMRCGRPLGKEKAIATLLQLCT  612

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
             GG   TE+V+K PALA L + LL TGT
Sbjct  613  LGGAVVTEKVVKTPALAVLTRKLLLTGT  640



>gb|KFK36322.1| hypothetical protein AALP_AA4G107600 [Arabis alpina]
Length=700

 Score =   132 bits (331),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 92/205 (45%), Positives = 133/205 (65%), Gaps = 13/205 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +IA  +G +E+ A L+++G+ RGKKD +  LFN+S H ++C RM++SG V+A+VGAL
Sbjct  506  YKIQIANANGCIESFAWLIQNGTPRGKKDVMKLLFNISIHPDSCMRMVNSGGVSAIVGAL  565

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              E VAE AA  LA + +Q +GA  +G+EE+A+ GL+ +MRCGTPKGKE A  ALL+LC 
Sbjct  566  ADEVVAERAAKVLAEVAKQSLGAETIGREESAIPGLVKLMRCGTPKGKEFAADALLQLCM  625

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGLGVGYA  140
              G     +V+KAPA+  L+  L +TG+ RA+RKA SLA + ++  +A M   G      
Sbjct  626  RSGTVVVGKVVKAPAITFLMNKLYWTGSDRAKRKANSLALLLKKSRNAGMMRSG------  679

Query  139  FAGNSATTRDTTFASDVSVQMSISV  65
                    R+ +F +DV V +SI V
Sbjct  680  -------NREESFQTDVHVPISIPV  697



>ref|XP_006296011.1| hypothetical protein CARUB_v10025155mg [Capsella rubella]
 gb|EOA28909.1| hypothetical protein CARUB_v10025155mg [Capsella rubella]
Length=700

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 129/211 (61%), Gaps = 16/211 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA  DG +E+LA L + G  RG+KDA+ AL  +    +N ++M++ G V ALVGAL
Sbjct  503  YKKRIANADGCIESLALLSQSGKPRGRKDAINALSAIWRDPDNYSQMVNLGGVFALVGAL  562

Query  499  gcegvaeeaagalal--iVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              E  A      + L  +    +GA  +G+EE+AV  LI +MRCGTP+GKENAVA LL L
Sbjct  563  ADEDEAVMERAVVVLAGVANHSLGAETIGREESAVPRLIELMRCGTPRGKENAVATLLHL  622

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTG-TkrarrkaaslaRVFQRCEHASMHYGGLGV  149
            C +GG A  E+V++APAL GL Q LL TG  +  R+  + LA +F+ CE+ +M    +G 
Sbjct  623  CINGGAAVVEKVVRAPALTGLTQKLLLTGRERAKRKATSLLALIFRECENTAM----MGS  678

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPVL  56
            G         +R+ +F + VS  +SI V VL
Sbjct  679  G---------SREGSFRTHVSPPISIPVSVL  700



>gb|KJB66867.1| hypothetical protein B456_010G161700 [Gossypium raimondii]
Length=716

 Score =   131 bits (329),  Expect = 4e-31, Method: Composition-based stats.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA+Q G +EALAGLLR G+ RGKKDAVTALFNLSTH++N ARMI+ GAV ALVGAL
Sbjct  512  YKKRIADQGGAIEALAGLLRVGTPRGKKDAVTALFNLSTHSDNYARMIEVGAVTALVGAL  571

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKG  359
            G EGVAEEAAGALALIVRQPIGA AVGKEE AVAGLI MMRCGT +G
Sbjct  572  GNEGVAEEAAGALALIVRQPIGAEAVGKEEMAVAGLITMMRCGTARG  618



>gb|AGP76183.1| ARC1 [Brassica rapa subsp. chinensis]
Length=661

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK IA  DG +EALA +LR+G++RGKKDAV A  +L  H +N + ++  G V+ALVGAL
Sbjct  491  YKKAIANADGCIEALALVLRNGTVRGKKDAVYAFHSLWLHPDNYSLVVKRGGVSALVGAL  550

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
            G E VAE+ A  L ++  + +GA ++G+EET V GL+ +MRCG P+GKE A+A LL+LC 
Sbjct  551  GEEAVAEKVAWVLGVMATETLGAESIGREETVVTGLMELMRCGRPRGKEKAIATLLQLCT  610

Query  319  SGGEAATERVLKAPALAGLLQSLLFTGT  236
            +GG   TE+V+K PALA L + LL TGT
Sbjct  611  AGGAVVTEKVVKTPALAVLTRKLLLTGT  638



>ref|XP_010509777.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=705

 Score =   129 bits (325),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 96/210 (46%), Positives = 130/210 (62%), Gaps = 17/210 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K IA  DG +E+L  LL++G  RG+KDA+ AL  +    +N ++MI+SG V ALV AL
Sbjct  507  YRKLIANADGCIESLVLLLQNGKPRGRKDAIKALSGIWRDPDNHSKMINSGGVLALVKAL  566

Query  499  gce--gvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              E   VAE A   LA++    +GA  +G+EE+AVAGLI +MRCGTP+GKENAVA LL L
Sbjct  567  ADEDEAVAERAVVVLAVVANHSLGAVTIGREESAVAGLIELMRCGTPRGKENAVATLLHL  626

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVF-QRCEHASMHYGGLGV  149
            C +GG    E+V++APAL GL + +L TGT R +RKA +L  +F   CE+ +M       
Sbjct  627  CVNGGAVVVEKVVRAPALTGLTEKVLRTGTDRGKRKATALLGLFLDGCENTAMM------  680

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPV  59
                       R+  F + VS+   ISVPV
Sbjct  681  -------RFVNREGGFETHVSLP-PISVPV  702



>ref|XP_010413765.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=708

 Score =   128 bits (321),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 97/210 (46%), Positives = 130/210 (62%), Gaps = 17/210 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA   G +E+L  L ++G  RG+KDA+ AL  +    +N ++MI+SG V ALV AL
Sbjct  510  YKKRIANAVGCIESLVLLSQNGKPRGRKDAINALSGIWRDPDNHSKMINSGGVLALVKAL  569

Query  499  --gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E VAE A   LA++    +GA  +G+EE+A+AGLI +MRCGTP+GKENAVA LL L
Sbjct  570  VDEDEAVAERAVVVLAVVANNSLGAETIGREESAMAGLIELMRCGTPRGKENAVATLLHL  629

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVF-QRCEHASMHYGGLGV  149
            C +GG    E+V++APAL GL Q++L TGT R RR A SL  +F   CE+ +M   G   
Sbjct  630  CVNGGAVVVEKVVRAPALTGLTQNVLRTGTDRGRRNATSLLGLFLNGCENTAMMRSG---  686

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPV  59
                       R+ +  + VS+   ISVPV
Sbjct  687  ----------NREGSLETHVSLP-PISVPV  705



>ref|XP_010473845.1| PREDICTED: U-box domain-containing protein 17-like [Camelina 
sativa]
Length=584

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 124/210 (59%), Gaps = 17/210 (8%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKKRIA   G +E+L  L ++G  RG+KDA+ AL  +    +N ++MI+S  V ALV AL
Sbjct  386  YKKRIANAVGCIESLVLLSQNGKPRGRKDAINALSGIWRDPDNHSKMINSVGVLALVKAL  445

Query  499  gcegvaeeaagalaliV--RQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +  A      + L V     +GA  +G+EE+AVAGLI +MRCGTP+GKENAVA LL L
Sbjct  446  ADKDEAVAERAVVVLAVVANNSLGAETIGREESAVAGLIELMRCGTPRGKENAVATLLHL  505

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQR-CEHASMHYGGLGV  149
            C +GG    E+V++AP L GL Q++L TGT R RR A SL  +F   CE+ +M   G   
Sbjct  506  CVNGGAVVVEKVVRAPDLTGLTQNVLRTGTDRGRRNATSLLGLFLNGCENTAMMRSG---  562

Query  148  GYAFAGNSATTRDTTFASDVSVQMSISVPV  59
                       R+  F + VS+   ISVPV
Sbjct  563  ----------NREGGFETHVSLP-PISVPV  581



>dbj|BAJ96993.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=651

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YKK I  + G +E LA +L+ G+ RG+KDAV ALFNLSTH E+ ARM++S AV AL+ +L
Sbjct  517  YKKMIMNEPGALEKLACMLKKGTPRGRKDAVMALFNLSTHAESSARMLESSAVVALIESL  576

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              + V+EEAAGALAL+++QP     VG  ET ++ L+G+MR GTPKGKENAV+AL E+CR
Sbjct  577  RNDTVSEEAAGALALLMKQPSVVHHVGSSETVISSLVGLMRRGTPKGKENAVSALYEICR  636

Query  319  SGGEAATERV  290
             GG     RV
Sbjct  637  RGGSTLVRRV  646



>gb|AES79080.2| raffinose synthase or seed inhibition protein Sip1 [Medicago 
truncatula]
Length=379

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  388  GMMRCGTPKGKENAVAALLELCRSGGEAATERVLKAPALAGLLQSLLFTGT  236
            GMMRCGTP GKENAVAALLELCRSGG AATERV+KAPA+AGLLQ+LLFTGT
Sbjct  328  GMMRCGTPMGKENAVAALLELCRSGGSAATERVVKAPAIAGLLQTLLFTGT  378



>ref|XP_003622862.1| Q protein [Medicago truncatula]
Length=417

 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = -2

Query  388  GMMRCGTPKGKENAVAALLELCRSGGEAATERVLKAPALAGLLQSLLFTGT  236
            GMMRCGTP GKENAVAALLELCRSGG AATERV+KAPA+AGLLQ+LLFTGT
Sbjct  366  GMMRCGTPMGKENAVAALLELCRSGGSAATERVVKAPAIAGLLQTLLFTGT  416



>ref|NP_001168190.1| uncharacterized protein LOC100381946 [Zea mays]
 gb|ACN27392.1| unknown [Zea mays]
Length=166

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 108/165 (65%), Gaps = 4/165 (2%)
 Frame = -2

Query  541  MIDSGAVNALvgalgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPK  362
            M++S AV +L+ +L  + V+EEAAGALAL+++QP     VG  ET +  L+G+MR GTPK
Sbjct  1    MLESSAVVSLIESLRNDTVSEEAAGALALLMKQPSIVHLVGSSETVITSLVGLMRRGTPK  60

Query  361  GKENAVAALLELCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCE  182
            GKENAV+AL E+CR GG    +RV + P L  ++Q++  TGTKRA++KA+ + ++ QR +
Sbjct  61   GKENAVSALYEICRRGGSTLAQRVARIPGLNTVMQNITLTGTKRAKKKASLIVKMCQRSQ  120

Query  181  HASMHYGGLG---VGYAFAGNSATTRDTTFAS-DVSVQMSISVPV  59
              S    G     V ++  GNS   R  +F S ++S  +SISVPV
Sbjct  121  MPSALALGSTLAVVDHSLVGNSRLRRAPSFGSGELSNPVSISVPV  165



>ref|XP_008811691.1| PREDICTED: U-box domain-containing protein 13-like [Phoenix dactylifera]
Length=691

 Score = 89.7 bits (221),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 93/166 (56%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I  + G +  L GLLR+G+  GK+DA TAL+NL+ ++ N A ++ +GAV  LV  L 
Sbjct  517  KVAIGARSGAIAGLVGLLREGTAPGKRDAATALYNLAVYSANKAGVVAAGAVPLLVDLLT  576

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                         L +      G   +G     V  L+ ++R G+PKGKEN+++ LL LC
Sbjct  577  DGNAGVTDDVLALLALLCGCDEGMKEIGDSRLVVPILVDLLRFGSPKGKENSISVLLGLC  636

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            R GGE   +R+L  P     LQSL+ TG+ +ARRKA +L R+  RC
Sbjct  637  RDGGEEMGKRLLMNPRSVPSLQSLVATGSPKARRKAQALLRLLNRC  682


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 68/142 (48%), Gaps = 4/142 (3%)
 Frame = -2

Query  673  KRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgc  494
            +RI  + G +  L  +L     R ++DA+TALFNLS    N   ++ +GA++A++  L  
Sbjct  434  RRIIAEAGAIPFLVTMLGSRDPRTQEDAITALFNLSILDSNKILIMAAGAIDAIITVLRT  493

Query  493  egvaeeaagalaliVRQPI---GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                E    A A I    +      A+G    A+AGL+G++R GT  GK +A  AL  L 
Sbjct  494  GAAMEARKNAAATIFSLSMMDECKVAIGARSGAIAGLVGLLREGTAPGKRDAATALYNLA  553

Query  322  -RSGGEAATERVLKAPALAGLL  260
              S  +A        P L  LL
Sbjct  554  VYSANKAGVVAAGAVPLLVDLL  575



>ref|XP_010907873.1| PREDICTED: U-box domain-containing protein 13-like [Elaeis guineensis]
Length=691

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 65/167 (39%), Positives = 93/167 (56%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK  I  + G +  L GLLR+G+  GK+DA TAL NL+ ++ N A ++ +GAV  LV  L
Sbjct  516  YKVVIGARPGAIAGLVGLLREGTAAGKRDAATALHNLAVYSANRAGVLAAGAVPVLVDLL  575

Query  499  gcegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +           L +      G   +G     V  L+ ++R G+PKGKEN+++ LL L
Sbjct  576  TDDKAGVTDDVLALLALLCGCEEGMKEIGDSRLVVPILVDLLRFGSPKGKENSISVLLGL  635

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            CR GGE   +R+L  P     LQSL+  G+ +ARRKA +L R+  RC
Sbjct  636  CRDGGEEMGKRLLMNPRSFPSLQSLVAAGSPKARRKAEALLRLLNRC  682


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 46/142 (32%), Positives = 65/142 (46%), Gaps = 4/142 (3%)
 Frame = -2

Query  673  KRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgc  494
            +RI  + G +  L  LL     R ++D VTALFNLS    N   ++ +GA++A++  L  
Sbjct  434  RRIIAEAGAIPFLVTLLVSPDSRTQEDVVTALFNLSILGNNKTLIMAAGAIDAIITVLQK  493

Query  493  egvaeeaagalaliVRQPI---GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                E    A A I    +       +G    A+AGL+G++R GT  GK +A  AL  L 
Sbjct  494  GTAMEARENAAATIFSLSMVDEYKVVIGARPGAIAGLVGLLREGTAAGKRDAATALHNLA  553

Query  322  -RSGGEAATERVLKAPALAGLL  260
              S   A        P L  LL
Sbjct  554  VYSANRAGVLAAGAVPVLVDLL  575



>ref|XP_001760681.1| predicted protein [Physcomitrella patens]
 gb|EDQ74420.1| predicted protein [Physcomitrella patens]
Length=686

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 105/175 (60%), Gaps = 4/175 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLR-GKKDAVTALFNLSTHTENCARMIDSGAVNALvga  503
            YK  I ++   + AL  LLRDG+ R GKKDA +ALFNL+ +  N + +++SGAV  LV  
Sbjct  493  YKIVIGKRPAAIPALVALLRDGTPRRGKKDAASALFNLAVYHGNKSSIVESGAVTILVSL  552

Query  502  --lgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                  G+A++A   LAL+     G  A+  E +A+  L+ M+R GTPKG+ENA+A LL 
Sbjct  553  LGEEENGIADDALMVLALVAGSTEGLTAIA-EASAIPILVRMLRVGTPKGRENAIAVLLA  611

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHY  164
            LCR+GGE     V++       L SLL  GT RA+RKA+SL ++  + E    H+
Sbjct  612  LCRNGGERIISAVMQVNTAVPSLYSLLTMGTPRAKRKASSLLKLLHKREPVDRHH  666



>ref|XP_009345217.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=690

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 68/177 (38%), Positives = 94/177 (53%), Gaps = 6/177 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I ++   + AL GLL++G+  GKKDA  ALFNL+ +  N   ++ +GAV  L+  L 
Sbjct  516  KVTIGKRPRAIPALVGLLKEGTPAGKKDAAIALFNLALYNANKVSVVFAGAVPLLIELLM  575

Query  496  cegvaeeaagalaliVRQPIGAA----AVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
             +           L   Q +G +     +GK    V  LI ++R G+PKGKENA+  LL 
Sbjct  576  DDKAGITDDALALLA--QILGCSEGREEIGKSRILVPILIDLLRFGSPKGKENAITLLLG  633

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGG  158
            LC+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC   S H  G
Sbjct  634  LCKDGGEEVVRRLLMNPRSIPSLQSLAADGSLKARRKADTLLRLLNRCCFQSHHQIG  690



>ref|XP_001753758.1| predicted protein [Physcomitrella patens]
 gb|EDQ81510.1| predicted protein [Physcomitrella patens]
Length=698

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 91/151 (60%), Gaps = 4/151 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLR-GKKDAVTALFNLSTHTENCARMIDSGAVNALvga  503
            YK  I  +   + AL  LLRDG+ R GKKDA +ALFNL+ +  N + +++SGAV  LV  
Sbjct  506  YKIAIGRRPAAIPALVALLRDGTPRRGKKDAASALFNLAVYHGNKSAIVESGAVTILVSL  565

Query  502  lgceg--vaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
            LG E   +A++A   LAL+     G  A+  E +A+  L+ M+R GTPKG+ENA+A LL 
Sbjct  566  LGEEEGGIADDALMVLALVAGSTEGLTAIA-EASAIPILVRMLRVGTPKGRENAIAVLLA  624

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGT  236
            LCR+GGE     V++       L SLL  GT
Sbjct  625  LCRNGGERIVSAVMQVNTAVPSLYSLLTMGT  655



>ref|XP_008374218.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
 ref|XP_008354158.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=692

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 63/166 (38%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I ++   + AL GLL++G+  GKKDA  ALFNL+ +  N   ++ +GAV  L+  L 
Sbjct  518  KITIGKRPRAIPALVGLLKEGTPAGKKDAAVALFNLALYNANKVSIVFAGAVPLLIELLM  577

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L        G   +GK    V  LI ++R G+PKGKENA+  LL LC
Sbjct  578  DDKAGITDDALALLAQXLGCSEGLQEIGKSRILVPILIDLLRFGSPKGKENAITLLLGLC  637

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQSL   G+ +ARRKA ++ R+  RC
Sbjct  638  KDGGEEVARRLLMNPRSIPSLQSLAADGSLKARRKADAVLRLLNRC  683



>gb|EPS67526.1| hypothetical protein M569_07248, partial [Genlisea aurea]
Length=692

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+ +I  + G V+AL  LL+ GS+RGKKDA TALFNLS H EN AR++ SGAV  LVG L
Sbjct  522  YRIKIG-RSGAVKALVDLLQFGSVRGKKDAATALFNLSIHHENKARIVQSGAVKPLVGFL  580

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +   P G +AV + E  +  L+ ++  GTP+GKENA A LL+LC
Sbjct  581  DPGTEMVDKAVALLANLSAIPEGCSAVAR-EGGIPLLVEIVEIGTPRGKENAAAILLQLC  639

Query  322  RSGGEAATERVLKA--PALAGLLQS  254
             +  +     +++   P L  L QS
Sbjct  640  FNSPKYCQTILVEGAVPPLVALSQS  664



>ref|XP_007008909.1| Plant U-box 13 [Theobroma cacao]
 gb|EOY17719.1| Plant U-box 13 [Theobroma cacao]
Length=755

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 67/167 (40%), Positives = 94/167 (56%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +K  I  +   + AL GLLR+G+   K+DA TA+FNL+ +  N A +I +G V  L+  L
Sbjct  580  FKMAIGARPTTILALVGLLREGTTVAKRDAATAIFNLALYNANKASIIAAGTVPLLIELL  639

Query  499  gcegvaee--aagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +       A G LAL++  P G  A+ K    V  LI ++R G+ KGKEN++  LL L
Sbjct  640  MDDKAGVTDDALGVLALLLSCPQGLEAIKKSRVLVPLLIDLLRFGSAKGKENSITLLLGL  699

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            C+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  700  CKDGGEEVARRLLINPRSIPSLQSLAADGSSKARRKADALLRLLNRC  746



>ref|XP_008233788.1| PREDICTED: U-box domain-containing protein 13-like [Prunus mume]
Length=690

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I ++   + AL GLL++G+  GKKDA  ALFNL+ +  N   ++ +GAV  L+  L 
Sbjct  516  KVTIGKRPRAIPALVGLLKEGTPAGKKDAAIALFNLAVYNANKVSVVFAGAVPLLIELLM  575

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   +GK    V  LI ++R G+PKGKEN++  LL LC
Sbjct  576  DDKAGITDDALAVLALLLGCSEGLEEIGKSRILVPILIDLLRFGSPKGKENSITLLLGLC  635

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQ L   G+ +ARRKA +L R+  RC
Sbjct  636  KDGGEEVARRLLMNPRSIPSLQGLAADGSLKARRKADALLRLLNRC  681


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 3/119 (3%)
 Frame = -2

Query  673  KRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgc  494
            +RI  + G +  L  LLR    R +++AVTAL NLS +  N   ++ +GA++++V  L  
Sbjct  433  RRIIAEAGAIPFLVTLLRSHEPRIQENAVTALLNLSIYNNNKILIMAAGAIDSIVNVLES  492

Query  493  egvaeeaagalaliVRQPI---GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E    A A I    +       +GK   A+  L+G+++ GTP GK++A  AL  L
Sbjct  493  GNTMEARENAAAAIFSLSMIDDCKVTIGKRPRAIPALVGLLKEGTPAGKKDAAIALFNL  551



>ref|XP_010262331.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Nelumbo nucifera]
Length=790

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 63/146 (43%), Positives = 84/146 (58%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LLR G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L
Sbjct  618  YKVKIG-RSGAVKALVDLLRSGTLRGKKDAATALFNLSISHENKARIVRAGAVKYLVEML  676

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   E A AL   +   P G +A+G+ E  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  677  DPATGMLEKAVALLANLSTIPEGCSAIGR-EGGIPPLVEILETGSQRGKENAASILLQLC  735

Query  322  RSGGEAATERVLK---APALAGLLQS  254
             +     T  VL+    P L  L QS
Sbjct  736  INSRRFCT-LVLQEGAVPPLVALSQS  760



>ref|XP_002272996.1| PREDICTED: U-box domain-containing protein 13 [Vitis vinifera]
Length=688

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 63/166 (38%), Positives = 87/166 (52%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I      + AL  LLR+G+  GK+DA TALFNL  ++ N    + +GAV  L+  L 
Sbjct  514  KVTIGAHPRAMPALVALLREGTSAGKRDAATALFNLVVYSANKGSAVVAGAVPLLIELLM  573

Query  496  cegvaeeaagalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +    P G   + K    V  LI ++R G+PKGKEN++  LL LC
Sbjct  574  DDKAGITDDALAVLALLLGCPDGLEEIRKSRILVPLLIDLLRFGSPKGKENSITLLLGLC  633

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQSL+  G+ +ARRKA +L R+  RC
Sbjct  634  KDGGEEVARRLLLNPRSIPSLQSLVADGSLKARRKADALLRLLNRC  679



>ref|XP_008369280.1| PREDICTED: U-box domain-containing protein 13-like [Malus domestica]
Length=687

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 64/168 (38%), Positives = 89/168 (53%), Gaps = 6/168 (4%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I +    + AL GLL++G+  GKKDA  ALFNL+ +  N    + +GAV  L+  L 
Sbjct  513  KVTIGKHPRAILALVGLLKEGTPAGKKDAAIALFNLAFYNANKVSAVFAGAVPLLIELLM  572

Query  496  cegvaeeaagalaliVRQPIGAA----AVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
             +           L   Q +G +     +GK    V  LI ++R G+PKGKEN++  LL 
Sbjct  573  DDKAGITDDALAVLA--QLLGCSEGMEEIGKSRILVPILIDLLRFGSPKGKENSITLLLG  630

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            LC+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  631  LCKDGGEEVARRLLMNPRSIPSLQSLAADGSLKARRKADALLRLLNRC  678



>ref|XP_007220150.1| hypothetical protein PRUPE_ppa019674mg [Prunus persica]
 gb|EMJ21349.1| hypothetical protein PRUPE_ppa019674mg [Prunus persica]
Length=690

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I ++   + AL GLL++G+  GKKDA  ALFNL+ +  N   ++ +GAV  L+  L 
Sbjct  516  KVTIGKRPRAIPALVGLLKEGTPAGKKDAAIALFNLAVYNANKVSVVFAGAVPLLIELLM  575

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   +GK    V  LI ++R G+PKGKEN++  LL LC
Sbjct  576  DDKAGITDEALAVLALLLGCSEGLEEIGKSRILVPILIDLLRFGSPKGKENSITLLLGLC  635

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQ L   G+ +ARRKA +L R+  RC
Sbjct  636  KDGGEEVARRLLMNPRSIPSLQGLGADGSLKARRKADALLRLLNRC  681


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 39/119 (33%), Positives = 62/119 (52%), Gaps = 3/119 (3%)
 Frame = -2

Query  673  KRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgc  494
            +RI  + G +  L  LLR    R +++AVTAL NLS +  N   ++ +GA++++V  L  
Sbjct  433  RRIIAEAGAIPFLVTLLRSHEPRIQENAVTALLNLSIYNNNKILIMAAGAIDSIVNVLES  492

Query  493  egvaeeaagalaliVRQPI---GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E    A A I    +       +GK   A+  L+G+++ GTP GK++A  AL  L
Sbjct  493  GNTMEARENAAAAIFSLSMIDDCKVTIGKRPRAIPALVGLLKEGTPAGKKDAAIALFNL  551



>ref|XP_011084885.1| PREDICTED: U-box domain-containing protein 13-like [Sesamum indicum]
Length=685

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 63/167 (38%), Positives = 88/167 (53%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK  I      + AL GLL +G+  GK+DA TALFNL+    N A++I +GA+  L+  L
Sbjct  510  YKVIIGAHPRAIPALVGLLGEGTPAGKRDAATALFNLAVLNVNRAKVILAGAIPLLINLL  569

Query  499  gcegvaeeaagalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +           L +    P G   + K    +  LI ++R G+ KGKEN++  LL L
Sbjct  570  TDDKAGVTDDALAVLALLLGCPEGLEEIRKSRNLIPLLIDLLRFGSSKGKENSITLLLGL  629

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            C+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  630  CKDGGEDVARRLLMNPRSVPSLQSLTTDGSPKARRKADALLRILNRC  676



>ref|XP_010262328.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010262329.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010262330.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Nelumbo nucifera]
Length=793

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LLR G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L
Sbjct  618  YKVKIG-RSGAVKALVDLLRSGTLRGKKDAATALFNLSISHENKARIVRAGAVKYLVEML  676

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   E A AL   +   P G +A+G+ E  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  677  DPATGMLEKAVALLANLSTIPEGCSAIGR-EGGIPPLVEILETGSQRGKENAASILLQLC  735



>ref|XP_004308949.1| PREDICTED: U-box domain-containing protein 13-like [Fragaria 
vesca subsp. vesca]
Length=692

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I ++   + AL GLL++G+  GKKDA  ALFNL+    N   ++ +GAV  L+  L 
Sbjct  517  KVTIGKRPRAIPALVGLLKEGTPAGKKDAAVALFNLAVCPANKVSLVVAGAVPMLIDLLM  576

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   +GK    V  LI ++R G+PK KEN++  LL LC
Sbjct  577  DDKAGITDDALAVLALLLGCSEGCEEIGKSRILVPILIDLLRFGSPKEKENSITLLLGLC  636

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQSL+  G+ +ARRKA +L R+  RC
Sbjct  637  KDGGEEVARRLLMNPRSIPSLQSLVSDGSLKARRKADALLRLLNRC  682


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 38/119 (32%), Positives = 60/119 (50%), Gaps = 3/119 (3%)
 Frame = -2

Query  673  KRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgc  494
            +RI  + G +  L  LLR    R +++AVTAL NLS    N   ++ +GA++ ++  L  
Sbjct  434  RRIIAEAGAIPFLVTLLRSHEPRIQENAVTALLNLSIFNNNKILIMAAGAIDNIIDVLES  493

Query  493  egvaeeaagalaliVRQPI---GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
                E    A A I    +       +GK   A+  L+G+++ GTP GK++A  AL  L
Sbjct  494  GNTMEARENAAAAIFSLSMIDDCKVTIGKRPRAIPALVGLLKEGTPAGKKDAAVALFNL  552



>ref|XP_002316197.1| hypothetical protein POPTR_0010s19330g [Populus trichocarpa]
 gb|EEF02368.1| hypothetical protein POPTR_0010s19330g [Populus trichocarpa]
Length=688

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I  +     AL GLLR+G+  GKKDA +ALFNLS +  N A ++ +GAV  LV  L 
Sbjct  514  KVTIGTRPRAFSALVGLLREGTSAGKKDAASALFNLSVYEANKASVVVAGAVPLLVEMLM  573

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   + K +  V  LI ++R G+ KGKEN++  LL LC
Sbjct  574  DDKAGITDDALALLALLLGCSEGLEEIRKSKVLVPLLIDLLRFGSTKGKENSITLLLGLC  633

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  634  KDGGEEVARRLLINPRSIPSLQSLSADGSLKARRKADALLRLLNRC  679



>ref|XP_006486527.1| PREDICTED: U-box domain-containing protein 13-like [Citrus sinensis]
Length=686

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 6/168 (4%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAV----NALv  509
            K  I  +   + AL GLLR+G+  GKKDA TALFNL+ +  N A ++ +GAV      L+
Sbjct  512  KVMIGGRPRAIPALVGLLREGTTAGKKDAATALFNLAVYNANKASVVVAGAVPLLIELLM  571

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                       A  AL L  R+  G   + K    V  LI ++R G+ KGKEN++  LL 
Sbjct  572  DDKAGITDDALAVLALLLGCRE--GLEEIRKCRVLVPLLIDLLRFGSAKGKENSITLLLG  629

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            LC+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  630  LCKDGGEEVARRLLINPRSIPSLQSLTTDGSLKARRKADALLRLLNRC  677



>ref|XP_006435778.1| hypothetical protein CICLE_v10033932mg [Citrus clementina]
 gb|ESR49018.1| hypothetical protein CICLE_v10033932mg [Citrus clementina]
Length=687

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 6/168 (4%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAV----NALv  509
            K  I  +   + AL GLLR+G+  GKKDA TALFNL+ +  N A ++ +GAV      L+
Sbjct  513  KVMIGGRPRAIPALVGLLREGTTAGKKDAATALFNLAVYNANKASVVVAGAVPLLIELLM  572

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                       A  AL L  R+  G   + K    V  LI ++R G+ KGKEN++  LL 
Sbjct  573  DDKAGITDDALAVLALLLGCRE--GLEEIRKCRVLVPLLIDLLRFGSAKGKENSITLLLG  630

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            LC+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  631  LCKDGGEEVARRLLINPRSIPSLQSLTTDGSLKARRKADALLRLLNRC  678



>ref|XP_011035905.1| PREDICTED: U-box domain-containing protein 17-like [Populus euphratica]
Length=688

 Score = 79.7 bits (195),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 65/166 (39%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I  +     AL GLLR+G+  GKKDA +ALFNLS +  N A ++ +GAV  LV  L 
Sbjct  514  KVTIGTRPRAFSALVGLLREGTSAGKKDAASALFNLSVYEANKASVVVAGAVPLLVEMLM  573

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   + K +  V  LI ++R G+ KGKEN++  LL LC
Sbjct  574  DDKAGITDDALALLALLLGCSEGLEEIRKSKVLVPLLIDLLRFGSTKGKENSITLLLGLC  633

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            + GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  634  KDGGEEVARRLLINPRSIPSLQSLSADGSLKARRKADALLRLLNRC  679



>gb|KDO68908.1| hypothetical protein CISIN_1g046850mg [Citrus sinensis]
Length=686

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 67/168 (40%), Positives = 90/168 (54%), Gaps = 6/168 (4%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAV----NALv  509
            K  I  +   + AL GLLR+G+  GKKDA TALFNL+ +  N A ++ +GAV      L+
Sbjct  512  KVMIGGRPRAIPALVGLLREGTTAGKKDAATALFNLAVYNANKASVVVAGAVPLLIELLM  571

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                       A  AL L  R+  G   + K    V  LI ++R G+ KGKEN++  LL 
Sbjct  572  DDKAGITDDALAVLALLLGCRE--GLEEIRKCRVLVPLLIDLLRFGSAKGKENSITLLLG  629

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            LC+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  630  LCKDGGEEVARRLLINPRSIPSLQSLTTDGSLKARRKADALLRLLNRC  677



>ref|XP_010105430.1| U-box domain-containing protein 13 [Morus notabilis]
 gb|EXC04705.1| U-box domain-containing protein 13 [Morus notabilis]
Length=693

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 66/176 (38%), Positives = 94/176 (53%), Gaps = 2/176 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I  +   + AL GLL++G+  GKKDA TALFNL+ +  N   ++ +GA+  LV  L 
Sbjct  518  KVAIGARPRAIPALVGLLKEGTPVGKKDAATALFNLAVYNANKVGVVVAGAIPLLVDLLM  577

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +  A        L +      G   + K +  V  L+ ++R G+PKGK+N++  LL LC
Sbjct  578  DDKAAITDDALAVLALLLGCSEGLEEIRKSKVLVPILVDLLRFGSPKGKDNSITLLLGLC  637

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGGL  155
            + GGE    R+L  P     LQSL   G+ RARRKA +L R+  RC   S +  GL
Sbjct  638  KDGGEEVVRRLLINPRSIPSLQSLAADGSLRARRKADALLRLLSRCCFQSHNQVGL  693



>emb|CBI25448.3| unnamed protein product [Vitis vinifera]
Length=518

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 85/157 (54%), Gaps = 2/157 (1%)
 Frame = -2

Query  649  GVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvaeeaa  470
             + AL  LLR+G+  GK+DA TALFNL  ++ N    + +GAV  L+  L  +       
Sbjct  353  AMPALVALLREGTSAGKRDAATALFNLVVYSANKGSAVVAGAVPLLIELLMDDKAGITDD  412

Query  469  galaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAATE  296
                L +    P G   + K    V  LI ++R G+PKGKEN++  LL LC+ GGE    
Sbjct  413  ALAVLALLLGCPDGLEEIRKSRILVPLLIDLLRFGSPKGKENSITLLLGLCKDGGEEVAR  472

Query  295  RVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            R+L  P     LQSL+  G+ +ARRKA +L R+  RC
Sbjct  473  RLLLNPRSIPSLQSLVADGSLKARRKADALLRLLNRC  509



>ref|XP_006393931.1| hypothetical protein EUTSA_v10003745mg [Eutrema salsugineum]
 gb|ESQ31217.1| hypothetical protein EUTSA_v10003745mg [Eutrema salsugineum]
Length=689

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 57/119 (48%), Positives = 73/119 (61%), Gaps = 3/119 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I E  G +E L  LL  GSLRGKKDA TALFNLS H EN  R+I++GAV  LV  + 
Sbjct  521  KTKIGEA-GAIEPLVDLLGYGSLRGKKDAATALFNLSIHHENKTRVIEAGAVRYLVELMD  579

Query  496  -cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
               G+ E A   LA +     G  A+G EE  +  L+ ++  G+ +GKENA AALL+LC
Sbjct  580  PAAGMVERAVVVLANLATTKEGKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQLC  637



>ref|XP_001755474.1| predicted protein [Physcomitrella patens]
 gb|EDQ79534.1| predicted protein [Physcomitrella patens]
Length=656

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 4/151 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLR-GKKDAVTALFNLSTHTENCARMIDSGAVNALvga  503
            YK  I ++   +  L  LLRDG+ R GKKDA +ALFNL+ +  N + +++SGAV  LV  
Sbjct  465  YKIVIGKRPDAISGLVTLLRDGTPRRGKKDAASALFNLAVYHGNKSPIVNSGAVAVLVSL  524

Query  502  lgcegvaeeaagalal--iVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
            L  +         + L  +     G  A+  E  A+  L+ ++R GTPKG+ENA+A LL 
Sbjct  525  LSEDEAGVADDALMVLGLVAGSTEGLTAIA-EANAIPILVRLLRVGTPKGRENAIAVLLV  583

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGT  236
            LCRSGGE      ++       L SLL  GT
Sbjct  584  LCRSGGEKMVTAAIECSTAVSSLCSLLTMGT  614



>dbj|BAB09019.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAP16467.1| hypothetical protein [Cloning vector pTACAtg1]
Length=698

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I E  G +E L  LL  GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  534  YKTEIGEA-GAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  592

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          A    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  593  DPAFGMVEKAVVVLANLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  649

Query  328  LC  323
            LC
Sbjct  650  LC  651



>dbj|BAF01345.1| hypothetical proteins [Arabidopsis thaliana]
Length=189

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK  I E  G +E L  LL  GSL GKKDA TALFNLS H EN  ++I++GAV  LV  +
Sbjct  20   YKTEIGEA-GAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  78

Query  499  gce---gvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          A    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  79   DPAFGMVEKAVVVLANLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  135

Query  328  LC  323
            LC
Sbjct  136  LC  137



>ref|NP_201535.3| ARM repeat superfamily protein [Arabidopsis thaliana]
 sp|Q5XEZ8.1|PUB2_ARATH RecName: Full=U-box domain-containing protein 2; AltName: Full=Plant 
U-box protein 2 [Arabidopsis thaliana]
 gb|AAU94381.1| At5g67340 [Arabidopsis thaliana]
 gb|AAV59272.1| At5g67340 [Arabidopsis thaliana]
 gb|AED98330.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=707

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I E  G +E L  LL  GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  538  YKTEIGEA-GAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  596

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          A    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  597  DPAFGMVEKAVVVLANLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  653

Query  328  LC  323
            LC
Sbjct  654  LC  655



>ref|XP_010444662.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Camelina sativa]
 ref|XP_010444663.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Camelina sativa]
Length=717

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I +  G +E L  LL +GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  549  YKTEIGKA-GAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  607

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  608  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVDVVELGSARGKENATAALLQ  664

Query  328  LC  323
            LC
Sbjct  665  LC  666



>ref|XP_002866707.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH42966.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=710

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I E  G +E L  LL  GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  541  YKTEIGEA-GAIEPLVDLLGSGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  599

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          A    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  600  DPAFGMVEKAVVVLANLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  656

Query  328  LC  323
            LC
Sbjct  657  LC  658



>tpg|DAA33939.1| TPA_exp: E3 ubiquitin ligase [Medicago truncatula]
 gb|AES99632.2| ubiquitin-protein ligase, PUB17 [Medicago truncatula]
Length=694

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 63/166 (38%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I      + AL GLL++G++ GK+DA TALFNL+ +  N   ++ SGAV  LV  L 
Sbjct  521  KVQIGASSRAIPALVGLLKEGTIIGKRDAATALFNLAVYNPNKLSIVKSGAVTLLVELLM  580

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L V      G   +   ++ V  LI ++R G+ KGKEN++  LL LC
Sbjct  581  DDKAGITDDSLAVLAVLLGCSEGLEEIKNSKSLVPLLIDLLRFGSVKGKENSITLLLGLC  640

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            +  GE    R+L  P     LQSL   G+ RARRKA +L R+  RC
Sbjct  641  KEEGELVAMRLLANPRSIPSLQSLAADGSLRARRKADALLRLLNRC  686



>ref|XP_010444664.1| PREDICTED: U-box domain-containing protein 2-like isoform X2 
[Camelina sativa]
Length=713

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I +  G +E L  LL +GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  545  YKTEIGKA-GAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  603

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  604  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVDVVELGSARGKENATAALLQ  660

Query  328  LC  323
            LC
Sbjct  661  LC  662



>ref|XP_008802944.1| PREDICTED: U-box domain-containing protein 4-like [Phoenix dactylifera]
Length=879

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 56/139 (40%), Positives = 79/139 (57%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLST  EN AR++ +GAVN LV  +       
Sbjct  716  RSGAIRPLVELLGNGTPRGKKDATTALFNLSTFHENKARIVQAGAVNHLVELMDPAAGMV  775

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +     G  A+G  +  +  L+ ++  G+ +GKENA AALL+LC++     
Sbjct  776  DKAVAVLANLATIQEGRTAIGHSD-GILPLVEVVELGSARGKENAAAALLQLCQNSNRFC  834

Query  301  TERVLK---APALAGLLQS  254
            T RVL+    P L  L QS
Sbjct  835  T-RVLQQGAVPPLVALSQS  852



>ref|XP_010464193.1| PREDICTED: U-box domain-containing protein 2 isoform X1 [Camelina 
sativa]
Length=716

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I +  G +E L  LL +GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  548  YKTEIGKA-GAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  606

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  607  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  663

Query  328  LC  323
            LC
Sbjct  664  LC  665



>ref|XP_010464200.1| PREDICTED: U-box domain-containing protein 2 isoform X2 [Camelina 
sativa]
Length=712

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I +  G +E L  LL +GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  544  YKTEIGKA-GAIEPLVDLLANGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  602

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  603  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  659

Query  328  LC  323
            LC
Sbjct  660  LC  661



>gb|KJB48642.1| hypothetical protein B456_008G079700 [Gossypium raimondii]
 gb|KJB48643.1| hypothetical protein B456_008G079700 [Gossypium raimondii]
 gb|KJB48644.1| hypothetical protein B456_008G079700 [Gossypium raimondii]
Length=835

 Score = 77.4 bits (189),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 65/167 (39%), Positives = 95/167 (57%), Gaps = 4/167 (2%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  672  RSGAIKPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVRHLVDLMDPAAGMV  731

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E+ +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  732  DKAVAVLANLATIPEGRNAIG-QESGIPVLVEVVELGSARGKENAAAALLQLCTTSGRFC  790

Query  301  TERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG  161
               VL+  A+  L+ +L  TGT RA+ KA +L   F+   H S   G
Sbjct  791  N-MVLQEGAVPPLV-ALSQTGTPRAKEKAQALLSYFRNQRHGSAGRG  835



>ref|XP_009369205.1| PREDICTED: U-box domain-containing protein 13-like [Pyrus x bretschneideri]
Length=687

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 62/168 (37%), Positives = 89/168 (53%), Gaps = 6/168 (4%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I +    + AL GLL++G+  GKKDA  ALFNL+ +  N   ++ +GAV  L+  L 
Sbjct  513  KVTIGKHHRAIPALVGLLKEGTPAGKKDAAIALFNLAVYNANKVSVVFAGAVPLLIELLM  572

Query  496  cegvaeeaagalaliVRQPIGAA----AVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
             +         + L   Q +G +     +GK    V  LI ++R G+PKGKEN++  LL 
Sbjct  573  DDKAGITDDALVVLA--QLLGCSEGMEEIGKSRILVPILIDLLRFGSPKGKENSITLLLG  630

Query  328  LCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            LC+ GGE     +L        LQSL   G+ +ARRKA +L R+  RC
Sbjct  631  LCKDGGEEVARHLLMNQRSIPSLQSLAADGSLKARRKADALLRLLNRC  678



>gb|KHG28018.1| U-box domain-containing 3 -like protein [Gossypium arboreum]
Length=776

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 79/144 (55%), Gaps = 3/144 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+LRG+KDA TALFNLS   EN  R++ +G V  LV  L
Sbjct  605  YKARIG-RSGAVKALVNLLGSGTLRGRKDAATALFNLSIFHENKTRIVQAGTVKYLVKFL  663

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              +    + A AL   +           +E  +  LI ++  G+P+GKENA +ALL+LC 
Sbjct  664  DPDSGMVDKAVALLSNLSTITEGRLAIVQEGGIPVLIEVVESGSPRGKENAASALLQLCL  723

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +  +  T  + +   P+L  L QS
Sbjct  724  NSSKFCTLVLYEGAIPSLVALSQS  747



>emb|CDX81323.1| BnaC09g07340D [Brassica napus]
Length=723

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I E  G +E L  LL +GSLRGKKDA TALFNLS H EN A++I++GAV  LV  + 
Sbjct  556  KTKIGEA-GAIEPLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMD  614

Query  496  -cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
               G+ E+A   LA +     G  A+G EE  +  L+ ++  G+ +GKENA AALL+L
Sbjct  615  PAAGMVEKAVVVLANLATVKEGKVAIG-EEGGIPVLVEVVELGSARGKENATAALLQL  671



>ref|XP_009112371.1| PREDICTED: U-box domain-containing protein 2-like isoform X2 
[Brassica rapa]
Length=734

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I E  G +E L  LL +GSLRGKKDA TALFNLS H EN A++I++GAV  LV  + 
Sbjct  567  KTKIGEA-GAIEPLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMD  625

Query  496  -cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
               G+ E+A   LA +     G  A+G EE  +  L+ ++  G+ +GKENA AALL+L
Sbjct  626  PAAGMVEKAVVVLANLATVKEGKVAIG-EEGGIPVLVEVVELGSARGKENATAALLQL  682



>ref|XP_009112370.1| PREDICTED: U-box domain-containing protein 2-like isoform X1 
[Brassica rapa]
Length=739

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I E  G +E L  LL +GSLRGKKDA TALFNLS H EN A++I++GAV  LV  + 
Sbjct  572  KTKIGEA-GAIEPLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMD  630

Query  496  -cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
               G+ E+A   LA +     G  A+G EE  +  L+ ++  G+ +GKENA AALL+L
Sbjct  631  PAAGMVEKAVVVLANLATVKEGKVAIG-EEGGIPVLVEVVELGSARGKENATAALLQL  687



>ref|XP_007047436.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007047437.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao]
 ref|XP_007047438.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 ref|XP_007047439.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91593.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91594.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao]
 gb|EOX91595.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
 gb|EOX91596.1| RING/U-box superfamily protein with ARM repeat domain isoform 
1 [Theobroma cacao]
Length=834

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 80/139 (58%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  671  RSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVRHLVELMDPAAGMV  730

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC + G+  
Sbjct  731  DKAVAVLANLATIPEGRTAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTTNGKFC  789

Query  301  TERVLK---APALAGLLQS  254
            + +VL+    P L  L QS
Sbjct  790  S-KVLQEGAVPPLVALSQS  807



>gb|KHG16511.1| U-box domain-containing 3 -like protein [Gossypium arboreum]
Length=783

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 78/145 (54%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+LRGKKDA TALFNLS   EN ARM+ +GAV  LV  +
Sbjct  613  YKARIG-RSGAVKALVNLLSSGTLRGKKDAATALFNLSIFHENKARMVQAGAVKYLVQLM  671

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              +    + A AL   +            E  V  L+ ++  G+ +GKENA + LL+LC 
Sbjct  672  DPDSGMVDKAVALLSNLSTVAEGRVAIVREGGVPLLVEILESGSQRGKENAASVLLQLCL  731

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  732  NSPKFCT-LVLQEGAVPPLVALSQS  755



>gb|KJB42276.1| hypothetical protein B456_007G146800 [Gossypium raimondii]
 gb|KJB42277.1| hypothetical protein B456_007G146800 [Gossypium raimondii]
 gb|KJB42278.1| hypothetical protein B456_007G146800 [Gossypium raimondii]
Length=815

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+LRG+KDA TALFNLS   EN AR++ +G V  LV  L
Sbjct  644  YKARIG-RSGAVKALVNLLGSGTLRGRKDAATALFNLSIFHENKARIVQAGTVKYLVKFL  702

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              +    + A AL   +           +E  +  L+ ++  G+P+GKENA +ALL+LC 
Sbjct  703  DPDSGMVDKAVALLSNLSTIAEGRLAIVQEGGIPVLMEVVESGSPRGKENAASALLQLCL  762

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +  +  T  + +   P+L  L QS
Sbjct  763  NSSKFCTLVLQEGAIPSLVALSQS  786



>emb|CDY18649.1| BnaA09g07460D [Brassica napus]
Length=712

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 75/118 (64%), Gaps = 3/118 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I E  G +E L  LL +GSLRGKKDA TALFNLS H EN A++I++GAV  LV  + 
Sbjct  545  KTKIGEA-GAIEPLVELLGNGSLRGKKDAATALFNLSIHHENKAKVIEAGAVRYLVELMD  603

Query  496  -cegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
               G+ E+A   LA +     G  A+G EE  +  L+ ++  G+ +GKENA AALL+L
Sbjct  604  PAAGMVEKAVVVLANLATVKEGKVAIG-EEGGIPVLVEVVELGSARGKENATAALLQL  660



>gb|KJB48641.1| hypothetical protein B456_008G079700 [Gossypium raimondii]
Length=746

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 65/167 (39%), Positives = 95/167 (57%), Gaps = 4/167 (2%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  583  RSGAIKPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVRHLVDLMDPAAGMV  642

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E+ +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  643  DKAVAVLANLATIPEGRNAIG-QESGIPVLVEVVELGSARGKENAAAALLQLCTTSGRFC  701

Query  301  TERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG  161
               VL+  A+  L+ +L  TGT RA+ KA +L   F+   H S   G
Sbjct  702  N-MVLQEGAVPPLV-ALSQTGTPRAKEKAQALLSYFRNQRHGSAGRG  746



>ref|XP_001761829.1| predicted protein [Physcomitrella patens]
 gb|EDQ73270.1| predicted protein [Physcomitrella patens]
Length=681

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 5/152 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSL-RGKKDAVTALFNLSTHTENCARMIDSGAVNALvg-  506
            +K  I    G + +L  LLRDGS+ RGKKDAVTALFNL+ +  N A++I +GAV  LV  
Sbjct  497  FKVEIGSTFGAIPSLITLLRDGSMQRGKKDAVTALFNLAVYHGNKAKIIKAGAVPLLVVH  556

Query  505  -algcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
             +     +AE  A  L L+   P    A+     +++  + ++R G+PKG+EN  + LL 
Sbjct  557  LSDQSSSIAETCAAVLTLLATSPDAIDAI-HNAASISEFLPLLRNGSPKGRENLASILLS  615

Query  328  LCRSGGEAATERV-LKAPALAGLLQSLLFTGT  236
            +C SG +   + + L    +  +L SLL +GT
Sbjct  616  MCLSGDQKVIDDIFLHLKDIVPILHSLLLSGT  647



>gb|AGG82490.1| E3 ubiquitin ligase [Datisca glomerata]
Length=673

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 90/174 (52%), Gaps = 3/174 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK  I      +  L  LLR+G+  GK+DA  ALFNLS ++ N AR++ +GAV  L+  L
Sbjct  498  YKVVIGAHPRAIPGLVRLLREGTSAGKRDAAIALFNLSIYSANKARVVVAGAVPLLIDLL  557

Query  499  gcegvaeeaagalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +           L +      G   + K    V  LI ++R G+ KGKEN++  LL L
Sbjct  558  TDDKAGITDDALQVLSLVLGCSDGLQEIRKSRVLVPLLIDLLRFGSLKGKENSITLLLGL  617

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQR-CEHASMH  167
            C+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  R C H+  H
Sbjct  618  CKDGGEEVARRLLMNPRSIPSLQSLAADGSLKARRKADALLRLLNRCCSHSQNH  671



>ref|XP_006857297.1| hypothetical protein AMTR_s00067p00049340 [Amborella trichopoda]
 gb|ERN18764.1| hypothetical protein AMTR_s00067p00049340 [Amborella trichopoda]
Length=841

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 56/146 (38%), Positives = 83/146 (57%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALv-ga  503
            YK +I  + G +++L  LL  G+LRGKKDA TALFNLS   EN AR++ +GAV  L+   
Sbjct  669  YKVKIG-RSGAIQSLVELLNSGTLRGKKDAATALFNLSIFHENKARIVKAGAVKCLIWLM  727

Query  502  lgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                G+ +++   L+ +   P G +A+  EE  +  L+ ++  G+ +GKENA + LL LC
Sbjct  728  DLTGGMVDKSVAVLSNLATIPEGRSAIA-EEGGIPALVEVVELGSQRGKENAASTLLLLC  786

Query  322  RSGGEAATERVLK---APALAGLLQS  254
             +     T  VL+    P L  L QS
Sbjct  787  MNSNRYCT-LVLQEGAVPPLVALSQS  811



>ref|XP_006280091.1| hypothetical protein CARUB_v10025974mg [Capsella rubella]
 gb|EOA12989.1| hypothetical protein CARUB_v10025974mg [Capsella rubella]
Length=713

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 51/122 (42%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I    G +E L  LL +GSL GKKDA TALFNLS H EN  ++I++GAV     L+
Sbjct  544  YKTDIGNA-GAIEPLVDLLGNGSLSGKKDAATALFNLSIHHENKTKVIEAGAVRYLVELM  602

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  603  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  659

Query  328  LC  323
            LC
Sbjct  660  LC  661



>ref|XP_008807731.1| PREDICTED: U-box domain-containing protein 3 [Phoenix dactylifera]
Length=783

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G ++AL  LL  GSLRGKKDA TALFNLS   EN AR++ +GAV  LV  +
Sbjct  614  YKVKIG-RSGAIKALVNLLGSGSLRGKKDAATALFNLSIFHENKARIVQAGAVRYLVELM  672

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + + AL   +   P G  AV  +E  +  L+ ++  G+ +GKENA +ALL+LC
Sbjct  673  DPSTGMADKSVALLANLSTVPEGRLAV-SQEGGIPLLVEIVETGSQRGKENAASALLQLC  731



>ref|XP_002970194.1| hypothetical protein SELMODRAFT_61948, partial [Selaginella moellendorffii]
 gb|EFJ28324.1| hypothetical protein SELMODRAFT_61948, partial [Selaginella moellendorffii]
Length=352

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvaeea  473
            G ++ L  LL +GSLRG+KDA TALFNLS  +EN +R++++GAV ALV  +         
Sbjct  205  GAIQPLVDLLVNGSLRGQKDAATALFNLSVLSENKSRIVNAGAVKALVNLVRDPTSGMVD  264

Query  472  agalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                 L      P G  A+G ++  +  L+ ++  GT +GKENA AALL LC
Sbjct  265  KAVAVLANLMTCPEGRVAIG-DDGGIPALVEVVEAGTARGKENAAAALLHLC  315



>ref|XP_002978359.1| hypothetical protein SELMODRAFT_51906, partial [Selaginella moellendorffii]
 gb|EFJ20345.1| hypothetical protein SELMODRAFT_51906, partial [Selaginella moellendorffii]
Length=375

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 66/112 (59%), Gaps = 3/112 (3%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvaeea  473
            G ++ L  LL +GSLRG+KDA TALFNLS  +EN +R++++GAV ALV  +         
Sbjct  228  GAIQPLVDLLVNGSLRGQKDAATALFNLSVLSENKSRIVNAGAVKALVNLVRDPTSGMVD  287

Query  472  agalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                 L      P G  A+G ++  +  L+ ++  GT +GKENA AALL LC
Sbjct  288  KAVAVLANLMTCPEGRVAIG-DDGGIPALVEVVEAGTARGKENAAAALLHLC  338



>ref|XP_003616674.1| U-box domain-containing protein [Medicago truncatula]
Length=736

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 53/149 (36%), Positives = 76/149 (51%), Gaps = 2/149 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I      + AL GLL++G++ GK+DA TALFNL+ +  N   ++ SGAV  LV  L 
Sbjct  521  KVQIGASSRAIPALVGLLKEGTIIGKRDAATALFNLAVYNPNKLSIVKSGAVTLLVELLM  580

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L V      G   +   ++ V  LI ++R G+ KGKEN++  LL LC
Sbjct  581  DDKAGITDDSLAVLAVLLGCSEGLEEIKNSKSLVPLLIDLLRFGSVKGKENSITLLLGLC  640

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGT  236
            +  GE    R+L  P     LQSL   G+
Sbjct  641  KEEGELVAMRLLANPRSIPSLQSLAADGS  669



>gb|KJB11337.1| hypothetical protein B456_001G254100 [Gossypium raimondii]
 gb|KJB11339.1| hypothetical protein B456_001G254100 [Gossypium raimondii]
 gb|KJB11340.1| hypothetical protein B456_001G254100 [Gossypium raimondii]
Length=783

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+ RGKKDA TALFNLS   EN ARM+ +GAV  LV  +
Sbjct  613  YKARIG-RSGAVKALVNLLGSGTFRGKKDAATALFNLSIFHENKARMVQAGAVKYLVQLM  671

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              +    + A AL   +            E  V  L+ ++  G+ +GKENA + LL+LC 
Sbjct  672  DPDSGMVDKAVALLSNLSTVAEGRVAIVREGGVPLLVEILESGSQRGKENAASVLLQLCL  731

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  732  NSPKFCT-LVLQEGAVPPLVALSQS  755



>gb|KHG28942.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=777

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 64/167 (38%), Positives = 93/167 (56%), Gaps = 4/167 (2%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  614  RSGAIKPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVRHLVDLMDPAAGMV  673

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  674  DKAVAVLANLATIPEGRNAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCTTSGRFC  732

Query  301  TERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG  161
               VL+  A+  L+ +L  TGT R + KA +L   F+   H S   G
Sbjct  733  N-MVLQEGAVPPLV-ALSQTGTPRGKEKAQALLSYFRNQRHGSAGRG  777



>ref|XP_010087281.1| U-box domain-containing protein 4 [Morus notabilis]
 gb|EXB28728.1| U-box domain-containing protein 4 [Morus notabilis]
Length=900

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 77/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  683  RSGAIRPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLVELMDPAAGMV  742

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  743  DKAVAVLANLATIPEGRTAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCTNSGRFC  801

Query  301  TERVLK---APALAGLLQS  254
               VL+    P L  L QS
Sbjct  802  N-MVLQEGAVPPLVALSQS  819



>ref|XP_010905800.1| PREDICTED: U-box domain-containing protein 3-like [Elaeis guineensis]
Length=784

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 51/120 (43%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G ++AL  LL  GSLRGKKDA TALFNLS   EN AR++ +GAV  LV  +
Sbjct  614  YKVKIG-RSGAIKALVNLLGSGSLRGKKDAATALFNLSILHENKARIVQAGAVKYLVELM  672

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + + AL   +   P G  A+  +E  +  L+ ++  G+ +GKENA +ALL+LC
Sbjct  673  DPSTGMVDKSVALLANLSTVPEGRLAI-SQEGGIPLLVEIVETGSQRGKENAASALLQLC  731



>gb|EPS70781.1| hypothetical protein M569_03979, partial [Genlisea aurea]
Length=800

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 52/138 (38%), Positives = 75/138 (54%), Gaps = 3/138 (2%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL  GSLRGKKDA TALFNLS   +N  R++ +GAV  LV  +       
Sbjct  637  RSGAIKPLVELLGTGSLRGKKDAATALFNLSISHDNKGRIVQAGAVKYLVELMDPAFGMV  696

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +   +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  697  DKAVAVLSNLATIPEGRMAIGGQGGGIPSLVEVVELGSGRGKENAAAALLQLCMNSGRFC  756

Query  301  TERVLKA--PALAGLLQS  254
               + +   P L  L QS
Sbjct  757  NMVLQEGAIPPLVALTQS  774



>ref|XP_007141746.1| hypothetical protein PHAVU_008G222100g [Phaseolus vulgaris]
 gb|ESW13740.1| hypothetical protein PHAVU_008G222100g [Phaseolus vulgaris]
Length=683

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 62/166 (37%), Positives = 85/166 (51%), Gaps = 2/166 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I  +   + AL GLL++G+  GKKDA +ALFNL+ +  N   ++  GAV  LV  L 
Sbjct  510  KVQIGGRSRAIPALVGLLKEGTSIGKKDAASALFNLAVYNPNKVSIVKGGAVPMLVELLM  569

Query  496  cegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   +      V  LI +MR G+ KGKEN++  LL LC
Sbjct  570  DDKAGITDDALAVLALLLGCSEGLEEIRNSRALVPLLIDLMRFGSVKGKENSITLLLGLC  629

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            +  GE    R+L  P     LQSL   G+ RARRKA +L R+  RC
Sbjct  630  KQEGEVVARRLLANPRSIPSLQSLAADGSLRARRKADALLRLLNRC  675



>ref|XP_007050278.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX94435.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=786

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 60/146 (41%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  +
Sbjct  615  YKARIG-RSGAVKALVNLLGSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELM  673

Query  499  gcegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
              +    + A AL   +   IG   +    E  +  L+  +  G+ +GKENA + LL+LC
Sbjct  674  DPDSGMVDKAVALLSNL-STIGEGRLAIVREGGIPVLVEAIESGSQRGKENAASVLLQLC  732

Query  322  RSGGEAATERVLK---APALAGLLQS  254
             +  +  T  VL+    P L  L QS
Sbjct  733  LNSPKFCT-LVLQEGAVPPLVALSQS  757



>ref|XP_002977628.1| ubiquitin-protein ligase, PUB17 [Selaginella moellendorffii]
 gb|EFJ21632.1| ubiquitin-protein ligase, PUB17 [Selaginella moellendorffii]
Length=684

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 94/169 (56%), Gaps = 1/169 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGS-LRGKKDAVTALFNLSTHTENCARMIDSGAVNALvga  503
            YK  I  +     +L  LLR+GS  RGK+DA TALFNL+ +  N  R+I +GAV  LV  
Sbjct  501  YKVLIGSKSETFTSLIALLREGSSARGKRDAATALFNLAVYHGNKGRIIAAGAVPLLVEL  560

Query  502  lgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
            L  +    + A A+  ++              A+  L+G++R G+ KGKEN+ A LL LC
Sbjct  561  LTEDADITDDALAVLALLASSSEGLLALSGTGAIPLLVGLLRMGSSKGKENSTAVLLALC  620

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHA  176
            RSG +    ++LK  A    L +L+  GT RA+RKA+SL R+  R E +
Sbjct  621  RSGSDTIVNQLLKISATVPALYNLITVGTPRAKRKASSLLRILHRSERS  669



>ref|XP_006845980.1| hypothetical protein AMTR_s00155p00026110 [Amborella trichopoda]
 gb|ERN07655.1| hypothetical protein AMTR_s00155p00026110 [Amborella trichopoda]
Length=876

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 67/176 (38%), Positives = 94/176 (53%), Gaps = 9/176 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I   D  ++ L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  + 
Sbjct  707  KIKIGRSDA-IKPLVHLLGNGTPRGKKDAATALFNLSIFHENKARIVHAGAVKHLVDLMD  765

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G  E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  766  PAAGMVDKAVAVLANLATIPEGRTAIGA-EGGITALVEVVELGSSRGKENAAAALLQLCT  824

Query  319  SGGEAATERVLKA--PALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGG  158
            +     +  + +   P L  L QS    GT RAR KA SL   F+   H ++  GG
Sbjct  825  NSHRFCSNVLQEGAVPPLVALSQS----GTPRAREKAQSLLSYFRNQRHGNVGRGG  876



>ref|XP_010933040.1| PREDICTED: U-box domain-containing protein 4-like [Elaeis guineensis]
Length=854

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +G+ RGKKDA TALFNLS   EN  R++ +GAVN LV  + 
Sbjct  686  KVRIG-RSGAIRPLVELLGNGTPRGKKDATTALFNLSIFHENKVRIVRAGAVNPLVELMD  744

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +     G  A+G  E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  745  PAAGLVDKAVAVLANLATIQEGRTAIGHSE-GIPSLVEVVELGSARGKENAAAALLQLCT  803

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +     T+ + +   P L  L QS
Sbjct  804  NSNRFCTQVLQQGAVPPLVALSQS  827



>gb|KJB09961.1| hypothetical protein B456_001G178000 [Gossypium raimondii]
Length=775

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  + 
Sbjct  605  KARIG-RSGAVKALVNLLSSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMD  663

Query  496  cegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
             +    + A AL   +   IG   +    E+ +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  664  PDSGMVDKAVALLSNL-STIGEGRLAIVRESGIPILVEVIESGSRRGKENAASVLLQLCL  722

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  723  NSPKFCT-LVLQEGAVPPLVALSQS  746



>ref|XP_006841267.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
 gb|ERN02942.1| hypothetical protein AMTR_s00135p00108920 [Amborella trichopoda]
Length=636

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgce--gvae  479
            G + AL GLL  GS RGKKDA TALFNL  +  N AR + +G +N L+  L     G+ +
Sbjct  479  GAIPALVGLLCSGSPRGKKDAATALFNLCIYQGNKARAVRAGILNPLMTMLTDTGNGMVD  538

Query  478  eaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGE  308
            EA   LA+I   P G  A+ K   A+  L+ + R G P+ KENAVA LL LC+  GE
Sbjct  539  EALTILAVIASHPEGKVAIAK-ANAIPVLVDLTRTGLPRNKENAVAILLTLCKKDGE  594



>ref|XP_002975220.1| ubiquitin-protein ligase, PUB17 [Selaginella moellendorffii]
 gb|EFJ24005.1| ubiquitin-protein ligase, PUB17 [Selaginella moellendorffii]
Length=684

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 94/169 (56%), Gaps = 1/169 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGS-LRGKKDAVTALFNLSTHTENCARMIDSGAVNALvga  503
            YK  I  +     +L  LLR+GS  RGK+DA TALFNL+ +  N  R+I +GAV  LV  
Sbjct  501  YKVLIGSKSETFTSLIALLREGSSARGKRDAATALFNLAVYHGNKGRIIAAGAVPLLVEL  560

Query  502  lgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
            L  +    + A A+  ++              A+  L+G++R G+ KGKEN+ A LL LC
Sbjct  561  LTEDADITDDALAVLALLASSSEGLLALSGTGAIPLLVGLLRMGSSKGKENSTAVLLALC  620

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHA  176
            RSG +    ++LK  A    L +L+  GT RA+RKA+SL R+  R E +
Sbjct  621  RSGSDTIVNQLLKISATVPALYNLITVGTPRAKRKASSLLRILHRSERS  669



>ref|XP_011458009.1| PREDICTED: U-box domain-containing protein 3 [Fragaria vesca 
subsp. vesca]
Length=790

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 58/149 (39%), Positives = 81/149 (54%), Gaps = 13/149 (9%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LLR G+LRGKKDA TALFNLS   EN AR++ +GAV  L+  +
Sbjct  620  YKAKIG-RSGAVKALVDLLRSGTLRGKKDAATALFNLSIFHENKARLVQAGAVKYLIELM  678

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALL  332
              +    + A AL       +   A G+   A  G    L+ ++  G+ +GKEN+ + LL
Sbjct  679  DPDTGMADKAVALLAN----LSTIAEGRLAIARGGGIPLLVEIVESGSQRGKENSASVLL  734

Query  331  ELCRSGGEAATERVLK---APALAGLLQS  254
            +LC    +  T  VL+    P L  L QS
Sbjct  735  QLCLHSPKFCT-MVLQEGAVPPLVALSQS  762



>ref|XP_010484515.1| PREDICTED: U-box domain-containing protein 2-like [Camelina sativa]
Length=717

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 50/122 (41%), Positives = 68/122 (56%), Gaps = 7/122 (6%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVN---ALv  509
            YK  I +  G +E L  LL +GSL GKKDA TALF LS H EN  ++I++GAV     L+
Sbjct  549  YKTEIGKA-GAIEPLVDLLANGSLSGKKDAATALFILSIHHENKTKVIEAGAVRYLVELM  607

Query  508  galgcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLE  329
                          +    VR+  G  A+G EE  +  L+ ++  G+ +GKENA AALL+
Sbjct  608  DPAFGMVEKAVVVLSNLATVRE--GKIAIG-EEGGIPVLVEVVELGSARGKENATAALLQ  664

Query  328  LC  323
            LC
Sbjct  665  LC  666



>gb|AAB87116.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14930.1| hypothetical protein [Arabidopsis thaliana]
Length=924

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 76/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            Q G +  L  LL +G+ RGKKDA TALFNLS H EN A ++ SGAV  L+  +       
Sbjct  742  QSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKAMIVQSGAVRYLIDLMDPAAGMV  801

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  802  DKAVAVLANLATIPEGRNAIG-QEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFC  860

Query  301  TERVLK---APALAGLLQS  254
               VL+    P L  L QS
Sbjct  861  N-MVLQEGAVPPLVALSQS  878



>ref|XP_009401620.1| PREDICTED: U-box domain-containing protein 3 [Musa acuminata 
subsp. malaccensis]
Length=764

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  GS+RGKKDA TALFNLS   EN AR++ +GAV  L+  +
Sbjct  593  YKAKIG-RSGAVKALVYLLETGSVRGKKDAATALFNLSIFHENKARIVQAGAVKYLIKLM  651

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + + AL   +   P G  A+  +E  +  L+ ++  G+ +GKENA + L +LC
Sbjct  652  ELSTGMVDKSVALLANLSTIPEGRIAIA-QEGGIPLLVEVVETGSQRGKENAASTLFQLC  710

Query  322  RS  317
             S
Sbjct  711  LS  712



>gb|KJB11341.1| hypothetical protein B456_001G254100 [Gossypium raimondii]
Length=681

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 58/145 (40%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+ RGKKDA TALFNLS   EN ARM+ +GAV  LV  +
Sbjct  511  YKARIG-RSGAVKALVNLLGSGTFRGKKDAATALFNLSIFHENKARMVQAGAVKYLVQLM  569

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
              +    + A AL   +            E  V  L+ ++  G+ +GKENA + LL+LC 
Sbjct  570  DPDSGMVDKAVALLSNLSTVAEGRVAIVREGGVPLLVEILESGSQRGKENAASVLLQLCL  629

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  630  NSPKFCT-LVLQEGAVPPLVALSQS  653



>gb|KDO79024.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79025.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79026.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79027.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79028.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79029.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79030.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
 gb|KDO79031.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=828

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  665  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  724

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  725  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  783

Query  301  TERVLK---APALAGLLQS  254
            +  VL+    P L  L QS
Sbjct  784  S-MVLQEGAVPPLVALSQS  801



>ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4-like isoform X5 
[Citrus sinensis]
 ref|XP_006466522.1| PREDICTED: U-box domain-containing protein 4-like isoform X6 
[Citrus sinensis]
Length=828

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  665  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  724

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  725  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  783

Query  301  TERVLK---APALAGLLQS  254
            +  VL+    P L  L QS
Sbjct  784  S-MVLQEGAVPPLVALSQS  801



>ref|XP_007050279.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
 gb|EOX94436.1| ARM repeat superfamily protein isoform 2 [Theobroma cacao]
Length=750

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 60/146 (41%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  +
Sbjct  579  YKARIG-RSGAVKALVNLLGSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELM  637

Query  499  gcegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
              +    + A AL   +   IG   +    E  +  L+  +  G+ +GKENA + LL+LC
Sbjct  638  DPDSGMVDKAVALLSNL-STIGEGRLAIVREGGIPVLVEAIESGSQRGKENAASVLLQLC  696

Query  322  RSGGEAATERVLK---APALAGLLQS  254
             +  +  T  VL+    P L  L QS
Sbjct  697  LNSPKFCT-LVLQEGAVPPLVALSQS  721



>ref|XP_006443826.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 ref|XP_006443827.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 ref|XP_006479529.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006479530.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Citrus sinensis]
 gb|ESR57066.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
 gb|ESR57067.1| hypothetical protein CICLE_v10018951mg [Citrus clementina]
Length=775

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRG+KDA TALFNLS   EN AR+I +GAV  LV  +
Sbjct  604  YKAKIG-RSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKHLVDLM  662

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                   + A AL   +            E  +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  663  DPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASILLQLCL  722

Query  319  SGGEAATERVLK---APALAGLLQS  254
               +  T  VL+    P L GL QS
Sbjct  723  HSPKFCT-LVLQEGAVPPLVGLSQS  746



>ref|XP_006426022.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 ref|XP_006426023.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 ref|XP_006426024.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39262.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39263.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
 gb|ESR39264.1| hypothetical protein CICLE_v10024899mg [Citrus clementina]
Length=828

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  665  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  724

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  725  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  783

Query  301  TERVLK---APALAGLLQS  254
            +  VL+    P L  L QS
Sbjct  784  S-MVLQEGAVPPLVALSQS  801



>ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Citrus sinensis]
 ref|XP_006466518.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Citrus sinensis]
 ref|XP_006466519.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 
[Citrus sinensis]
 ref|XP_006466520.1| PREDICTED: U-box domain-containing protein 4-like isoform X4 
[Citrus sinensis]
Length=834

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 78/139 (56%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  671  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  730

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  731  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  789

Query  301  TERVLK---APALAGLLQS  254
            +  VL+    P L  L QS
Sbjct  790  S-MVLQEGAVPPLVALSQS  807



>gb|KJB09958.1| hypothetical protein B456_001G178000 [Gossypium raimondii]
Length=792

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  + 
Sbjct  620  KARIG-RSGAVKALVNLLSSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMD  678

Query  496  cegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
             +    + A AL   +   IG   +    E+ +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  679  PDSGMVDKAVALLSNL-STIGEGRLAIVRESGIPILVEVIESGSRRGKENAASVLLQLCL  737

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  738  NSPKFCT-LVLQEGAVPPLVALSQS  761



>gb|KJB09962.1| hypothetical protein B456_001G178000 [Gossypium raimondii]
Length=793

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  + 
Sbjct  621  KARIG-RSGAVKALVNLLSSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMD  679

Query  496  cegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
             +    + A AL   +   IG   +    E+ +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  680  PDSGMVDKAVALLSNL-STIGEGRLAIVRESGIPILVEVIESGSRRGKENAASVLLQLCL  738

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  739  NSPKFCT-LVLQEGAVPPLVALSQS  762



>gb|KJB09959.1| hypothetical protein B456_001G178000 [Gossypium raimondii]
 gb|KJB09960.1| hypothetical protein B456_001G178000 [Gossypium raimondii]
Length=777

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 82/145 (57%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G V+AL  LL  G+LRGKKDAVTALFNLS   EN AR++ +GAV  LV  + 
Sbjct  605  KARIG-RSGAVKALVNLLSSGTLRGKKDAVTALFNLSIFHENKARIVQAGAVKYLVELMD  663

Query  496  cegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
             +    + A AL   +   IG   +    E+ +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  664  PDSGMVDKAVALLSNL-STIGEGRLAIVRESGIPILVEVIESGSRRGKENAASVLLQLCL  722

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +  +  T  VL+    P L  L QS
Sbjct  723  NSPKFCT-LVLQEGAVPPLVALSQS  746



>gb|KDO60475.1| hypothetical protein CISIN_1g004078mg [Citrus sinensis]
Length=732

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRG+KDA TALFNLS   EN AR+I +GAV  LV  +
Sbjct  561  YKAKIG-RSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKHLVDLM  619

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                   + A AL   +            E  +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  620  DPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASILLQLCL  679

Query  319  SGGEAATERVLK---APALAGLLQS  254
               +  T  VL+    P L GL QS
Sbjct  680  HSPKFCT-LVLQEGAVPPLVGLSQS  703



>gb|KDO60476.1| hypothetical protein CISIN_1g004078mg [Citrus sinensis]
Length=775

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 5/145 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRG+KDA TALFNLS   EN AR+I +GAV  LV  +
Sbjct  604  YKAKIG-RSGAVKALVDLLGSGTLRGRKDAATALFNLSIFHENKARIIQAGAVKHLVDLM  662

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                   + A AL   +            E  +  L+ ++  G+ +GKENA + LL+LC 
Sbjct  663  DPSTGMVDKAVALLANLSTVGEGRLAIAREGGIPSLVEVVESGSQRGKENAASILLQLCL  722

Query  319  SGGEAATERVLK---APALAGLLQS  254
               +  T  VL+    P L GL QS
Sbjct  723  HSPKFCT-LVLQEGAVPPLVGLSQS  746



>ref|XP_011008564.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008565.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008566.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008567.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011008568.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=840

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 72/119 (61%), Gaps = 3/119 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +G+ RGKKDA TALFNLS   EN AR++++GAV  LV  + 
Sbjct  672  KVRIG-RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAGAVKHLVDLMD  730

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                  + A A+   +   P G  A+G +E+ +  L+ ++  G+ +GKENA AALL+LC
Sbjct  731  PAAGMVDKAVAVLANLATIPEGRNAIG-QESGIPVLVEVVELGSARGKENAAAALLQLC  788



>ref|XP_011013975.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013976.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013978.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013979.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
 ref|XP_011013980.1| PREDICTED: U-box domain-containing protein 4-like [Populus euphratica]
Length=840

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 81/145 (56%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +G+ RGKKDA TALFNLS   EN AR++++GAV  LV  + 
Sbjct  672  KVRIG-RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVEAGAVKHLVDLMD  730

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G +E+ +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  731  PAAGMVDKAVAVLANLATIPEGRNAIG-QESGIPVLVEVVELGSARGKENAAAALLQLCT  789

Query  319  SGGEAATERVLK---APALAGLLQS  254
            +        VL+    P L  L QS
Sbjct  790  NSSRFC-HMVLQEGAVPPLVALSQS  813



>ref|XP_007142063.1| hypothetical protein PHAVU_008G249400g [Phaseolus vulgaris]
 gb|ESW14057.1| hypothetical protein PHAVU_008G249400g [Phaseolus vulgaris]
Length=769

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 59/145 (41%), Positives = 79/145 (54%), Gaps = 7/145 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +GS RGKKDA TALFNLS   EN  R++ +GAV  LV  + 
Sbjct  601  KIRIG-RSGAIRPLVDLLGNGSPRGKKDAATALFNLSIFHENKDRIVQAGAVKHLVELMD  659

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G AA+G +E  +  L+ ++  G+ +GKENA AALL LC 
Sbjct  660  PAAGMVDKAVAVLANLATIPEGKAAIG-DEGGIPVLVEVIELGSVRGKENAAAALLHLC-  717

Query  319  SGGEAATERVLK---APALAGLLQS  254
            S       +VL+    P L  L QS
Sbjct  718  SYNHRYLNKVLQEGAVPPLVALSQS  742



>ref|XP_010319902.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
 ref|XP_010319930.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum]
Length=818

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR+I +GAV  LV  +       
Sbjct  655  RSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIIQAGAVKYLVDLMDPATGMV  714

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G A +G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  715  DKAVAVLSNLATIPDGRAGIG-QEGGIPLLVEVVELGSARGKENAAAALLQLCTNSNRFC  773

Query  301  TERVLKA--PALAGLLQS  254
               + +   P L  L QS
Sbjct  774  NTVLQEGAVPPLVALSQS  791



>ref|XP_011080053.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Sesamum 
indicum]
Length=802

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+ +I  + G V+AL  LL  G+ RGKKDA TALFNLS   EN  R++ +GAV  LV  L
Sbjct  631  YRIKIG-RSGAVKALVDLLGSGTFRGKKDAATALFNLSIFHENKVRIVQAGAVKYLVRFL  689

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +   +   +    E  +  L+ ++  G+P+GKENA + LL+LC
Sbjct  690  DPATEMVDKAVALLANLSTVVEGCSAIAREGGIPLLVEILETGSPRGKENAASILLQLC  748



>ref|XP_002528322.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF34080.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=695

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 60/166 (36%), Positives = 88/166 (53%), Gaps = 2/166 (1%)
 Frame = -2

Query  649  GVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvaeeaa  470
             + AL  LL++G+  GK+DA +ALFNL+ +  N A ++ +GAV  L+G L  +       
Sbjct  530  AIPALVRLLKEGTTAGKRDAASALFNLAVYNGNKASVVLAGAVPLLIGLLTDDKAGITDD  589

Query  469  galaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAATE  296
                L +      G   + K    V  LI ++R G+ KGKEN++  LL LC+ GGE    
Sbjct  590  ALAVLSLLLGCAEGLEEIRKSRVLVPLLIDLLRFGSTKGKENSITLLLGLCKDGGEEVAR  649

Query  295  RVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYGG  158
            R+L  P     LQSL   G+ +ARRKA ++ R+  RC     + GG
Sbjct  650  RLLINPRSIPSLQSLSSDGSLKARRKADAVLRLLNRCCSRCHNPGG  695



>ref|XP_007201804.1| hypothetical protein PRUPE_ppa001702mg [Prunus persica]
 gb|EMJ03003.1| hypothetical protein PRUPE_ppa001702mg [Prunus persica]
Length=777

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 58/146 (40%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRGKKDA TALFNLS + EN AR++ +GAV  L+  +
Sbjct  607  YKAKIG-RSGAVKALVDLLGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELM  665

Query  499  gcegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
              +    + A AL   +   IG   V    E  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  666  DPDTGMVDKAVALLANL-STIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASILLQLC  724

Query  322  RSGGEAATERVLK---APALAGLLQS  254
                +  T  VL+    P L  L QS
Sbjct  725  LHSPKFCT-LVLQEGAVPPLVALSQS  749



>ref|XP_011080054.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Sesamum 
indicum]
Length=770

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+ +I  + G V+AL  LL  G+ RGKKDA TALFNLS   EN  R++ +GAV  LV  L
Sbjct  599  YRIKIG-RSGAVKALVDLLGSGTFRGKKDAATALFNLSIFHENKVRIVQAGAVKYLVRFL  657

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +   +   +    E  +  L+ ++  G+P+GKENA + LL+LC
Sbjct  658  DPATEMVDKAVALLANLSTVVEGCSAIAREGGIPLLVEILETGSPRGKENAASILLQLC  716



>ref|XP_006351668.1| PREDICTED: U-box domain-containing protein 3-like [Solanum tuberosum]
Length=778

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 51/120 (43%), Positives = 71/120 (59%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K+I  + G V+AL  LL  G++RGKKDA TALFNLS   EN AR+I  GAV  L+  L
Sbjct  607  YRKKIG-RSGAVKALVDLLGLGTIRGKKDAATALFNLSIFHENKARIIQVGAVKHLIRLL  665

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +     G  A+ +EE  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  666  DPSNELVDKAVALLANLSTISEGCLAIAREE-GIPSLVEIVETGSQRGKENAASILLQLC  724



>emb|CDP02559.1| unnamed protein product [Coffea canephora]
Length=821

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  + 
Sbjct  655  KVRIG-RSGAIQPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVKYLVELMD  713

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  714  PAAGMVDKAVAVLSNLATIPEGRTAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCT  772

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            S        + +   P L  L QS
Sbjct  773  SSNRFCNMVLQEGAVPPLVALSQS  796



>ref|XP_010429257.1| PREDICTED: U-box domain-containing protein 4-like [Camelina sativa]
Length=837

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 76/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            Q G +  L  LL +G+ RGKKDA TALFNLS H EN A ++ SGAV  L+  +       
Sbjct  674  QSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRYLIDLMDPAAGMV  733

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  734  DKAVAVLANLATIPEGRNAIG-QEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFC  792

Query  301  TERVLK---APALAGLLQS  254
               VL+    P L  L QS
Sbjct  793  N-MVLQEGAVPPLVALSQS  810



>ref|XP_010326171.1| PREDICTED: U-box domain-containing protein 3 [Solanum lycopersicum]
 ref|XP_010326172.1| PREDICTED: U-box domain-containing protein 3 [Solanum lycopersicum]
Length=776

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K+I  + G V+AL  LL  G++RGKKDA TALFNLS   EN AR+I  GAV  L+  L
Sbjct  605  YRKKIG-RSGAVKALVDLLGLGTIRGKKDAATALFNLSIFHENKARIIQVGAVKHLIRLL  663

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                V  + A AL   +     G  A+ +EE  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  664  DPSNVMVDKAVALLANLSTISEGCLAIAREE-GIPSLVEIVETGSQRGKENAASILLQLC  722



>ref|XP_009614286.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=779

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K+I  + G V+AL  LL  G++RGKKDA TALFNLS   EN AR++ +GAV  L+  L
Sbjct  608  YRKKIG-RSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKARIVQAGAVKHLIRLL  666

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +            E  +  L+ ++  G+ +GKENA A LL+LC
Sbjct  667  DPSNELVDKAVALLANLSTIAEGCLAIAREGGIPSLVEIVETGSQRGKENAAAILLQLC  725



>ref|XP_009614285.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=785

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K+I  + G V+AL  LL  G++RGKKDA TALFNLS   EN AR++ +GAV  L+  L
Sbjct  614  YRKKIG-RSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKARIVQAGAVKHLIRLL  672

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +            E  +  L+ ++  G+ +GKENA A LL+LC
Sbjct  673  DPSNELVDKAVALLANLSTIAEGCLAIAREGGIPSLVEIVETGSQRGKENAAAILLQLC  731



>ref|XP_010531283.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531284.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531285.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
 ref|XP_010531286.1| PREDICTED: U-box domain-containing protein 4 [Tarenaya hassleriana]
Length=839

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 76/138 (55%), Gaps = 4/138 (3%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL  G+ RGKKDA TALFNLS H EN AR++ +GAV  L+  +   G   
Sbjct  676  RSGAIGPLVDLLGTGTPRGKKDAATALFNLSIHHENKARIVQAGAVRHLIDLMDPAGGMV  735

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G   +G +E  +  L+ ++  G+ +GKENA AALL+LC + G   
Sbjct  736  DKAVAVMANLATIPEGRNGIG-QEGGIPLLVEVVELGSARGKENAAAALLQLCTNSGRFC  794

Query  301  TERVLKA--PALAGLLQS  254
               + +   P L  L QS
Sbjct  795  NMVLQEGAIPPLVALSQS  812



>ref|XP_010246789.1| PREDICTED: U-box domain-containing protein 3-like [Nelumbo nucifera]
Length=795

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 50/120 (42%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G++RGKKDAVTALFNLS   EN AR++ +GAV  LV  +
Sbjct  624  YKIKIG-RSGAVKALVDLLGSGTIRGKKDAVTALFNLSICHENKARIVQAGAVKYLVELM  682

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +   P G +A+ +    +  L+ ++  G+ +GKENA + LL+LC
Sbjct  683  DPATKMLDKAVALLANLSTIPEGCSAITR-NGGIPPLVEVVETGSQRGKENAASILLQLC  741



>ref|XP_010472313.1| PREDICTED: U-box domain-containing protein 4 [Camelina sativa]
Length=837

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 55/139 (40%), Positives = 76/139 (55%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            Q G +  L  LL +G+ RGKKDA TALFNLS H EN A ++ SGAV  L+  +       
Sbjct  674  QSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKATIVQSGAVRYLIDLMDPAAGMV  733

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  734  DKAVAVLANLATIPEGRNAIG-QEGGIPLLVEVVELGSARGKENAAAALLQLSTNSGRFC  792

Query  301  TERVLK---APALAGLLQS  254
               VL+    P L  L QS
Sbjct  793  N-MVLQEGAVPPLVALSQS  810



>ref|XP_010935918.1| PREDICTED: U-box domain-containing protein 3-like [Elaeis guineensis]
Length=792

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 49/120 (41%), Positives = 72/120 (60%), Gaps = 3/120 (3%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G ++AL  LL  GSLRGKKDA TALF+LS   EN AR++ +GAV  LV  L
Sbjct  613  YKVKIG-RSGAIKALVNLLGSGSLRGKKDAATALFSLSIFHENKARIVQAGAVKYLVELL  671

Query  499  gcegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + + A+   +   P G  A+  ++  +  L+ ++  G+ +GKENA +ALL+LC
Sbjct  672  DTSTGMVDKSVAVLANLTTVPEGCLAI-SQQGGIPLLVEIVETGSQRGKENAASALLQLC  730



>ref|XP_006361218.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum]
Length=818

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G ++ L  LL +G+ RGKKDA TALFNLS   EN AR+I +GAV  LV  +       
Sbjct  655  RSGAIKPLVDLLGNGTPRGKKDAATALFNLSILHENKARIIQAGAVKYLVDLMDPATGMV  714

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
            + A A+   +   P G A +G +E  +  L+ ++  G+ +GKENA AALL+LC
Sbjct  715  DKAVAVLSNLATIPEGRAGIG-QEGGIPLLVEVVELGSARGKENAAAALLQLC  766



>gb|KDO79032.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=729

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 4/138 (3%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  566  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  625

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  626  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  684

Query  301  TERVLKA--PALAGLLQS  254
            +  + +   P L  L QS
Sbjct  685  SMVLQEGAVPPLVALSQS  702



>gb|KJB11338.1| hypothetical protein B456_001G254100 [Gossypium raimondii]
Length=590

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 80/149 (54%), Gaps = 13/149 (9%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK RI  + G V+AL  LL  G+ RGKKDA TALFNLS   EN ARM+ +GAV  LV  +
Sbjct  420  YKARIG-RSGAVKALVNLLGSGTFRGKKDAATALFNLSIFHENKARMVQAGAVKYLVQLM  478

Query  499  gcegvaeeaagalaliVRQPIGAAAVGK----EETAVAGLIGMMRCGTPKGKENAVAALL  332
              +    + A AL       +   A G+     E  V  L+ ++  G+ +GKENA + LL
Sbjct  479  DPDSGMVDKAVALLSN----LSTVAEGRVAIVREGGVPLLVEILESGSQRGKENAASVLL  534

Query  331  ELCRSGGEAATERVLK---APALAGLLQS  254
            +LC +  +  T  VL+    P L  L QS
Sbjct  535  QLCLNSPKFCT-LVLQEGAVPPLVALSQS  562



>gb|EYU20039.1| hypothetical protein MIMGU_mgv1a025209mg [Erythranthe guttata]
Length=663

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +K  I      + AL GLL +G+  GK+DA TALFNL+    N  ++I +GA+  L+G L
Sbjct  495  HKIIIGAHPRAITALVGLLGEGTRAGKRDAATALFNLAVFNVNRGKVITAGAIPLLIGLL  554

Query  499  gcegvaeeaagalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +           L +      G   + K    V+ LI ++R G+ KGKEN++  LL L
Sbjct  555  TDDKAGITDDALAMLALLLGCSQGLEEIRKSRVLVSLLIDLLRFGSSKGKENSITLLLGL  614

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            C+ GGE    ++L  P     LQSL+  G+ +ARRKA +L R+  RC
Sbjct  615  CKDGGEEVARKLLMNPRSIPSLQSLVTDGSLKARRKADALLRILNRC  661



>gb|KHN02500.1| U-box domain-containing protein 3 [Glycine soja]
Length=774

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  609  RSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  668

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL++C    
Sbjct  669  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSQRGKENAASILLQMCLHSQ  724

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  725  KFCT-LVLQEGAVPPLVALSQS  745



>ref|XP_006604491.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Glycine max]
Length=797

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  630  RSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  689

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL++C    
Sbjct  690  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSQRGKENAASILLQMCLHSQ  745

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  746  KFCT-LVLQEGAVPPLVALSQS  766



>ref|XP_006604492.1| PREDICTED: U-box domain-containing protein 3-like isoform X3 
[Glycine max]
Length=796

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  631  RSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  690

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL++C    
Sbjct  691  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSQRGKENAASILLQMCLHSQ  746

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  747  KFCT-LVLQEGAVPPLVALSQS  767



>ref|XP_006604490.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Glycine max]
Length=798

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKDA TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  631  RSGAVKALVGLLASGTLRGKKDAATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  690

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL++C    
Sbjct  691  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSQRGKENAASILLQMCLHSQ  746

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  747  KFCT-LVLQEGAVPPLVALSQS  767



>gb|KJB74380.1| hypothetical protein B456_011G291400 [Gossypium raimondii]
Length=623

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 76/145 (52%), Gaps = 2/145 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +K  I      + AL GLLR+G+  GK+DA  AL NL+ +  N  + + +GAV  L+  L
Sbjct  454  FKVAIGAHSQAIPALVGLLREGTTTGKRDAAMALCNLALYNANKLKTVAAGAVPLLIELL  513

Query  499  gcegvaeeaag--alaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +           LAL++  P G  A+ K    V  LI ++R G+ KGKEN++  LL L
Sbjct  514  MDDKAGITDDALGVLALLLSCPQGLEAIKKSRPLVPLLIDLLRFGSAKGKENSITLLLGL  573

Query  325  CRSGGEAATERVLKAPALAGLLQSL  251
            C+ GGE    R+L  P     LQSL
Sbjct  574  CKDGGEEVARRLLINPRSIPSLQSL  598



>gb|KDO79033.1| hypothetical protein CISIN_1g003348mg [Citrus sinensis]
Length=689

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 52/138 (38%), Positives = 77/138 (56%), Gaps = 4/138 (3%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS + EN AR++ +GAV  LV  +       
Sbjct  526  RSGAIGPLVDLLGNGTPRGKKDAATALFNLSIYHENKARIVQAGAVKHLVDLMDPAAGMV  585

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  586  DKAVAVLANLATIPDGRVAIG-QENGIPVLVEVVELGSARGKENAAAALLQLCTNSSRFC  644

Query  301  TERVLKA--PALAGLLQS  254
            +  + +   P L  L QS
Sbjct  645  SMVLQEGAVPPLVALSQS  662



>ref|XP_004138560.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
 ref|XP_004160750.1| PREDICTED: U-box domain-containing protein 13-like [Cucumis sativus]
Length=686

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 61/167 (37%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +K  I      + AL  LL++G+  GK+DA TAL NL+ +  N A ++ SGAV  L+  L
Sbjct  513  FKITIGASPKAIPALVRLLKEGNSAGKRDAATALCNLALYNANKACIVVSGAVPLLIELL  572

Query  499  gcegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +          AL +      G   + K    V+ LI ++R G+PKGK++++  LL L
Sbjct  573  TDDKAGITDDALQALSLVLGCSEGLQEIRKSRVLVSLLIDLLRFGSPKGKDSSLTLLLGL  632

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            C+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  633  CKDGGEEVARRLLINPRSIPSLQSLAADGSLKARRKADALLRLLNRC  679



>gb|KGN45800.1| hypothetical protein Csa_6G012250 [Cucumis sativus]
Length=688

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 61/167 (37%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            +K  I      + AL  LL++G+  GK+DA TAL NL+ +  N A ++ SGAV  L+  L
Sbjct  515  FKITIGASPKAIPALVRLLKEGNSAGKRDAATALCNLALYNANKACIVVSGAVPLLIELL  574

Query  499  gcegvaeeaagalaliVRQPI--GAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
              +          AL +      G   + K    V+ LI ++R G+PKGK++++  LL L
Sbjct  575  TDDKAGITDDALQALSLVLGCSEGLQEIRKSRVLVSLLIDLLRFGSPKGKDSSLTLLLGL  634

Query  325  CRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
            C+ GGE    R+L  P     LQSL   G+ +ARRKA +L R+  RC
Sbjct  635  CKDGGEEVARRLLINPRSIPSLQSLAADGSLKARRKADALLRLLNRC  681



>gb|ADQ12763.1| ARM protein, partial [Picea jezoensis]
 gb|ADQ12764.1| ARM protein, partial [Picea jezoensis]
 gb|ADQ12765.1| ARM protein, partial [Picea jezoensis]
Length=174

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 69/117 (59%), Gaps = 3/117 (3%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegv--ae  479
            G + AL GLL +GS RGKKDA TALFNLS +  N AR + +G V+ L+  L        +
Sbjct  28   GAIPALVGLLCEGSQRGKKDAATALFNLSIYQGNKARAVRAGVVSPLMQLLVDPSAGMVD  87

Query  478  eaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGE  308
            EA   LA++     G  A+G  + A+  L+ ++R G+P+ +ENA A LL LC S  +
Sbjct  88   EALAILAILASHQEGKIAIGNAD-AIPILVQLIRTGSPRNRENAAAVLLALCTSDSQ  143



>ref|XP_009367853.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367860.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009367866.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 
[Pyrus x bretschneideri]
Length=831

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +GS RG+KDA TALFNLS   EN  R++ +GAV  LV  + 
Sbjct  663  KVRIG-RSGAIRPLVDLLGNGSPRGRKDAATALFNLSIFHENKGRIVQAGAVKYLVELMD  721

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  722  PAAGMVDKAVAVLANLSTIPDGRTAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCT  780

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +     ++ + +   P L  L QS
Sbjct  781  NSNRYCSQVLQEGAVPPLVVLSQS  804



>ref|XP_006404783.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum]
 gb|ESQ46236.1| hypothetical protein EUTSA_v10000047mg [Eutrema salsugineum]
Length=826

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 53/138 (38%), Positives = 75/138 (54%), Gaps = 4/138 (3%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            Q G +  L  LL +G+ RGKKDA TALFNLS H EN   ++ SGAV  L+  +       
Sbjct  663  QSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMV  722

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +A L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  723  DKAVAVLANLATIPEGRNAIG-QEGGIALLVEVVELGSARGKENAAAALLQLSTNSGRFC  781

Query  301  TERVLKA--PALAGLLQS  254
               + +   P L  L QS
Sbjct  782  NMVLQEGAVPPLVALSQS  799



>ref|XP_009780997.1| PREDICTED: U-box domain-containing protein 3 [Nicotiana sylvestris]
Length=779

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 47/119 (39%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            Y+K+I  + G V+AL  LL  G++RGKKDA TALFNLS   EN AR++ +GAV  L+  L
Sbjct  608  YRKKIG-RSGAVKALVDLLGSGTIRGKKDAATALFNLSIFHENKARIVQAGAVKHLIRLL  666

Query  499  gcegvaeeaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
                   + A AL   +      +     E  +  L+ ++  G+ +GKENA + LL+LC
Sbjct  667  DPSNELVDKAVALLANLSTIAEGSLAIAREGGIPSLVEIVETGSQRGKENAASILLQLC  725



>gb|KDP44728.1| hypothetical protein JCGZ_01228 [Jatropha curcas]
Length=397

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 75/149 (50%), Gaps = 2/149 (1%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K  I  +   + AL  LLR+G+  GK+DA +ALFNL+ +  N A ++ SGA+  L+  L 
Sbjct  223  KVTIGARPRAIPALVSLLREGTTAGKRDAASALFNLAVYNANKASVVISGAIPLLIELLM  282

Query  496  cegvaeeaagalaliVRQ--PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
             +           L +      G   + +    V  LI ++R G+ KGKEN++  LL LC
Sbjct  283  DDKAGVTDDVLAVLSLLLGCSQGLKEIRESRVLVPLLIDLLRFGSAKGKENSITILLGLC  342

Query  322  RSGGEAATERVLKAPALAGLLQSLLFTGT  236
            R GGE    R+L  P     LQSL   G+
Sbjct  343  RDGGEEVANRLLINPRSIPSLQSLSADGS  371



>emb|CDY46092.1| BnaA09g42160D [Brassica napus]
Length=1033

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 75/139 (54%), Gaps = 6/139 (4%)
 Frame = -2

Query  658   QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
             Q G +  L  LL +G+ RGKKDA TALFNLS H EN   ++ SGAV  L+  +       
Sbjct  870   QSGAIGPLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMV  929

Query  478   eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
             + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  930   DKAVAVLANLATIPEGRNAIG-QEGGIGLLVEVVELGSARGKENAAAALLQLSTNSGRFC  988

Query  301   TERVLK---APALAGLLQS  254
                VL+    P L  L QS
Sbjct  989   N-MVLQEGAVPPLVALSQS  1006



>ref|XP_008235668.1| PREDICTED: U-box domain-containing protein 3 isoform X2 [Prunus 
mume]
Length=777

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 57/146 (39%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRGKKDA TALFNLS + EN AR++ +GAV  L+  +
Sbjct  607  YKAKIG-RSGAVKALVDLLGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELM  665

Query  499  gcegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
              +    + A AL   +   IG   V    E  +  L+ ++  G+ +GKENA + +L+LC
Sbjct  666  DPDTGMVDKAVALLANL-STIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASIMLQLC  724

Query  322  RSGGEAATERVLK---APALAGLLQS  254
                +  T  VL+    P L  L QS
Sbjct  725  LHSPKFCT-LVLQEGAVPPLVALSQS  749



>ref|XP_008235667.1| PREDICTED: U-box domain-containing protein 3 isoform X1 [Prunus 
mume]
Length=791

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 57/146 (39%), Positives = 81/146 (55%), Gaps = 7/146 (5%)
 Frame = -2

Query  679  YKKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgal  500
            YK +I  + G V+AL  LL  G+LRGKKDA TALFNLS + EN AR++ +GAV  L+  +
Sbjct  621  YKAKIG-RSGAVKALVDLLGSGTLRGKKDAATALFNLSIYHENKARLVQAGAVKYLIELM  679

Query  499  gcegvaeeaagalaliVRQPIGAAAVG-KEETAVAGLIGMMRCGTPKGKENAVAALLELC  323
              +    + A AL   +   IG   V    E  +  L+ ++  G+ +GKENA + +L+LC
Sbjct  680  DPDTGMVDKAVALLANL-STIGEGRVAIAREGGIPLLVEIVETGSQRGKENAASIMLQLC  738

Query  322  RSGGEAATERVLK---APALAGLLQS  254
                +  T  VL+    P L  L QS
Sbjct  739  LHSPKFCT-LVLQEGAVPPLVALSQS  763



>ref|XP_006576944.1| PREDICTED: U-box domain-containing protein 3-like isoform X5 
[Glycine max]
Length=813

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  648  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  707

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  708  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  763

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  764  KFCT-LVLQEGAVPPLVALSQS  784



>gb|KHN10747.1| U-box domain-containing protein 3 [Glycine soja]
Length=824

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  595  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  654

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  655  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  710

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  711  KFCT-LVLQEGAVPPLVALSQS  731



>ref|XP_006576943.1| PREDICTED: U-box domain-containing protein 3-like isoform X4 
[Glycine max]
Length=844

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  648  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  707

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  708  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  763

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  764  KFCT-LVLQEGAVPPLVALSQS  784



>emb|CDX76873.1| BnaC08g34590D [Brassica napus]
Length=747

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 54/139 (39%), Positives = 75/139 (54%), Gaps = 6/139 (4%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            Q G +  L  LL +G+ RGKKDA TALFNLS H EN   ++ SGAV  L+  +       
Sbjct  584  QSGAIAPLVDLLGNGTPRGKKDAATALFNLSIHQENKGTIVQSGAVRYLIDLMDPAAGMV  643

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+L  + G   
Sbjct  644  DKAVAVLANLATIPEGRNAIG-QEGGIGLLVEVVELGSARGKENAAAALLQLSTNSGRFC  702

Query  301  TERVLK---APALAGLLQS  254
               VL+    P L  L QS
Sbjct  703  N-MVLQEGAVPPLVALSQS  720



>ref|XP_004491021.1| PREDICTED: U-box domain-containing protein 17-like [Cicer arietinum]
Length=698

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 63/169 (37%), Positives = 88/169 (52%), Gaps = 8/169 (5%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K +I      + AL GLL++G+  GK+DA TALFNL+ +  N   ++ SG V+ LV  L 
Sbjct  525  KVQIGGSTNAIPALIGLLKEGTQIGKRDAATALFNLAVYNPNKISIVKSGGVSLLVELLM  584

Query  496  cegvaeeaagalaliVRQPIGAAAVGKEETA-----VAGLIGMMRCGTPKGKENAVAALL  332
             +           L V   +   + G EE       V  LI ++R G+ KGKEN++  LL
Sbjct  585  DDKAGITDDSLAVLAV---LLGCSQGLEEIKNSRGLVPLLIDLLRFGSVKGKENSITLLL  641

Query  331  ELCRSGGEAATERVLKAPALAGLLQSLLFTGTkrarrkaaslaRVFQRC  185
             LC+  GE    ++L  P     LQSL   G+ RARRKA +L R+  RC
Sbjct  642  GLCKEEGELVARKLLANPRSIPSLQSLAADGSLRARRKADALLRLLNRC  690



>ref|XP_006576942.1| PREDICTED: U-box domain-containing protein 3-like isoform X3 
[Glycine max]
Length=856

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  627  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  686

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  687  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  742

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  743  KFCT-LVLQEGAVPPLVALSQS  763



>ref|XP_006576941.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 
[Glycine max]
Length=857

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  628  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  687

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  688  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  743

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  744  KFCT-LVLQEGAVPPLVALSQS  764



>ref|XP_006576940.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 
[Glycine max]
Length=877

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 58/142 (41%), Positives = 77/142 (54%), Gaps = 12/142 (8%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G V+AL GLL  G+LRGKKD+ TALFNLS   EN AR++ +GAV  LV  L       
Sbjct  648  RSGAVKALVGLLASGTLRGKKDSATALFNLSIFHENKARIVQAGAVKFLVLLLDPTDKMV  707

Query  478  eaagalaliVRQPIGAAAVGKEETAVAG----LIGMMRCGTPKGKENAVAALLELCRSGG  311
            + A AL       +   A G+ E A  G    L+ ++  G+ +GKENA + LL+LC    
Sbjct  708  DKAVALLAN----LSTIAEGRIEIAREGGIPSLVEIVESGSLRGKENAASILLQLCLHNQ  763

Query  310  EAATERVLK---APALAGLLQS  254
            +  T  VL+    P L  L QS
Sbjct  764  KFCT-LVLQEGAVPPLVALSQS  784



>ref|XP_002868987.1| hypothetical protein ARALYDRAFT_912596 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45246.1| hypothetical protein ARALYDRAFT_912596 [Arabidopsis lyrata subsp. 
lyrata]
Length=297

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 68/115 (59%), Gaps = 2/115 (2%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgceg-vaee  476
            G V  L  LL +G+ RGKKDA+TALFNLS H EN AR++  GAV  L+  +     + ++
Sbjct  139  GAVGPLVDLLGNGTPRGKKDAITALFNLSIHHENKARIVQYGAVRYLIELMDPAVGMVDK  198

Query  475  aagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGG  311
            A   L  +   P G  A+G EE  +  L+ ++  G+ KGKENA AALL L  + G
Sbjct  199  AVAVLTNLATIPEGRNAIG-EEGGIPLLVEVVELGSAKGKENAAAALLRLSTNSG  252



>ref|XP_010111712.1| U-box domain-containing protein 15 [Morus notabilis]
 gb|EXC31551.1| U-box domain-containing protein 15 [Morus notabilis]
Length=644

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 69/111 (62%), Gaps = 3/111 (3%)
 Frame = -2

Query  652  GGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgceg--vae  479
             G+  L  LLRDG++RGKKDA TALFNLS +  N +R I +G + AL+  L  +   + +
Sbjct  486  NGIPPLVELLRDGTIRGKKDAATALFNLSLNQANKSRAIKAGIIPALLQLLEDKNLGMVD  545

Query  478  eaagalaliVRQPIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLEL  326
            EA   L L+   P G + +G+  + +  L+G++R GTPK KE A A LLEL
Sbjct  546  EALSILRLLASHPEGRSEIGR-LSFIETLVGIIRSGTPKNKECAAAVLLEL  595



>ref|XP_009367873.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 
[Pyrus x bretschneideri]
Length=792

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G +  L  LL +GS RG+KDA TALFNLS   EN  R++ +GAV  LV  + 
Sbjct  624  KVRIG-RSGAIRPLVDLLGNGSPRGRKDAATALFNLSIFHENKGRIVQAGAVKYLVELMD  682

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  683  PAAGMVDKAVAVLANLSTIPDGRTAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCT  741

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +     ++ + +   P L  L QS
Sbjct  742  NSNRYCSQVLQEGAVPPLVVLSQS  765



>gb|KJB43859.1| hypothetical protein B456_007G219900 [Gossypium raimondii]
Length=788

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 65/170 (38%), Positives = 93/170 (55%), Gaps = 10/170 (6%)
 Frame = -2

Query  658  QDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalgcegvae  479
            + G +  L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  +       
Sbjct  625  RSGAIGPLVNLLGNGTPRGKKDASTALFNLSIFHENKARIVQAGAVRHLVELMDPAAGMV  684

Query  478  eaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCRSGGEAA  302
            + A A+   +   P G  ++G+E+  +  L+ ++  G+ +GKENA AALL+LC +     
Sbjct  685  DKAVAVLANLATIPEGRTSIGQEQ-GIPVLVEVVELGSARGKENAAAALLQLCTNSNRFC  743

Query  301  TERVLK---APALAGLLQSLLFTGTkrarrkaaslaRVFQRCEHASMHYG  161
            +  VL+    P L  L QS    GT RAR KA +L  VF+   H +   G
Sbjct  744  S-LVLQEGAVPPLVALSQS----GTPRAREKAQTLLSVFRNQRHGNSGRG  788



>ref|XP_002524955.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF37452.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=799

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 56/144 (39%), Positives = 78/144 (54%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G V  L  LL +G+ RGKKDA TALFNLS   EN AR++ +GAV  LV  + 
Sbjct  632  KVRIG-RSGAVGPLVDLLGNGTPRGKKDAATALFNLSIFHENKARIVQAGAVKHLVELMD  690

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G  A+G +E  +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  691  PAAGMVDKAVAVLANLATIPEGRTAIG-QEGGIPVLVEVVELGSARGKENAAAALLQLCT  749

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +        + +   P L  L QS
Sbjct  750  NSNRFCNTVLQEGAVPPLVALSQS  773



>ref|XP_010942970.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 
[Elaeis guineensis]
Length=847

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = -2

Query  676  KKRIAEQDGGVEALAGLLRDGSLRGKKDAVTALFNLSTHTENCARMIDSGAVNALvgalg  497
            K RI  + G ++ L  LL +G+ RGKKDA TALFNLS   E+  R++ +GAV  LV  + 
Sbjct  668  KVRIG-RSGAIKPLVELLGNGTPRGKKDAATALFNLSIFHEHKGRIVQAGAVKHLVELMD  726

Query  496  cegvaeeaagalaliVRQ-PIGAAAVGKEETAVAGLIGMMRCGTPKGKENAVAALLELCR  320
                  + A A+   +   P G AA+G     +  L+ ++  G+ +GKENA AALL+LC 
Sbjct  727  PAAGMVDKAVAVLANLATIPEGRAAIG-HSGGIPVLVEVVELGSARGKENAAAALLQLCT  785

Query  319  SGGEAATERVLKA--PALAGLLQS  254
            +     T+ + +   P L  L QS
Sbjct  786  NSNRFCTQVLQEGAVPPLVALSQS  809



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240