BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032O23

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAH59425.1|  amino acid permease                                    254   5e-82   Plantago major [cart-track plant]
ref|XP_011099674.1|  PREDICTED: amino acid permease 2-like              251   3e-77   Sesamum indicum [beniseed]
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   249   1e-76   Vitis vinifera
emb|CAN61092.1|  hypothetical protein VITISV_005276                     249   1e-76   Vitis vinifera
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              250   1e-76   Populus euphratica
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             249   2e-76   
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             247   1e-75   Populus trichocarpa [western balsam poplar]
ref|XP_006382883.1|  amino acid permease AAP1 family protein            247   1e-75   Populus trichocarpa [western balsam poplar]
gb|KJB75356.1|  hypothetical protein B456_012G038000                    247   2e-75   Gossypium raimondii
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        246   2e-75   Vitis vinifera
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        246   3e-75   
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   246   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        246   4e-75   Prunus mume [ume]
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        245   4e-75   Prunus mume [ume]
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        245   4e-75   Prunus mume [ume]
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             245   4e-75   Prunus persica
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    245   5e-75   Populus euphratica
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    245   5e-75   Populus euphratica
emb|CAN65437.1|  hypothetical protein VITISV_038918                     245   7e-75   Vitis vinifera
ref|XP_004160712.1|  PREDICTED: amino acid permease 3-like              241   2e-74   
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              243   3e-74   Nelumbo nucifera [Indian lotus]
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    242   7e-74   
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              242   8e-74   Cucumis melo [Oriental melon]
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              242   9e-74   Eucalyptus grandis [rose gum]
gb|KJB33339.1|  hypothetical protein B456_006G007300                    241   1e-73   Gossypium raimondii
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              241   2e-73   Cucumis sativus [cucumbers]
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       241   2e-73   
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    241   3e-73   Prunus mume [ume]
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             241   3e-73   
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    241   3e-73   Prunus mume [ume]
gb|KJB16327.1|  hypothetical protein B456_002G223200                    236   7e-73   Gossypium raimondii
gb|KHG16478.1|  Amino acid permease 2 -like protein                     239   8e-73   Gossypium arboreum [tree cotton]
gb|KJB16326.1|  hypothetical protein B456_002G223200                    236   9e-73   Gossypium raimondii
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              238   3e-72   Pyrus x bretschneideri [bai li]
ref|XP_010537371.1|  PREDICTED: amino acid permease 3                   238   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              237   9e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_196484.1|  amino acid permease 2                                 237   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61227.1|  amino acid transport protein AAP2                       237   1e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78353.1|  BnaA03g02650D                                          236   1e-71   
gb|KJB59301.1|  hypothetical protein B456_009G248600                    236   1e-71   Gossypium raimondii
gb|KJB16325.1|  hypothetical protein B456_002G223200                    236   1e-71   Gossypium raimondii
gb|KHG20963.1|  Amino acid permease 3 -like protein                     236   2e-71   Gossypium arboreum [tree cotton]
gb|KDO57534.1|  hypothetical protein CISIN_1g015342mg                   234   2e-71   Citrus sinensis [apfelsine]
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             236   2e-71   
ref|NP_201190.1|  amino acid permease 4                                 235   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   235   3e-71   Brassica rapa
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             235   3e-71   Capsella rubella
emb|CAA54631.1|  amino acid transporter                                 235   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   235   4e-71   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO80515.1|  hypothetical protein CISIN_1g0115802mg                  231   4e-71   Citrus sinensis [apfelsine]
ref|XP_011458812.1|  PREDICTED: amino acid permease 3-like isofor...    235   4e-71   Fragaria vesca subsp. vesca
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like isofor...    235   4e-71   Fragaria vesca subsp. vesca
ref|NP_177862.1|  amino acid permease 3                                 234   6e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             234   6e-71   
gb|AAM13223.1|  amino acid transporter AAP4                             234   6e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62803.1|  amino acid carrier, putative                            234   6e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   234   6e-71   Brassica rapa
ref|XP_007019168.1|  Amino acid permease isoform 2                      235   6e-71   Theobroma cacao [chocolate]
ref|XP_007019167.1|  Amino acid permease isoform 1                      234   6e-71   
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             234   7e-71   Capsella rubella
gb|KHG27248.1|  Amino acid permease 3 -like protein                     234   8e-71   Gossypium arboreum [tree cotton]
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             234   1e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              234   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX81121.1|  BnaC03g03750D                                          233   2e-70   
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              233   2e-70   Camelina sativa [gold-of-pleasure]
emb|CDX69918.1|  BnaA10g22670D                                          233   2e-70   
emb|CAF22024.1|  amino acid permease                                    233   2e-70   Brassica napus [oilseed rape]
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   233   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              233   3e-70   
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              233   3e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             233   3e-70   Citrus clementina [clementine]
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              233   3e-70   Citrus sinensis [apfelsine]
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             232   4e-70   
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    233   4e-70   Populus euphratica
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             233   4e-70   Capsella rubella
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             233   4e-70   Populus trichocarpa [western balsam poplar]
gb|AAM61320.1|  amino acid transporter AAP4                             232   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    233   4e-70   Populus euphratica
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             232   4e-70   Citrus clementina [clementine]
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             232   4e-70   
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              233   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              232   6e-70   Phoenix dactylifera
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       231   7e-70   Solanum lycopersicum
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              232   7e-70   
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             231   7e-70   
ref|XP_006386355.1|  amino acid permease which transports basic a...    231   8e-70   Populus trichocarpa [western balsam poplar]
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             231   9e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    232   9e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    232   9e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   232   1e-69   Phoenix dactylifera
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                231   1e-69   Erythranthe guttata [common monkey flower]
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                232   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   231   1e-69   Brassica rapa
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              231   1e-69   Solanum tuberosum [potatoes]
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              231   1e-69   Populus euphratica
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              231   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              231   2e-69   Camelina sativa [gold-of-pleasure]
ref|XP_010095435.1|  hypothetical protein L484_013392                   231   2e-69   
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   230   2e-69   
emb|CDX88364.1|  BnaC06g38080D                                          230   2e-69   
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   230   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   230   3e-69   Glycine max [soybeans]
emb|CDY21569.1|  BnaC09g47230D                                          230   4e-69   Brassica napus [oilseed rape]
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    230   4e-69   Setaria italica
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              229   6e-69   Eucalyptus grandis [rose gum]
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              229   6e-69   Sesamum indicum [beniseed]
emb|CDX87522.1|  BnaA07g33510D                                          229   6e-69   
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              229   7e-69   Populus euphratica
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              229   7e-69   Camelina sativa [gold-of-pleasure]
ref|NP_001234606.1|  amino acid transporter                             228   1e-68   
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             229   1e-68   Phaseolus vulgaris [French bean]
emb|CAC51425.1|  amino acid permease AAP4                               228   1e-68   Vicia faba var. minor [tick bean]
ref|XP_010546307.1|  PREDICTED: amino acid permease 2 isoform X2        226   2e-68   Tarenaya hassleriana [spider flower]
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    228   3e-68   Arabis alpina [alpine rockcress]
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   228   3e-68   Vitis vinifera
ref|XP_011002450.1|  PREDICTED: amino acid permease 3-like              228   3e-68   Populus euphratica
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              227   4e-68   Camelina sativa [gold-of-pleasure]
emb|CDY39844.1|  BnaC02g42740D                                          227   4e-68   Brassica napus [oilseed rape]
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              227   5e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN44307.1|  Amino acid permease 3                                   227   5e-68   Glycine soja [wild soybean]
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    227   5e-68   Glycine max [soybeans]
ref|XP_004289864.1|  PREDICTED: amino acid permease 4-like              228   7e-68   Fragaria vesca subsp. vesca
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   226   7e-68   Brassica rapa
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              226   7e-68   Nicotiana sylvestris
ref|XP_002520322.1|  amino acid transporter, putative                   226   8e-68   
ref|XP_006383588.1|  hypothetical protein POPTR_0005s20390g             226   8e-68   Populus trichocarpa [western balsam poplar]
emb|CDY31348.1|  BnaA02g33930D                                          226   9e-68   Brassica napus [oilseed rape]
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        226   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              226   1e-67   Brachypodium distachyon [annual false brome]
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             226   1e-67   Prunus persica
emb|CAA10608.1|  amino acid carrier                                     226   1e-67   Ricinus communis
ref|XP_011027691.1|  PREDICTED: amino acid permease 3-like              223   1e-67   Populus euphratica
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              226   1e-67   Nicotiana tomentosiformis
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    226   2e-67   Elaeis guineensis
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              225   2e-67   
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              226   2e-67   Prunus mume [ume]
emb|CDX88365.1|  BnaC06g38090D                                          225   2e-67   
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              226   2e-67   Elaeis guineensis
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    226   2e-67   Elaeis guineensis
ref|XP_002520323.1|  amino acid transporter, putative                   225   2e-67   
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    225   3e-67   
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    225   3e-67   Nicotiana tomentosiformis
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              225   4e-67   
gb|KHN39882.1|  Amino acid permease 2                                   224   4e-67   Glycine soja [wild soybean]
emb|CDY43761.1|  BnaA06g22970D                                          224   4e-67   Brassica napus [oilseed rape]
ref|XP_009150448.1|  PREDICTED: amino acid permease 4                   224   4e-67   Brassica rapa
gb|AIL30502.1|  amino acid transporter                                  224   5e-67   Nicotiana tabacum [American tobacco]
gb|KDP32819.1|  hypothetical protein JCGZ_12111                         224   5e-67   Jatropha curcas
ref|XP_002306650.2|  hypothetical protein POPTR_0005s20400g             224   5e-67   Populus trichocarpa [western balsam poplar]
gb|AII99817.1|  amino acid transporter                                  224   5e-67   Nicotiana tabacum [American tobacco]
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              224   6e-67   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              224   7e-67   Pyrus x bretschneideri [bai li]
ref|NP_001149036.1|  amino acid carrier                                 224   7e-67   
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             224   7e-67   Eutrema salsugineum [saltwater cress]
gb|AIS71894.1|  amino acid transporter                                  224   8e-67   Nicotiana tabacum [American tobacco]
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           224   8e-67   
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              224   9e-67   
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              224   9e-67   Populus euphratica
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              224   9e-67   Populus euphratica
gb|AAK33098.1|  amino acid transporter                                  224   1e-66   Glycine max [soybeans]
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              224   1e-66   Glycine max [soybeans]
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              223   1e-66   Cucumis melo [Oriental melon]
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          223   1e-66   
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             224   1e-66   Prunus persica
gb|EMS58805.1|  hypothetical protein TRIUR3_05113                       216   2e-66   Triticum urartu
ref|XP_010090330.1|  hypothetical protein L484_024995                   224   2e-66   Morus notabilis
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              223   2e-66   Prunus mume [ume]
ref|XP_009421017.1|  PREDICTED: amino acid permease 3-like              221   2e-66   
emb|CDX84450.1|  BnaC03g50500D                                          222   2e-66   
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                223   2e-66   Erythranthe guttata [common monkey flower]
gb|KJB80668.1|  hypothetical protein B456_013G109500                    221   3e-66   Gossypium raimondii
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   223   3e-66   Glycine max [soybeans]
gb|KHN25477.1|  Amino acid permease 2                                   223   3e-66   Glycine soja [wild soybean]
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              222   4e-66   
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    223   4e-66   
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              222   4e-66   Nicotiana sylvestris
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              223   5e-66   Cicer arietinum [garbanzo]
ref|XP_002312967.2|  hypothetical protein POPTR_0009s13610g             220   5e-66   
gb|ACR35411.1|  unknown                                                 218   5e-66   Zea mays [maize]
gb|EMT11988.1|  hypothetical protein F775_30582                         219   6e-66   
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         221   7e-66   Jatropha curcas
dbj|BAJ95327.1|  predicted protein                                      221   7e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX56951.1|  amino acid transporter                                  221   8e-66   Pisum sativum [garden pea]
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              221   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA70778.1|  amino acid transporter                                 221   1e-65   Vicia faba [broad bean]
emb|CDO96925.1|  unnamed protein product                                221   1e-65   Coffea canephora [robusta coffee]
gb|EPS68727.1|  hypothetical protein M569_06043                         211   1e-65   Genlisea aurea
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              221   2e-65   Phoenix dactylifera
dbj|BAK03421.1|  predicted protein                                      220   2e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO68036.1|  hypothetical protein CISIN_1g010376mg                   214   2e-65   Citrus sinensis [apfelsine]
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              221   3e-65   Eucalyptus grandis [rose gum]
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    220   3e-65   Cicer arietinum [garbanzo]
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             220   3e-65   
dbj|BAK03497.1|  predicted protein                                      220   4e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          220   4e-65   
emb|CDM85442.1|  unnamed protein product                                219   4e-65   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001045010.1|  Os01g0882800                                       219   4e-65   
emb|CDP10973.1|  unnamed protein product                                219   4e-65   Coffea canephora [robusta coffee]
gb|KEH35328.1|  transmembrane amino acid transporter family protein     219   4e-65   Medicago truncatula
emb|CDM85443.1|  unnamed protein product                                219   5e-65   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              220   5e-65   Elaeis guineensis
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             219   5e-65   Phaseolus vulgaris [French bean]
ref|NP_001055592.1|  Os05g0424000                                       219   7e-65   
ref|XP_004290905.1|  PREDICTED: amino acid permease 3-like              218   9e-65   Fragaria vesca subsp. vesca
ref|NP_001142349.1|  hypothetical protein                               219   9e-65   Zea mays [maize]
gb|KDO68037.1|  hypothetical protein CISIN_1g010376mg                   216   1e-64   Citrus sinensis [apfelsine]
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              219   1e-64   Populus euphratica
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         219   2e-64   Jatropha curcas
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              218   2e-64   Nicotiana tomentosiformis
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              218   2e-64   
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              218   2e-64   
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                218   2e-64   Erythranthe guttata [common monkey flower]
gb|KEH35330.1|  transmembrane amino acid transporter family protein     217   3e-64   Medicago truncatula
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              217   3e-64   Eucalyptus grandis [rose gum]
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             218   4e-64   Citrus clementina [clementine]
gb|KEH30491.1|  transmembrane amino acid transporter family protein     218   4e-64   Medicago truncatula
gb|KEH30492.1|  transmembrane amino acid transporter family protein     218   4e-64   Medicago truncatula
gb|KHN19623.1|  Amino acid permease 3                                   217   4e-64   Glycine soja [wild soybean]
gb|KDO68034.1|  hypothetical protein CISIN_1g010376mg                   214   4e-64   Citrus sinensis [apfelsine]
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    217   4e-64   Glycine max [soybeans]
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    216   6e-64   Brachypodium distachyon [annual false brome]
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              216   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009342937.1|  PREDICTED: amino acid permease 2-like              214   7e-64   Pyrus x bretschneideri [bai li]
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    216   7e-64   Brachypodium distachyon [annual false brome]
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              216   8e-64   Prunus mume [ume]
ref|XP_006645132.1|  PREDICTED: amino acid permease 2-like              216   1e-63   Oryza brachyantha
ref|XP_009764610.1|  PREDICTED: amino acid permease 3-like isofor...    213   2e-63   Nicotiana sylvestris
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              216   2e-63   Citrus sinensis [apfelsine]
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              215   2e-63   Eucalyptus grandis [rose gum]
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   216   2e-63   Citrus sinensis [apfelsine]
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        215   2e-63   Sesamum indicum [beniseed]
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        215   2e-63   Sesamum indicum [beniseed]
gb|AFK37021.1|  unknown                                                 216   2e-63   Medicago truncatula
ref|XP_003630316.1|  Amino acid permease                                214   4e-63   
ref|XP_004503904.1|  PREDICTED: amino acid permease 2-like              214   5e-63   Cicer arietinum [garbanzo]
gb|AAX56952.1|  amino acid transporter                                  213   5e-63   Pisum sativum [garden pea]
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              214   6e-63   Pyrus x bretschneideri [bai li]
gb|KJB15783.1|  hypothetical protein B456_002G196200                    214   6e-63   Gossypium raimondii
gb|KEH40510.1|  transmembrane amino acid transporter family protein     213   9e-63   Medicago truncatula
emb|CAH59424.1|  amino acid permease                                    204   1e-62   Plantago major [cart-track plant]
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    213   2e-62   Nicotiana sylvestris
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    212   2e-62   Tarenaya hassleriana [spider flower]
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        212   2e-62   Glycine max [soybeans]
ref|XP_002534252.1|  amino acid transporter, putative                   212   2e-62   
emb|CDY60629.1|  BnaAnng17090D                                          210   3e-62   Brassica napus [oilseed rape]
gb|KHN16938.1|  Amino acid permease 2                                   210   4e-62   Glycine soja [wild soybean]
ref|NP_175076.2|  amino acid permease 5                                 211   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          212   5e-62   Amborella trichopoda
gb|AAG50558.1|AC074228_13  amino acid permease, putative                211   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    213   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_003524313.1|  PREDICTED: amino acid permease 2-like              211   5e-62   Glycine max [soybeans]
ref|XP_007224395.1|  hypothetical protein PRUPE_ppa021701mg             211   5e-62   Prunus persica
emb|CDY36017.1|  BnaA08g04440D                                          211   5e-62   Brassica napus [oilseed rape]
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   211   5e-62   Tarenaya hassleriana [spider flower]
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              211   5e-62   Solanum tuberosum [potatoes]
gb|ABR18002.1|  unknown                                                 211   6e-62   Picea sitchensis
emb|CAA54632.1|  amino acid permease                                    211   7e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    210   9e-62   
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             210   1e-61   Eutrema salsugineum [saltwater cress]
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    211   1e-61   
dbj|BAO45885.1|  amino acid permease                                    210   2e-61   Acacia mangium
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              210   2e-61   Solanum tuberosum [potatoes]
gb|AFW65566.1|  hypothetical protein ZEAMMB73_193502                    201   2e-61   
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   210   2e-61   Brassica rapa
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              209   3e-61   Brassica rapa
gb|EMS65401.1|  hypothetical protein TRIUR3_22906                       206   4e-61   Triticum urartu
dbj|BAJ86012.1|  predicted protein                                      209   4e-61   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             209   4e-61   Phaseolus vulgaris [French bean]
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             209   5e-61   Phaseolus vulgaris [French bean]
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             209   6e-61   Phaseolus vulgaris [French bean]
emb|CAN77083.1|  hypothetical protein VITISV_003992                     210   7e-61   Vitis vinifera
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             208   8e-61   Capsella rubella
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              208   9e-61   Malus domestica [apple tree]
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             207   2e-60   
gb|KCW82484.1|  hypothetical protein EUGRSUZ_C03879                     206   4e-60   Eucalyptus grandis [rose gum]
ref|XP_007161468.1|  hypothetical protein PHAVU_001G071500g             204   5e-60   Phaseolus vulgaris [French bean]
gb|KGN54767.1|  hypothetical protein Csa_4G470690                       201   7e-60   
gb|AFW65567.1|  hypothetical protein ZEAMMB73_193502                    202   8e-60   
ref|XP_010461433.1|  PREDICTED: amino acid permease 5-like              203   9e-60   
ref|XP_010051605.1|  PREDICTED: amino acid permease 3-like              205   1e-59   
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        205   1e-59   
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    204   1e-59   
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              202   4e-59   
emb|CAC51423.1|  amino acid permease AAP1                               203   4e-59   
ref|NP_001233979.1|  amino acid transporter                             203   5e-59   
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              202   7e-59   
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              202   7e-59   
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              202   8e-59   
gb|EMT28649.1|  hypothetical protein F775_26310                         203   1e-58   
gb|KHN31184.1|  Amino acid permease 2                                   197   1e-58   
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              202   1e-58   
ref|XP_006578775.1|  PREDICTED: amino acid permease 3-like isofor...    202   1e-58   
gb|EPS60160.1|  hypothetical protein M569_14643                         198   2e-58   
ref|XP_006578773.1|  PREDICTED: amino acid permease 3-like isofor...    202   2e-58   
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              201   2e-58   
ref|XP_004978920.1|  PREDICTED: amino acid permease 3-like              201   2e-58   
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          201   3e-58   
ref|XP_007226332.1|  hypothetical protein PRUPE_ppa022253mg             201   3e-58   
gb|EPS61237.1|  amino acid transporter                                  197   4e-58   
ref|XP_008219593.1|  PREDICTED: amino acid permease 3-like              200   9e-58   
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              199   1e-57   
gb|KCW82236.1|  hypothetical protein EUGRSUZ_C03655                     199   1e-57   
ref|NP_001170050.1|  uncharacterized protein LOC100383966               199   1e-57   
ref|XP_003602669.1|  Amino acid permease                                199   2e-57   
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    199   2e-57   
ref|XP_006581783.1|  PREDICTED: amino acid permease 3-like isofor...    199   2e-57   
gb|EEE52230.1|  hypothetical protein OsJ_34158                          198   2e-57   
gb|EEC81839.1|  hypothetical protein OsI_25597                          198   2e-57   
ref|XP_006581782.1|  PREDICTED: amino acid permease 3-like isofor...    199   3e-57   
ref|XP_010051542.1|  PREDICTED: amino acid permease 3-like              199   3e-57   
gb|KCW82488.1|  hypothetical protein EUGRSUZ_C03884                     197   4e-57   
ref|NP_001067425.1|  Os11g0195600                                       198   5e-57   
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             198   6e-57   
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              198   6e-57   
ref|XP_010653015.1|  PREDICTED: amino acid permease 4-like              198   6e-57   
gb|KCW82485.1|  hypothetical protein EUGRSUZ_C03880                     196   8e-57   
ref|XP_010051607.1|  PREDICTED: amino acid permease 3-like              197   1e-56   
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          197   1e-56   
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              197   2e-56   
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              197   2e-56   
ref|XP_006856753.1|  hypothetical protein AMTR_s00055p00034490          187   2e-56   
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              196   3e-56   
ref|XP_004977213.1|  PREDICTED: amino acid permease 3-like              196   3e-56   
ref|XP_004502977.1|  PREDICTED: amino acid permease 3-like              195   7e-56   
emb|CDY47793.1|  BnaC06g00580D                                          194   1e-55   
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    201   1e-55   
ref|NP_001140430.1|  hypothetical protein                               194   1e-55   
gb|EAY84081.1|  hypothetical protein OsI_05462                          194   1e-55   
ref|XP_002442926.1|  hypothetical protein SORBIDRAFT_08g005000          194   1e-55   
ref|XP_004977211.1|  PREDICTED: amino acid permease 3-like              194   2e-55   
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    200   2e-55   
gb|KCW82487.1|  hypothetical protein EUGRSUZ_C03882                     191   3e-55   
ref|NP_001045595.1|  Os02g0102200                                       194   4e-55   
ref|XP_003602666.1|  Amino acid permease                                193   4e-55   
gb|KCW71228.1|  hypothetical protein EUGRSUZ_F04325                     192   4e-55   
ref|XP_004977212.1|  PREDICTED: amino acid permease 3-like              193   5e-55   
ref|XP_002442923.1|  hypothetical protein SORBIDRAFT_08g004960          192   1e-54   
ref|XP_010266973.1|  PREDICTED: amino acid permease 3-like              192   1e-54   
ref|XP_006356925.1|  PREDICTED: amino acid permease 3-like              191   1e-54   
dbj|BAJ91191.1|  predicted protein                                      185   2e-54   
ref|XP_009123048.1|  PREDICTED: amino acid permease 5                   191   2e-54   
ref|XP_010051606.1|  PREDICTED: amino acid permease 3-like              191   2e-54   
ref|XP_004977210.1|  PREDICTED: amino acid permease 3-like              191   3e-54   
gb|EEC72288.1|  hypothetical protein OsI_05459                          185   4e-54   
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              190   7e-54   
ref|NP_001168530.1|  uncharacterized protein LOC100382310 precursor     187   1e-53   
ref|XP_003577747.1|  PREDICTED: amino acid permease 3                   189   1e-53   
ref|XP_002441927.1|  hypothetical protein SORBIDRAFT_08g004980          189   1e-53   
gb|KGN60300.1|  hypothetical protein Csa_3G894480                       181   3e-53   
ref|XP_008674422.1|  PREDICTED: amino acid permease 3-like              187   8e-53   
gb|AFW56244.1|  hypothetical protein ZEAMMB73_131551                    187   8e-53   
ref|XP_002442925.1|  hypothetical protein SORBIDRAFT_08g004990          187   9e-53   
ref|XP_004290906.1|  PREDICTED: amino acid permease 3-like              187   9e-53   
ref|XP_003578826.1|  PREDICTED: amino acid permease 3-like              186   1e-52   
gb|AAD16014.1|  amino acid transporter                                  184   1e-52   
gb|EAY82481.1|  hypothetical protein OsI_37698                          186   2e-52   
gb|ADE75660.1|  unknown                                                 186   2e-52   
dbj|BAK02045.1|  predicted protein                                      186   2e-52   
ref|NP_001066316.1|  Os12g0181500                                       186   2e-52   
ref|NP_001066317.1|  Os12g0181600                                       186   3e-52   
gb|EEC68963.1|  hypothetical protein OsI_37697                          186   3e-52   
ref|XP_008466098.1|  PREDICTED: amino acid permease 6-like              181   3e-52   
ref|XP_010051603.1|  PREDICTED: amino acid permease 3-like              185   6e-52   
ref|XP_010025741.1|  PREDICTED: amino acid permease 4-like              185   7e-52   
ref|XP_002442927.1|  hypothetical protein SORBIDRAFT_08g005010          186   7e-52   
gb|KCW62470.1|  hypothetical protein EUGRSUZ_H05110                     185   7e-52   
gb|ABR16450.1|  unknown                                                 185   7e-52   
ref|XP_004502978.1|  PREDICTED: amino acid permease 2-like isofor...    184   9e-52   
ref|XP_004301080.1|  PREDICTED: amino acid permease 3-like              184   9e-52   
gb|KCW82234.1|  hypothetical protein EUGRSUZ_C03653                     182   1e-51   
gb|EMT28875.1|  hypothetical protein F775_29828                         183   1e-51   
ref|XP_010025740.1|  PREDICTED: amino acid permease 4-like              184   2e-51   
ref|XP_003578825.1|  PREDICTED: amino acid permease 4-like              183   2e-51   
ref|XP_001784036.1|  predicted protein                                  183   2e-51   
gb|AFW56242.1|  hypothetical protein ZEAMMB73_107595                    183   2e-51   
gb|AFK43956.1|  unknown                                                 175   4e-51   
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              182   4e-51   
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              182   5e-51   
gb|KHN09641.1|  Amino acid permease 2                                   182   9e-51   
gb|EMT07264.1|  hypothetical protein F775_06597                         181   9e-51   
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              182   1e-50   
dbj|BAJ93107.1|  predicted protein                                      182   1e-50   
gb|KDO81360.1|  hypothetical protein CISIN_1g011548mg                   177   2e-50   
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              180   3e-50   
gb|KDO81359.1|  hypothetical protein CISIN_1g011548mg                   177   3e-50   
gb|ABK22946.1|  unknown                                                 172   3e-50   
gb|KCW70650.1|  hypothetical protein EUGRSUZ_F03824                     180   4e-50   
gb|EMS57663.1|  hypothetical protein TRIUR3_25238                       179   4e-50   
gb|EMT26484.1|  hypothetical protein F775_32730                         180   4e-50   
ref|XP_004502980.1|  PREDICTED: amino acid permease 2-like isofor...    180   4e-50   
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   180   5e-50   
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             179   6e-50   
gb|KCW62466.1|  hypothetical protein EUGRSUZ_H05106                     175   7e-50   
ref|XP_007018375.1|  Amino acid permease 6                              179   7e-50   
gb|KDO49532.1|  hypothetical protein CISIN_1g046038mg                   174   7e-50   
gb|KCW71229.1|  hypothetical protein EUGRSUZ_F04327                     177   8e-50   
ref|XP_006422746.1|  hypothetical protein CICLE_v100286921mg            173   9e-50   
gb|ADB92670.1|  amino acid permease 6                                   179   9e-50   
emb|CDY49542.1|  BnaCnng17660D                                          171   1e-49   
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              179   1e-49   
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             179   1e-49   
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              178   2e-49   
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              178   2e-49   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              178   2e-49   
ref|XP_003602671.1|  Amino acid permease                                177   3e-49   
dbj|BAJ91439.1|  predicted protein                                      178   3e-49   
emb|CAC51424.1|  amino acid permease AAP3                               178   3e-49   
ref|XP_003602670.1|  Amino acid permease                                177   3e-49   
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             177   3e-49   
ref|XP_010063932.1|  PREDICTED: amino acid permease 3-like              177   4e-49   
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             177   4e-49   
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   177   5e-49   
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                177   5e-49   
ref|XP_008378686.1|  PREDICTED: amino acid permease 6-like              169   6e-49   
ref|NP_001057853.1|  Os06g0556000                                       177   7e-49   
ref|XP_004496860.1|  PREDICTED: amino acid permease 6-like              176   8e-49   
emb|CAD92449.1|  amino acid permease 1                                  176   9e-49   
ref|XP_002510013.1|  amino acid transporter, putative                   176   1e-48   
gb|KJB64021.1|  hypothetical protein B456_010G029800                    176   1e-48   
emb|CDY53793.1|  BnaCnng25620D                                          176   1e-48   
gb|KHG13110.1|  Amino acid permease 6 -like protein                     174   2e-48   
ref|XP_002442913.1|  hypothetical protein SORBIDRAFT_08g004810          176   2e-48   
gb|KJB64022.1|  hypothetical protein B456_010G029800                    176   2e-48   
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              175   2e-48   
gb|KEH43993.1|  transmembrane amino acid transporter family protein     175   3e-48   
emb|CAA70969.1|  amino acid transporter                                 172   3e-48   
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              175   4e-48   
gb|KEH43996.1|  transmembrane amino acid transporter family protein     174   4e-48   
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             174   4e-48   
emb|CDY63746.1|  BnaC05g07760D                                          172   5e-48   
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             174   5e-48   
gb|KJB58749.1|  hypothetical protein B456_009G224500                    176   5e-48   
emb|CDY48843.1|  BnaA09g14700D                                          174   5e-48   
ref|XP_002301129.2|  amino acid transport protein AAP2                  174   6e-48   
ref|XP_010027424.1|  PREDICTED: amino acid permease 4-like              176   7e-48   
ref|XP_003638241.1|  Amino acid permease                                176   7e-48   
ref|XP_006307429.1|  hypothetical protein CARUB_v10009053mg             174   8e-48   
ref|XP_007143143.1|  hypothetical protein PHAVU_007G047400g             173   9e-48   
gb|KCW62469.1|  hypothetical protein EUGRSUZ_H05109                     173   1e-47   
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              173   1e-47   
gb|ABK24505.1|  unknown                                                 173   1e-47   
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         173   1e-47   
gb|AFW86930.1|  hypothetical protein ZEAMMB73_950309                    170   1e-47   
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              173   1e-47   
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   173   1e-47   
emb|CDP08191.1|  unnamed protein product                                173   2e-47   
gb|KJB14684.1|  hypothetical protein B456_002G137400                    173   2e-47   
ref|XP_009627462.1|  PREDICTED: amino acid permease 6-like              172   2e-47   
ref|NP_176132.1|  amino acid permease 1                                 172   2e-47   
gb|AAB87674.1|  neutral amino acid transport system II                  172   2e-47   
emb|CDY44564.1|  BnaA01g21750D                                          173   2e-47   
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              172   2e-47   
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                172   2e-47   
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              172   3e-47   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              172   4e-47   
emb|CDP00978.1|  unnamed protein product                                172   4e-47   
ref|XP_009792204.1|  PREDICTED: amino acid permease 6-like              172   4e-47   
ref|NP_172472.1|  amino acid permease 8                                 172   4e-47   
ref|XP_008368120.1|  PREDICTED: amino acid permease 6-like              165   5e-47   
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              171   6e-47   
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             171   6e-47   
ref|XP_010058357.1|  PREDICTED: amino acid permease 3-like              171   6e-47   
ref|NP_001233983.1|  amino acid transporter                             171   7e-47   
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   171   7e-47   
emb|CDP00979.1|  unnamed protein product                                171   7e-47   
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   171   8e-47   
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     171   8e-47   
ref|XP_002889784.1|  hypothetical protein ARALYDRAFT_888258             171   1e-46   
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             171   1e-46   
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             171   1e-46   
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          171   1e-46   
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    171   1e-46   
gb|EMT16213.1|  hypothetical protein F775_29086                         169   1e-46   
emb|CAA70968.2|  amino acid transporter                                 170   2e-46   
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              170   2e-46   
gb|KHG24473.1|  Amino acid permease 6 -like protein                     170   2e-46   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    170   2e-46   
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             170   2e-46   
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    170   2e-46   
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   170   2e-46   
emb|CDY04349.1|  BnaC04g18440D                                          170   2e-46   
gb|KEH43995.1|  transmembrane amino acid transporter family protein     170   2e-46   
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              170   3e-46   
ref|XP_009118278.1|  PREDICTED: amino acid permease 8-like              170   3e-46   
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   169   3e-46   
gb|EMS56484.1|  hypothetical protein TRIUR3_26560                       172   3e-46   
ref|XP_009118276.1|  PREDICTED: amino acid permease 8-like isofor...    169   3e-46   
ref|XP_010475860.1|  PREDICTED: amino acid permease 8-like              169   4e-46   
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              169   4e-46   
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    169   4e-46   
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              169   4e-46   
ref|XP_010250334.1|  PREDICTED: amino acid permease 4-like              170   5e-46   
emb|CDY60248.1|  BnaC01g42990D                                          169   5e-46   
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              169   5e-46   
gb|KCW62461.1|  hypothetical protein EUGRSUZ_H05097                     169   5e-46   
gb|EMT23821.1|  hypothetical protein F775_31800                         166   6e-46   
emb|CDY22607.1|  BnaC08g42410D                                          169   7e-46   
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   168   9e-46   
gb|AFK46687.1|  unknown                                                 164   9e-46   
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              168   1e-45   



>emb|CAH59425.1| amino acid permease [Plantago major]
Length=193

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK+  AKWPD E IT +I + IPG
Sbjct  26   FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKYANAKWPDREFITNDIEIPIPG  85

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY+LN FRL+WRTAFV+LTTVISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  86   LQEPYRLNFFRLVWRTAFVILTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  145

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+WICLQMLS ACL +S+AAAAGS AGV+LDLK+Y+PFKTSY
Sbjct  146  KIPKWSTKWICLQMLSMACLVISIAAAAGSVAGVILDLKVYKPFKTSY  193



>ref|XP_011099674.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
 ref|XP_011099676.1| PREDICTED: amino acid permease 2-like [Sesamum indicum]
Length=491

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 151/168 (90%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF+EK   A+WPD   ITKEI+++IP 
Sbjct  324  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKHAAARWPDSGFITKEISIRIPC  383

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY LN FRL+WR+ FV+LTTVISMLLPFFND+VGILGAFGFWPLTVYFPV MYI+QK
Sbjct  384  LQQPYNLNMFRLVWRSVFVVLTTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIAQK  443

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +I +WSTRWICLQMLS ACLA+S+AAAAGS AGVVLDLK+YRPFKTSY
Sbjct  444  RIARWSTRWICLQMLSFACLAISIAAAAGSVAGVVLDLKVYRPFKTSY  491



>ref|XP_003634405.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
Length=483

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW   K+PD + ITKEI + IPG
Sbjct  317  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWAAEKFPDSQFITKEIKIPIPG  376

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  377  FK-PYNLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  435

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFKTSY
Sbjct  436  KIPKWSTRWLCLQILSFACLIISIAAAAGSVAGVILDLKVYKPFKTSY  483



>emb|CAN61092.1| hypothetical protein VITISV_005276 [Vitis vinifera]
 emb|CBI18979.3| unnamed protein product [Vitis vinifera]
Length=481

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 152/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAFIEKW   K+PD + ITKEI + IPG
Sbjct  315  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWAAEKFPDSQFITKEIKIPIPG  374

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  375  FK-PYNLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  433

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFKTSY
Sbjct  434  KIPKWSTRWLCLQILSFACLIISIAAAAGSVAGVILDLKVYKPFKTSY  481



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIVIHLVGAYQV+CQPLFAFIEKW   KWP    ITKE N+ +PG
Sbjct  327  FGFYNPYWLIDIANAAIVIHLVGAYQVFCQPLFAFIEKWANQKWPGSYFITKEFNIAVPG  386

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  YKLN FRL+WRT FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  387  YGL-YKLNLFRLVWRTIFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQK  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK Y+PFKTSY
Sbjct  446  KIPKWSTRWICLQMLSMACLVISLVAVAGSVAGVVLDLKAYKPFKTSY  493



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIVIHLVGAYQV+CQPLFAFIEKW   KWP+   ITKE N+ +PG
Sbjct  326  FGFYNPYWLIDIANAAIVIHLVGAYQVFCQPLFAFIEKWANQKWPESYFITKEFNIAVPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL+WRT FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  LGL-YKLNLFRLVWRTIFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQR  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK Y+PFKTSY
Sbjct  445  KIPKWSTRWICLQMLSMACLVISLVAVAGSLAGVVLDLKAYKPFKTSY  492



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLFAFIEKW   KWP+   ITKE  + +PG
Sbjct  328  FGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPG  387

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FR++WRT FVLLTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  388  F-RPYKLNLFRMVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQK  446

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK+Y+PFKTSY
Sbjct  447  KIPKWSTRWICLQMLSMACLVISLVAVAGSIAGVVLDLKVYKPFKTSY  494



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   247 bits (630),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLFAFIEKW   KWP+   ITKE  + +PG
Sbjct  326  FGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FR++WRT FVLLTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  386  F-RPYKLNLFRMVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK+Y+PFKTSY
Sbjct  445  KIPKWSTRWICLQMLSMACLVISLVAVAGSIAGVVLDLKVYKPFKTSY  492



>gb|KJB75356.1| hypothetical protein B456_012G038000 [Gossypium raimondii]
Length=519

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NPFWLLDIANAAI+IHLVGAYQV+CQP+FAFIEKW   +WP+   ITKE  + +PG
Sbjct  352  FGFFNPFWLLDIANAAIIIHLVGAYQVFCQPIFAFIEKWATQRWPESYFITKEFKIPVPG  411

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            + +PYKLN FRL+WRT FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  412  YRHPYKLNMFRLVWRTGFVMLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIQQK  471

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWS+RWICL+MLS ACL +S+ A AGS  GV+LDLK+Y+PFKT+Y
Sbjct  472  KISKWSSRWICLKMLSMACLMISIVAGAGSIVGVILDLKVYKPFKTTY  519



>ref|XP_010652912.1| PREDICTED: amino acid permease 3 isoform X1 [Vitis vinifera]
Length=489

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF EKW   KWP  + ITKEI + IPG
Sbjct  323  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPG  382

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  383  CS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLDLK+Y PFKTSY
Sbjct  442  KIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLDLKVYHPFKTSY  489



>ref|XP_002275881.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
 ref|XP_010652913.1| PREDICTED: amino acid permease 3 isoform X2 [Vitis vinifera]
Length=487

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF EKW   KWP  + ITKEI + IPG
Sbjct  321  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  381  CS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLDLK+Y PFKTSY
Sbjct  440  KIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLDLKVYHPFKTSY  487



>ref|XP_010270272.1| PREDICTED: amino acid permease 3 [Nelumbo nucifera]
Length=483

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    +W + + ITKEI + IPG
Sbjct  317  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSASERWSESKFITKEIKVPIPG  376

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WR+ FV+ TTVISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  377  F-RPYKLNLFRLVWRSVFVVATTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  435

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL VS+AAAAGS AGV LDLK+Y+PFKTSY
Sbjct  436  KIPKWSTRWLCLQILSFACLVVSIAAAAGSIAGVALDLKVYKPFKTSY  483



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   246 bits (627),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+ ++ITKE  + +PG
Sbjct  315  FGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPG  374

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  375  LP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  433

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  434  QIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  481



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+ ++ITKE  + +PG
Sbjct  316  FGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  376  LP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  435  QIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  482



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+ ++ITKE  + +PG
Sbjct  314  FGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  374  LP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  433  QIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EKW   +WP+ ++ITKE  + +PG
Sbjct  314  FGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +KLN FRL+WRT FV+LTT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  374  LP-SFKLNLFRLVWRTKFVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQMLS ACL +SL AAAGS AGV+LDLK+YRPFKTSY
Sbjct  433  QIPKWSTRWICLQMLSIACLVISLVAAAGSIAGVMLDLKVYRPFKTSY  480



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLFAFIEKW   KWP+   ITKE  + +PG
Sbjct  327  FGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPG  386

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FVLLTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  387  F-RPYNLNLFRLVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQK  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK Y+PFKTSY
Sbjct  446  KIPKWSTRWICLQMLSMACLVISLVAVAGSIAGVVLDLKAYKPFKTSY  493



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN AIVIHL+GAYQV+CQPLFAFIEKW   KWP+   ITKE  + +PG
Sbjct  328  FGFYNPYWLIDIANVAIVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPG  387

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FVLLTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  388  F-RPYNLNLFRLVWRTIFVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQK  446

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +SL A AGS AGVVLDLK Y+PFKTSY
Sbjct  447  KIPKWSTRWICLQMLSMACLVISLVAVAGSIAGVVLDLKAYKPFKTSY  494



>emb|CAN65437.1| hypothetical protein VITISV_038918 [Vitis vinifera]
Length=487

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 135/168 (80%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF EKW   KWP  + ITKEI + IPG
Sbjct  321  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFTEKWAAQKWPHSDFITKEIKIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ LN FRL+WR+AFV++TTVISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  381  CS-PFSLNLFRLVWRSAFVVVTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWICLQMLS ACL +S+AAAAGS AGVVLDLK+Y PFKTSY
Sbjct  440  KIPKWSTRWICLQMLSVACLIISIAAAAGSIAGVVLDLKVYHPFKTSY  487



>ref|XP_004160712.1| PREDICTED: amino acid permease 3-like, partial [Cucumis sativus]
Length=368

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+   K PD + ITK+I++ IPG
Sbjct  202  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPG  261

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WRTAFV++TTVISMLLPFFNDVVG LGA GFWPLTVY+PV MYI+QK
Sbjct  262  F-RPYKLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQK  320

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y+PFKTS+
Sbjct  321  KIPKWSSRWLCLQTLSFACLMISIAAAAGSIAGVVLDLKSYKPFKTSF  368



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 151/168 (90%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFW++DIANAA+VIHLVGAYQV+CQPLFAFIEKW   +WPD + IT EI + IPG
Sbjct  310  FGFYNPFWVIDIANAAVVIHLVGAYQVFCQPLFAFIEKWASQRWPDSKFITNEIKVPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WR+AFV+ TT+ISMLLPFFNDVVGILGAF FWPLTV+FPV+MYI+QK
Sbjct  370  F-CPYKLNLFRLVWRSAFVVATTIISMLLPFFNDVVGILGAFSFWPLTVFFPVQMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+ LQ+LS ACL +S+AAAAGS AGV+LDLK+Y+PFKTSY
Sbjct  429  KIPRWSTRWLSLQILSFACLVISVAAAAGSIAGVILDLKVYKPFKTSY  476



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   242 bits (618),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIVIHLVGAYQV+CQP+FAFIEKW   +W +   ITKE  + IPG
Sbjct  319  FGFYNPFWLLDVANAAIVIHLVGAYQVFCQPIFAFIEKWATQRWAESNFITKEFKIPIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            + +PYKLN FRL+WRTAFV+LTTVISML+PFFNDV+GI+GAFGFWPLTVYFP+ MYI QK
Sbjct  379  Y-HPYKLNLFRLVWRTAFVILTTVISMLIPFFNDVMGIMGAFGFWPLTVYFPLEMYIQQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRWICL+MLS ACL +++ A AGS AGV+LDLK+Y+PFKT+Y
Sbjct  438  KILKWSTRWICLKMLSMACLLITIVAGAGSIAGVMLDLKVYKPFKTTY  485



>ref|XP_008466753.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=478

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+   K PD E ITK+I++ IPG
Sbjct  312  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYAAEKSPDSEFITKDIDVPIPG  371

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WRTAFV+ TTVISMLLPFFNDVVG LGA GFWPLTVY+PV MYI+QK
Sbjct  372  F-RPYKLNLFRLVWRTAFVITTTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQK  430

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y+PFKTS+
Sbjct  431  KIPKWSSRWLCLQTLSFACLMISIAAAAGSVAGVVLDLKSYKPFKTSF  478



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQP+FAF+EK    +WPD E I +EI + +PG
Sbjct  328  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPIFAFVEKQAAQRWPDSEFIAREIKIPVPG  387

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y +N FRL+WRT FV LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  388  LG-QYNMNLFRLVWRTIFVTLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQK  446

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IP+WSTRW+CLQ+LS ACL +S+ AAAGS AGV+LDLK Y+PFKTSY
Sbjct  447  QIPRWSTRWLCLQVLSMACLVISIMAAAGSIAGVMLDLKSYQPFKTSY  494



>gb|KJB33339.1| hypothetical protein B456_006G007300 [Gossypium raimondii]
Length=476

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQV+CQP+F F+EKW   +WP+ + ITKE+ + +P 
Sbjct  308  FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPIFTFVEKWASQRWPESKTITKELKIPMPI  367

Query  425  FGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  249
             G+ PYKLN FRL+WRTAFV+LTTVISMLLPFF DVVGILGAFGFWPLTVYFPV MYI Q
Sbjct  368  RGFRPYKLNLFRLVWRTAFVMLTTVISMLLPFFGDVVGILGAFGFWPLTVYFPVEMYIEQ  427

Query  248  KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KKI KWS+RWICL+MLS  CL +S+ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  428  KKISKWSSRWICLKMLSMGCLMISILAGTGSIAGVILDLKVYKPFKTTY  476



>ref|XP_004149429.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
Length=478

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+   K PD + ITK+I++ IPG
Sbjct  312  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPG  371

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WRTAFV++TTVISMLLPFFNDVVG LGA GFWPLTVY+PV MYI+QK
Sbjct  372  F-RPYKLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQK  430

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y+PFKTS+
Sbjct  431  KIPKWSSRWLCLQTLSFACLMISIAAAAGSIAGVVLDLKSYKPFKTSF  478



>gb|KGN47695.1| hypothetical protein Csa_6G381850 [Cucumis sativus]
Length=476

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK+   K PD + ITK+I++ IPG
Sbjct  310  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKYASEKSPDSDFITKDIDVPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WRTAFV++TTVISMLLPFFNDVVG LGA GFWPLTVY+PV MYI+QK
Sbjct  370  F-RPYKLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGFLGALGFWPLTVYYPVEMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS+RW+CLQ LS ACL +S+AAAAGS AGVVLDLK Y+PFKTS+
Sbjct  429  KIPKWSSRWLCLQTLSFACLMISIAAAAGSIAGVVLDLKSYKPFKTSF  476



>ref|XP_008219592.1| PREDICTED: amino acid permease 3-like isoform X2 [Prunus mume]
Length=487

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK    K+PD + ITK+I L+IPG
Sbjct  321  FGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAFGFWPLTVYFPV MYI QK
Sbjct  381  IG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK+Y+PFKTSY
Sbjct  440  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLKVYKPFKTSY  487



>ref|XP_007222588.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
 gb|EMJ23787.1| hypothetical protein PRUPE_ppa004920mg [Prunus persica]
Length=485

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK    K+PD + ITK+I L+IPG
Sbjct  319  FGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAFGFWPLTVYFPV MYI QK
Sbjct  379  IG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK+Y+PFKTSY
Sbjct  438  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLKVYKPFKTSY  485



>ref|XP_008219591.1| PREDICTED: amino acid permease 3-like isoform X1 [Prunus mume]
Length=488

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVY QPLFAF+EK    K+PD + ITK+I L+IPG
Sbjct  322  FGFYNPYWLLDIANAAIVVHLVGAYQVYAQPLFAFVEKTAAQKFPDSDFITKDIRLQIPG  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAFGFWPLTVYFPV MYI QK
Sbjct  382  IG-PYNLNLFRMIWRTAFVIITTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQK  440

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK+Y+PFKTSY
Sbjct  441  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVVSDLKVYKPFKTSY  488



>gb|KJB16327.1| hypothetical protein B456_002G223200 [Gossypium raimondii]
Length=371

 Score =   236 bits (603),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  205  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAAKRFPDSEFITKDIKIPIPG  264

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQ 
Sbjct  265  F-RPYNLNLFRLVWRTIFVMLTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYISQN  323

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL++++AAAAGS AGV+LDLK Y+PF T+Y
Sbjct  324  KIAKWSTRWLCLQILSIACLSITIAAAAGSIAGVILDLKSYKPFSTAY  371



>gb|KHG16478.1| Amino acid permease 2 -like protein [Gossypium arboreum]
Length=476

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQV+CQP+F F+EKW   +WP+ + ITKE+ + +P 
Sbjct  308  FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPIFTFVEKWASQRWPESKTITKELKIPMPI  367

Query  425  FGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  249
             GY PYKLN FR +WRTAFV+LTTVISMLLPFF DVVGILGAFGFWPLTVYFPV MYI Q
Sbjct  368  RGYRPYKLNLFRSVWRTAFVMLTTVISMLLPFFGDVVGILGAFGFWPLTVYFPVEMYIEQ  427

Query  248  KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KKI KWS+RWICL+MLS +CL +S+ A  GS AGV+ DLK+Y+PFKT+Y
Sbjct  428  KKISKWSSRWICLKMLSMSCLMISILAGTGSIAGVIHDLKVYKPFKTTY  476



>gb|KJB16326.1| hypothetical protein B456_002G223200 [Gossypium raimondii]
Length=375

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  209  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAAKRFPDSEFITKDIKIPIPG  268

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQ 
Sbjct  269  F-RPYNLNLFRLVWRTIFVMLTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYISQN  327

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL++++AAAAGS AGV+LDLK Y+PF T+Y
Sbjct  328  KIAKWSTRWLCLQILSIACLSITIAAAAGSIAGVILDLKSYKPFSTAY  375



>ref|XP_009339426.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009339427.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009342935.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=489

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVY QPLFAF+EK    K+PD E ITK+I L+IPG
Sbjct  323  FGFYNPYWLLDIANAAIVIHLVGAYQVYAQPLFAFVEKTAAQKFPDSEFITKDIKLRIPG  382

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAFGFWPLTVYFPV MYI QK
Sbjct  383  IG-PYNLNLFRMIWRTAFVVITTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQK  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+CLQ LS  CL +++AAAAGS AGVV DLK+Y+PF  SY
Sbjct  442  RIPKWSTRWLCLQTLSVGCLMITIAAAAGSIAGVVSDLKVYKPFTASY  489



>ref|XP_010537371.1| PREDICTED: amino acid permease 3 [Tarenaya hassleriana]
Length=480

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FG+YNPFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EK   A++P  E I KEI + +PG
Sbjct  314  FGYYNPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKQASARFPGNEFIAKEIKIPVPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRTAFV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  374  F-KPYNLNLFRLIWRTAFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S ACL V++AAAAGS AGVVLDLK Y+PF+T Y
Sbjct  433  KIPRWSTRWVCLQVFSSACLVVTVAAAAGSVAGVVLDLKSYKPFRTDY  480



>ref|XP_010684694.1| PREDICTED: amino acid permease 3-like [Beta vulgaris subsp. vulgaris]
Length=494

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWL+DIANAAIVIHL+GAYQVYCQPL+AFIEK     +P+ + ITKEI + +PG
Sbjct  327  FGFYNPFWLVDIANAAIVIHLIGAYQVYCQPLYAFIEKIASENFPNSDFITKEILIPLPG  386

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY+LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYISQK
Sbjct  387  GYKPYRLNMFRLVWRTIFVIVTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYISQK  446

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+WICLQMLS ACL +++AAAAGS AGV+LDLK Y+PFKT+Y
Sbjct  447  KIPKWSTKWICLQMLSFACLIITIAAAAGSVAGVILDLKSYKPFKTTY  494



>ref|NP_196484.1| amino acid permease 2 [Arabidopsis thaliana]
 sp|Q38967.1|AAP2_ARATH RecName: Full=Amino acid permease 2; AltName: Full=Amino acid 
transporter AAP2 [Arabidopsis thaliana]
 emb|CAA50672.1| amine acid permease [Arabidopsis thaliana]
 emb|CAC05448.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
 gb|AAL91247.1| AT5g09220/T5E8_20 [Arabidopsis thaliana]
 gb|AED91352.1| amino acid permease 2 [Arabidopsis thaliana]
Length=493

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAFIEK V  ++PD + ++KE  ++IPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR+++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  FKSPYKVNVFRMVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>gb|AAM61227.1| amino acid transport protein AAP2 [Arabidopsis thaliana]
Length=493

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAFIEK V  ++PD + ++KE  ++IPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIRIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR+++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  FKSPYKVNVFRMVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQML+ ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLTVACLVISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>emb|CDX78353.1| BnaA03g02650D [Brassica napus]
Length=487

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 146/168 (87%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V  ++PD +++TKE+ +KIPG
Sbjct  320  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDSDLLTKELQIKIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  380  FRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PF+++Y
Sbjct  440  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>gb|KJB59301.1| hypothetical protein B456_009G248600 [Gossypium raimondii]
Length=468

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  302  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSATERFPDSEFITKDIKIPIPG  361

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV++TT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  362  F-RPYNLNLFRLVWRTIFVIITTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  420

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK ++PF T Y
Sbjct  421  KIPKWSTRWVCLQILSIACLFITIAAAAGSIAGVVLDLKSFKPFATVY  468



>gb|KJB16325.1| hypothetical protein B456_002G223200 [Gossypium raimondii]
Length=477

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  311  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAAKRFPDSEFITKDIKIPIPG  370

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQ 
Sbjct  371  F-RPYNLNLFRLVWRTIFVMLTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYISQN  429

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL++++AAAAGS AGV+LDLK Y+PF T+Y
Sbjct  430  KIAKWSTRWLCLQILSIACLSITIAAAAGSIAGVILDLKSYKPFSTAY  477



>gb|KHG20963.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=486

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  320  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSATERFPDSEFITKDIKIPIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV++TT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  380  F-RPYNLNLFRLVWRTIFVIITTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK ++PF T Y
Sbjct  439  KIPKWSTRWVCLQILSIACLFITIAAAAGSIAGVVLDLKSFKPFATVY  486



>gb|KDO57534.1| hypothetical protein CISIN_1g015342mg [Citrus sinensis]
Length=408

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+CQP+FAF+EK V   WPD   ++KE  + +PG
Sbjct  242  FGFYNPFWLLDIANAAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPG  301

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  302  L-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  360

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y PFKT+Y
Sbjct  361  KITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY  408



>ref|XP_002871360.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47619.1| hypothetical protein ARALYDRAFT_487723 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAFIEK V  ++PD + ++KE  +KIPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLIGAYQVFAQPIFAFIEKSVAERYPDNDFLSKEFEIKIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  FKSPYKANVFRVVYRSGFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|NP_201190.1| amino acid permease 4 [Arabidopsis thaliana]
 sp|Q9FN04.1|AAP4_ARATH RecName: Full=Amino acid permease 4; AltName: Full=Amino acid 
transporter AAP4 [Arabidopsis thaliana]
 dbj|BAB11033.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AED97804.1| amino acid permease 4 [Arabidopsis thaliana]
Length=466

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  FRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_009122500.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=485

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK V  ++PD +++TKE+  KIPG
Sbjct  318  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSVSERFPDNDLLTKELEFKIPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  378  FRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PF+T+Y
Sbjct  438  KVEKWSTRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPFQTTY  485



>ref|XP_006279782.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
 gb|EOA12680.1| hypothetical protein CARUB_v10027867mg [Capsella rubella]
Length=466

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR ++R+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  FRSPYKVNVFRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>emb|CAA54631.1| amino acid transporter [Arabidopsis thaliana]
Length=466

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK + A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQLAARFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  FRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_010674405.1| PREDICTED: amino acid permease 4 [Beta vulgaris subsp. vulgaris]
Length=485

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EKW   KWPD + IT+E+ ++IPG
Sbjct  319  FGFYNPYWLLDIANVAIVIHLVGAYQVYCQPLFAFVEKWAAQKWPDSDFITREMKIRIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN+FRL+WRT FV+ TT+ISMLLPFFND+VG+LGA GFWPLTVYFP+ MYI+QK
Sbjct  379  IG-PYNLNSFRLVWRTTFVITTTIISMLLPFFNDIVGLLGALGFWPLTVYFPIEMYIAQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+PKWST+W+CLQMLS ACL +S+AAAAGS AGV LDLK+YRPFKTSY
Sbjct  438  KVPKWSTKWLCLQMLSMACLVISIAAAAGSIAGVALDLKVYRPFKTSY  485



>gb|KDO80515.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80516.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80517.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
 gb|KDO80518.1| hypothetical protein CISIN_1g0115802mg, partial [Citrus sinensis]
Length=335

 Score =   231 bits (588),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  169  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPG  228

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y LN FRL+WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  229  FKC-YNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  287

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+W+CLQ+LS ACL +++AAAAGS AGVV DLK Y+PF TSY
Sbjct  288  KIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY  335



>ref|XP_011458812.1| PREDICTED: amino acid permease 3-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    K+PD E I++EI + +PG
Sbjct  320  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAAKKYPDSEFISREIKIPVPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G+   LN FRL+WRTAFV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  380  LGH-CNLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGLLGAVGFWPLTVYFPVEMYIAQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ DLK Y+PFKTSY
Sbjct  439  RIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVISDLKTYKPFKTSY  486



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    K+PD E I++EI + +PG
Sbjct  318  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAAKKYPDSEFISREIKIPVPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G+   LN FRL+WRTAFV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  378  LGH-CNLNLFRLVWRTAFVIVTTVISMLLPFFNDVVGLLGAVGFWPLTVYFPVEMYIAQK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ DLK Y+PFKTSY
Sbjct  437  RIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVISDLKTYKPFKTSY  484



>ref|NP_177862.1| amino acid permease 3 [Arabidopsis thaliana]
 sp|Q39134.2|AAP3_ARATH RecName: Full=Amino acid permease 3; AltName: Full=Amino acid 
transporter AAP3 [Arabidopsis thaliana]
 gb|AAG29203.1|AC078898_13 amino acid carrier, putative [Arabidopsis thaliana]
 emb|CAA54630.1| amino acid permease [Arabidopsis thaliana]
 gb|AAM20639.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AAM91305.1| putative amino acid carrier [Arabidopsis thaliana]
 gb|AEE35971.1| amino acid permease 3 [Arabidopsis thaliana]
Length=476

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIQFPDSEFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  370  F-KPLRLNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  429  KIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_002302224.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
 gb|EEE81497.2| hypothetical protein POPTR_0002s08000g [Populus trichocarpa]
Length=485

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV CQPL+AFIEK    ++PD E ITK+IN+ IPG
Sbjct  319  FGFYNPYWLLDIANAAIVIHLVGAYQVSCQPLYAFIEKEAAQRFPDSEFITKDINIPIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FR++WRT FV+LTTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  379  F-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AG+V DLK  +PF+TSY
Sbjct  438  KIPKWSTRWLCLQILSVACLIITIAAAAGSVAGIVGDLKSIKPFQTSY  485



>gb|AAM13223.1| amino acid transporter AAP4 [Arabidopsis thaliana]
 gb|AAO30058.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   234 bits (597),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A +PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAASFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  FRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>gb|AAM62803.1| amino acid carrier, putative [Arabidopsis thaliana]
Length=476

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIQFPDSEFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  370  F-KPLRLNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  429  KIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_009131105.1| PREDICTED: amino acid permease 2 [Brassica rapa]
Length=487

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V  ++PD +++TKE+ +KIPG
Sbjct  320  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDSDLLTKELQIKIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILG  GFWPLTVYFPV MYI Q+
Sbjct  380  FRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGVLGFWPLTVYFPVEMYIKQR  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PF+++Y
Sbjct  440  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>ref|XP_007019168.1| Amino acid permease isoform 2 [Theobroma cacao]
 gb|EOY16393.1| Amino acid permease isoform 2 [Theobroma cacao]
Length=488

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    K+PD E ITK+I + IPG
Sbjct  322  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKKAAEKFPDSEFITKDIKISIPG  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y LN FRL+WRT FV+ TT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYIS+K
Sbjct  382  F-RAYNLNLFRLVWRTLFVISTTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISKK  440

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK Y+PF T Y
Sbjct  441  KIPKWSTRWLCLQILSIACLIITIAAAAGSIAGVVLDLKSYKPFSTDY  488



>ref|XP_007019167.1| Amino acid permease isoform 1 [Theobroma cacao]
 gb|EOY16392.1| Amino acid permease isoform 1 [Theobroma cacao]
Length=486

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    K+PD E ITK+I + IPG
Sbjct  320  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKKAAEKFPDSEFITKDIKISIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y LN FRL+WRT FV+ TT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYIS+K
Sbjct  380  F-RAYNLNLFRLVWRTLFVISTTLISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISKK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVVLDLK Y+PF T Y
Sbjct  439  KIPKWSTRWLCLQILSIACLIITIAAAAGSIAGVVLDLKSYKPFSTDY  486



>ref|XP_006300985.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
 gb|EOA33883.1| hypothetical protein CARUB_v10021374mg [Capsella rubella]
Length=475

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK    ++PD E I K+I + IPG
Sbjct  309  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKQASIRFPDSEFIAKDIKIPIPG  368

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P++LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+QK
Sbjct  369  F-KPFRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQK  427

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  428  KIPRWSTRWVCLQVFSSGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  475



>gb|KHG27248.1| Amino acid permease 3 -like protein [Gossypium arboreum]
Length=468

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  302  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKSAAKRFPDSEFITKDIKIPIPG  361

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQ 
Sbjct  362  F-RPYNLNLFRLVWRTIFVMLTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYISQN  420

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL +++AAAAGS AGV+LDLK Y PF T+Y
Sbjct  421  KIAKWSTRWLCLQILSIACLIITIAAAAGSIAGVILDLKSYTPFSTAY  468



>ref|XP_006399392.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
 gb|ESQ40845.1| hypothetical protein EUTSA_v10013363mg [Eutrema salsugineum]
Length=492

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HL+GAYQV+ QP+FAF+EK V  ++PD +++TKE  +K+PG
Sbjct  325  FGFYNPFWLLDVANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDNDLVTKEFKIKVPG  384

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY+ N FR+++R  FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  385  FKSPYRANVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PF+++Y
Sbjct  445  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFQSTY  492



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW   +WP  E+IT E   +IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEKWSAKRWPKSELITHEYEARIPC  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL+WRTAFV+LTTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  406  TGATYKLNLFRLVWRTAFVVLTTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI  WS+RW+ LQ+LS  CL VSLAAA GS AGVVLDLK YRPF+++Y
Sbjct  466  KIRPWSSRWVGLQLLSFTCLVVSLAAACGSMAGVVLDLKSYRPFESTY  513



>emb|CDX81121.1| BnaC03g03750D [Brassica napus]
Length=487

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF+EK V  ++PD +++TKE+  KIPG
Sbjct  320  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFVEKSVSERFPDNDLLTKELQFKIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  380  IRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PF+++Y
Sbjct  440  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>ref|XP_010416679.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I K+I + IPG
Sbjct  311  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDSEFIAKDIEIPIPG  370

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+QK
Sbjct  371  F-KPLRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQK  429

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  430  KIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>emb|CDX69918.1| BnaA10g22670D [Brassica napus]
Length=485

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK    ++PD +++TKE+  KIPG
Sbjct  318  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSASERFPDNDLLTKELVFKIPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R  FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  378  FRSPYKTNVFRVVFRCCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PF+T+Y
Sbjct  438  KVEKWSTRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPFQTTY  485



>emb|CAF22024.1| amino acid permease [Brassica napus]
Length=487

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 144/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK    ++PD +++TKE+  KIPG
Sbjct  320  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSASERFPDNDLLTKELEFKIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK N FR+++R +FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  380  FRSPYKTNVFRVVFRCSFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PF+++Y
Sbjct  440  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFQSTY  487



>ref|XP_010452897.1| PREDICTED: amino acid permease 2 [Camelina sativa]
Length=493

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAFIEK V  ++PD +  TKE  +KIPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK N FR+++R  FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  LRSPYKANVFRIVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +++ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSVACLVITVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_008338673.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=489

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVY QPLF+F+EK    ++PD E ITK+I L+IPG
Sbjct  323  FGFYNPYWLLDIANAAIVIHLVGAYQVYAQPLFSFVEKTAAQRFPDSEFITKDIKLRIPG  382

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRTAFV++TTVISM+LPFFNDVVG+LGAFGFWPLTVYFPV MYI Q 
Sbjct  383  IG-PYNLNLFRMIWRTAFVVITTVISMILPFFNDVVGLLGAFGFWPLTVYFPVEMYIVQX  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+CLQ LS  CL +++AAAAGS AGVV DLK+Y+PF  SY
Sbjct  442  RIPKWSTRWLCLQTLSVGCLIITIAAAAGSIAGVVSDLKVYKPFTASY  489



>ref|XP_010423021.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHL+GAYQV+ QP+FAFIEK V  ++PD +  TKE  +KIPG
Sbjct  326  FGFYNPFWLLDIANAAIVIHLIGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIKIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK N FR+++R  FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  LKSPYKANVFRIVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSVACLLISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIAN+AIV+HLVGAYQV+CQP+FAF+EK V   WPD   ++KE  + +PG
Sbjct  317  FGFYNPFWLLDIANSAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPG  376

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  377  L-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  435

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y PFKT+Y
Sbjct  436  KITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY  483



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIAN+AIV+HLVGAYQV+CQP+FAF+EK V   WPD   ++KE  + +PG
Sbjct  319  FGFYNPFWLLDIANSAIVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WR+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  379  L-LPYKLNLFRLVWRSCFVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQMLS ACL +S+ A AGS  GVV D+K Y PFKT+Y
Sbjct  438  KITKWSTRWMCLQMLSMACLVLSIIAGAGSIVGVVNDVKAYTPFKTTY  485



>ref|XP_002864872.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41131.1| hypothetical protein ARALYDRAFT_496573 [Arabidopsis lyrata subsp. 
lyrata]
Length=466

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  IRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVYKPFKTTY  466



>ref|XP_011027478.1| PREDICTED: amino acid permease 3-like isoform X1 [Populus euphratica]
Length=486

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    ++PD + +TK+I + IPG
Sbjct  320  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKAAARRFPDSDFVTKDIKISIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  380  LG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PF+TSY
Sbjct  439  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIKPFQTSY  486



>ref|XP_006287587.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
 gb|EOA20485.1| hypothetical protein CARUB_v10000805mg [Capsella rubella]
Length=493

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAFIEK    ++PD + +TKE  ++IPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAFIEKSAAERYPDNDFLTKEFEIRIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK N FR+++R  FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  LKSPYKANVFRVVYRCGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSAACLVISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_006386354.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|ERP64151.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=487

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    ++PD + +TK+I + IPG
Sbjct  321  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKEAARRFPDSDFVTKDIKISIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  381  LG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PF+TSY
Sbjct  440  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIKPFQTSY  487



>gb|AAM61320.1| amino acid transporter AAP4 [Arabidopsis thaliana]
Length=466

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIVIHLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVIHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEYEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  FRSPYKVNVFRAVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIRQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+ +PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLMITLVAGVGSIAGVMLDLKVXKPFKTTY  466



>ref|XP_011027479.1| PREDICTED: amino acid permease 3-like isoform X2 [Populus euphratica]
Length=485

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    ++PD + +TK+I + IPG
Sbjct  319  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKAAARRFPDSDFVTKDIKISIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  379  LG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PF+TSY
Sbjct  438  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIKPFQTSY  485



>ref|XP_006434261.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
 gb|ESR47501.1| hypothetical protein CICLE_v10000991mg [Citrus clementina]
Length=480

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  314  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y LN FRL+WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  374  FKC-YNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+W+CLQ+LS ACL +++AAAAGS AGVV DLK Y+PF TSY
Sbjct  433  KIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY  480



>ref|XP_002302223.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
 gb|EEE81496.1| hypothetical protein POPTR_0002s07960g [Populus trichocarpa]
Length=485

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    ++PD + +TK+I + IPG
Sbjct  319  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKEAARRFPDSDFVTKDIKISIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYISQK
Sbjct  379  LG-PYNLNLFRMIWRTLFVVTTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYISQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PF+TSY
Sbjct  438  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVLDDVKTIKPFQTSY  485



>ref|XP_009414606.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   233 bits (593),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIEKW    WP  E ITK+I + I  
Sbjct  326  FGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIEKWTLKTWPKSEFITKDIQVPIAS  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y LN FRL WRT FV++TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  386  -GRCYNLNLFRLTWRTMFVIVTTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KIPKWSTRW+CLQ+LS ACL +++A+AAGS AGVV DLK+YRPFK+S
Sbjct  445  KIPKWSTRWVCLQLLSLACLVITVASAAGSVAGVVSDLKVYRPFKSS  491



>ref|XP_008799058.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=492

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQV+CQPLFAFIEKW    WP    ITKE+ + +  
Sbjct  326  FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKWALQTWPKSTFITKEVRIPLTS  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y LN FRL+WR+AFV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  386  -TRSYNLNLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            ++P+WSTRW+CLQMLS ACL VS+AAAAGS AGVV DLK+YRPFKTSY
Sbjct  445  EVPRWSTRWVCLQMLSIACLIVSIAAAAGSIAGVVTDLKVYRPFKTSY  492



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +PD +IITKEI++ IPG
Sbjct  309  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPG  368

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  369  F-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  427

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            +I KWS RWICLQ+LSGACL +S+AAAAGSFAGVV DLK+YRPF++
Sbjct  428  RITKWSARWICLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFQS  473



>ref|XP_006473027.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=479

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAFIEK    ++PD E ITK+I + IPG
Sbjct  313  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFIEKQAHQRFPDSEFITKDIKVPIPG  372

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y LN FRL+WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  373  FKC-YNLNLFRLVWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  431

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+W+CLQ+LS ACL +++AAAAGS AGVV DLK Y+PF TSY
Sbjct  432  KIPKWSTKWLCLQILSVACLIITIAAAAGSIAGVVTDLKSYKPFSTSY  479



>ref|XP_002889140.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65399.1| hypothetical protein ARALYDRAFT_476902 [Arabidopsis lyrata subsp. 
lyrata]
Length=476

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I ++I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDSEFIARDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F + + LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  370  FKHLH-LNVFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL +S+AAAAGS AGV+LDLK Y+PF++ Y
Sbjct  429  KIPRWSTRWVCLQVFSSGCLVISIAAAAGSIAGVLLDLKSYKPFRSEY  476



>ref|XP_006386355.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
 gb|ERP64152.1| amino acid permease which transports basic amino acids family 
protein [Populus trichocarpa]
Length=480

 Score =   231 bits (590),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPL+AFIEK    ++PD E ITK+I + IPG
Sbjct  314  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FR++WRT FV+LTTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  374  F-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL +S+AAAAGS AG+V DLK  +PF+TSY
Sbjct  433  KIRKWSTRWLCLQILSVACLIISIAAAAGSVAGIVGDLKSIKPFQTSY  480



>ref|XP_006394236.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 ref|XP_006394237.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31522.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
 gb|ESQ31523.1| hypothetical protein EUTSA_v10004152mg [Eutrema salsugineum]
Length=466

 Score =   231 bits (589),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDNDLVTKEFEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  IRSPYKVNVFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSLKWVCLQMLSCGCLVITVVAGVGSLAGVMLDLKVYKPFKTTY  466



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLD+ANAAIV+HLVGAYQV+CQPLFAFIEKW    WPD   ITKE+ + +P 
Sbjct  343  FGFYNPYWLLDVANAAIVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPS  402

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y+L+ FRL+WR+AFV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  403  TKR-YRLSLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  461

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IP+WSTRW+CLQ+LS ACL +++AAA GS AGVV DL+ YRPFK+SY
Sbjct  462  RIPRWSTRWVCLQILSLACLVITVAAAIGSVAGVVTDLEAYRPFKSSY  509



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   232 bits (591),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLD+ANAAIV+HLVGAYQV+CQPLFAFIEKW    WPD   ITKE+ + +P 
Sbjct  329  FGFYNPYWLLDVANAAIVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPS  388

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y+L+ FRL+WR+AFV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  389  TKR-YRLSLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  447

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IP+WSTRW+CLQ+LS ACL +++AAA GS AGVV DL+ YRPFK+SY
Sbjct  448  RIPRWSTRWVCLQILSLACLVITVAAAIGSVAGVVTDLEAYRPFKSSY  495



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQV+CQPLFAF+EKW    WP    ITKE  + +  
Sbjct  326  FGFYNPFWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKWARQTWPKSTFITKETRIPLSS  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y LN FRL+WR+AFV+LTT+ISMLLPFFNDVVG+LGA GFWPLTVYFP+ MYI+QK
Sbjct  386  -ARSYNLNLFRLVWRSAFVVLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIAQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+PKWSTRW+ LQMLS ACL VS++AAAGS AGVV DLK+YRPFKTSY
Sbjct  445  KVPKWSTRWVSLQMLSIACLIVSISAAAGSIAGVVTDLKVYRPFKTSY  492



>gb|EYU32508.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=490

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK     +P+ + ITKEI++ IPG
Sbjct  323  FGFFNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKTSAHYFPNSKFITKEISIPIPG  382

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F    KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI Q 
Sbjct  383  FNRLLKLNLFRLVWRTIFVIVTTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQM  442

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS RWICLQ+LS ACL +S+AA  GSFAGVV DLK+Y+PFKTSY
Sbjct  443  RIPKWSPRWICLQILSMACLIISIAAGVGSFAGVVTDLKVYKPFKTSY  490



>gb|EYU32509.1| hypothetical protein MIMGU_mgv1a005226mg [Erythranthe guttata]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK     +P+ + ITKEI++ IPG
Sbjct  325  FGFFNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKTSAHYFPNSKFITKEISIPIPG  384

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F    KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI Q 
Sbjct  385  FNRLLKLNLFRLVWRTIFVIVTTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQM  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS RWICLQ+LS ACL +S+AA  GSFAGVV DLK+Y+PFKTSY
Sbjct  445  RIPKWSPRWICLQILSMACLIISIAAGVGSFAGVVTDLKVYKPFKTSY  492



>ref|XP_009106399.1| PREDICTED: amino acid permease 3 [Brassica rapa]
Length=476

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PD + I KEI + +PG
Sbjct  310  FGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKEIKIPVPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  F-KPFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  429  KIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +PD +IITKEI++ IPG
Sbjct  309  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTATEWYPDSKIITKEIDVPIPG  368

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  369  F-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  427

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            +I KWS RWICLQ+LSGACL +S+AAAAGSFAGV  DLK+YRPF++
Sbjct  428  RITKWSGRWICLQILSGACLVISIAAAAGSFAGVASDLKVYRPFQS  473



>ref|XP_011027477.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=480

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPL+AFIEK    ++PD E ITK+I + IPG
Sbjct  314  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FR++WR  FV+LTTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  374  F-RPYNLNLFRMIWRALFVVLTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS RW+CLQ+LS ACL +++AAAAGS AG+V DLK  +PF+TSY
Sbjct  433  KIPKWSKRWLCLQILSVACLIITMAAAAGSVAGIVGDLKSIKPFQTSY  480



>ref|XP_010461080.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  LKSPYKVNVFRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQ+LS  CL V+L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  419  KVERWSMKWVCLQLLSAGCLMVTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>ref|XP_010491540.1| PREDICTED: amino acid permease 2-like [Camelina sativa]
Length=493

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HLVGAYQV+ QP+FAFIEK V  ++PD +  TKE  ++IPG
Sbjct  326  FGFYNPFWLLDIANAAIVVHLVGAYQVFAQPIFAFIEKSVAERYPDNDFFTKEFEIRIPG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY+ N FR+++R  FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  386  LRSPYRANVFRIVYRCIFVVTTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  445

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWSTRW+CLQMLS ACL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  446  KVEKWSTRWVCLQMLSVACLVISVVAGVGSIAGVMLDLKVYKPFKSTY  493



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EK    ++PD E IT++I + +PG
Sbjct  316  FGFYNPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKQAAQRFPDSEFITRDIRIPLPG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
              + Y LN FRL+WRT FV+LTT+ISMLLPFFND+VG+LGA GFWPLTVY+PV MYI+QK
Sbjct  376  SRF-YNLNLFRLVWRTIFVILTTLISMLLPFFNDIVGLLGALGFWPLTVYYPVEMYIAQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+W+CLQ+LS ACL +++AAAAGS AGV+LDLK Y+PFKT Y
Sbjct  435  RIPKWSTKWLCLQILSFACLIITVAAAAGSIAGVILDLKSYKPFKTDY  482



>ref|XP_010484145.1| PREDICTED: amino acid permease 4 [Camelina sativa]
Length=466

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+AN AIV+HLVGAYQV+ QP+FAFIEK   A++PD +++TKE  ++IPG
Sbjct  299  FGFYNPFWLLDVANVAIVVHLVGAYQVFAQPIFAFIEKQAAARFPDSDLVTKEHEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  LKSPYKVNVFRTVYRSGFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL V+L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  419  KVERWSMKWVCLQMLSAGCLMVTLVAGVGSIAGVMLDLKVYKPFKSTY  466



>emb|CDX88364.1| BnaC06g38080D [Brassica napus]
Length=476

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PD + I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  F-KPFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  429  KIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_010428816.1| PREDICTED: amino acid permease 3 [Camelina sativa]
Length=477

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK    ++PD E I K+I + IPG
Sbjct  311  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASIRFPDCEFIAKDIKIPIPG  370

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+QK
Sbjct  371  F-KPLRLNLFRLIWRTVFVIITTVISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQK  429

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+C Q+ S  CL VS+AAAAGS AG+VLDLK Y+PF+++Y
Sbjct  430  KIPRWSTRWVCFQVFSLGCLVVSIAAAAGSIAGIVLDLKSYKPFQSNY  477



>ref|XP_003527948.1| PREDICTED: amino acid permease 3 [Glycine max]
 gb|KHN46995.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK     +PD + + KEI + IPG
Sbjct  321  FGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAAQMFPDSDFLNKEIEIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F +PY+LN FRL+WRT +V+L+TVISMLLPFFND+ G+LGAFGFWPLTVYFPV MYI QK
Sbjct  381  F-HPYRLNLFRLVWRTIYVMLSTVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYIIQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WICLQ+LS  CL +++ AAAGS AG+ +DL+ Y+PFKT+Y
Sbjct  440  RIPKWSTKWICLQILSMTCLLMTIGAAAGSIAGIAIDLRTYKPFKTNY  487



>emb|CDY21569.1| BnaC09g47230D [Brassica napus]
Length=485

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIV+HL+GAYQV+ QP+FAF EK    ++PD +++TKE+  KIPG
Sbjct  318  FGFYNPFWLLDIANAAIVVHLIGAYQVFSQPIFAFAEKSASERFPDNDLLTKELEFKIPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK N FR+++R +FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  378  LRSPYKTNVFRVVFRCSFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PF+T+Y
Sbjct  438  KVEKWSLRWVCLQMLSVSCLVISVFAGVGSIAGVMLDLKVYKPFQTTY  485



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 3/171 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEIN--LKI  432
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   KWP  + IT E++  L +
Sbjct  324  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAKQKWPKSKYITGEVDVPLSL  383

Query  431  PG-FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
             G  G  YKLN FRL WRTAFV+ TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI
Sbjct  384  SGSAGRCYKLNLFRLTWRTAFVVATTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYI  443

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
             QKK+P+WSTRW+CLQMLS ACL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  444  VQKKVPRWSTRWVCLQMLSLACLIITVASAAGSVAGIISDLKVYKPFVTTY  494



>ref|XP_010063933.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW71231.1| hypothetical protein EUGRSUZ_F04329 [Eucalyptus grandis]
Length=478

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WL+DIANAAIVIHL+GAYQVYCQPLFAFIEK    ++ D + ITKEI + +PG
Sbjct  312  FGFFNPYWLIDIANAAIVIHLIGAYQVYCQPLFAFIEKHAAKRFGDSQFITKEIEIPVPG  371

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FR++WRT FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI+Q 
Sbjct  372  F-RPFKLNVFRMIWRTIFVILTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQM  430

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+W+ LQ+LS ACL +++AAAAGS AGVVLDLK Y+PFKTSY
Sbjct  431  KIPKWSTKWLSLQILSAACLIITIAAAAGSIAGVVLDLKSYKPFKTSY  478



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   229 bits (585),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/168 (77%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHL+GAYQV+CQPLFAFIEK     +PD + ITKEI + IPG
Sbjct  318  FGFYNPYWLLDIANVAIVIHLIGAYQVFCQPLFAFIEKTALEWFPDSKFITKEIAIPIPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  378  F-RAYKLNLFRLVWRTIFVIVTTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+ LQ+LS ACL +S+AAAAGSFAGVV DLK+Y+PFKTSY
Sbjct  437  RIPKWSTRWVSLQILSVACLVISVAAAAGSFAGVVSDLKVYKPFKTSY  484



>emb|CDX87522.1| BnaA07g33510D [Brassica napus]
Length=476

 Score =   229 bits (584),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAFIE+    ++PD + I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  F-KPLRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  429  KIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_011003418.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK    ++PD + +TK+I + IPG
Sbjct  321  FGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ +N FR +WRT FV++TTVISMLLPFFND+VG+LGAFGFWPLTVYFPV MYISQK
Sbjct  381  L-RPFNINLFRTVWRTTFVVITTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEMYISQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PFKTSY
Sbjct  440  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>ref|XP_010471931.1| PREDICTED: amino acid permease 3-like [Camelina sativa]
Length=477

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAFIEK     +PD E I K+I + IPG
Sbjct  311  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFIEKQASICFPDSEFIAKDIKIPIPG  370

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P +LN FRL+WRT FV++TT ISMLLPFFNDVVG+LG+ GFWPLTVYFPV MYI+QK
Sbjct  371  F-KPLRLNLFRLIWRTVFVIITTDISMLLPFFNDVVGLLGSLGFWPLTVYFPVEMYIAQK  429

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WSTRW+CLQ+ S  CL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  430  KIPRWSTRWVCLQVFSLGCLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  477



>ref|NP_001234606.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13689.1|AF013280_1 amino acid transporter [Solanum lycopersicum]
Length=471

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 147/166 (89%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN A+V+HLVGAYQVYCQPLFAF+EK     +PD +IITKEI++ IPG
Sbjct  307  FGFYNPYWLLDIANIAMVVHLVGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPG  366

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WR  FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  367  F-KPFKLNLFRLVWRAIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  425

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            +I KWS RWICLQ+LSGACL +S+AAAAGSFAGVV DLK+YRPF++
Sbjct  426  RITKWSARWICLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFQS  471



>ref|XP_007137459.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
 gb|ESW09453.1| hypothetical protein PHAVU_009G128500g [Phaseolus vulgaris]
Length=487

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVG+YQVY QP+FAF+EK V +++PD + + KEI + +PG
Sbjct  321  FGFYNPYWLLDIANAAIVIHLVGSYQVYSQPIFAFVEKNVASRFPDSDFVNKEIEIGVPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F +PY+LN FRL+WRT +V+L+TVI+MLLPFFND+ G+LGAFGFWPLTVYFPV MYI QK
Sbjct  381  F-HPYRLNLFRLIWRTIYVVLSTVIAMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYIIQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS++WICLQ LS ACL +++ A  GS AG ++DLK Y+PFKT+Y
Sbjct  440  RIPKWSSKWICLQTLSIACLLMTIGAGVGSVAGTLIDLKSYKPFKTNY  487



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHL+GAYQVYCQPLFAF+E +   ++PD + + K++ + IPG
Sbjct  315  FGFYNPFWLLDIANAAIVIHLIGAYQVYCQPLFAFVENYTAKRFPDSDFVNKDVKIPIPG  374

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKLN FRL+WRT +V+LTT+ISMLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  375  LD-RYKLNLFRLVWRTVYVILTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYIIQK  433

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+WICLQ+LSGACL +++AA  GS AG++LDLK+++PFKT Y
Sbjct  434  KIPKWSTKWICLQLLSGACLIITIAATIGSIAGLILDLKVFKPFKTIY  481



>ref|XP_010546307.1| PREDICTED: amino acid permease 2 isoform X2 [Tarenaya hassleriana]
Length=409

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FG+Y PFWLLD+ANAAIVIHLVGAYQV+CQP+FAF+EKWV  ++P   ++ KE  +++PG
Sbjct  242  FGYYEPFWLLDVANAAIVIHLVGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVPG  301

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY+ N FR ++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MY+ Q+
Sbjct  302  FRAPYRANVFRAVFRSGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQR  361

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  362  KVERWSVRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPFKSTY  409



>gb|KFK42132.1| hypothetical protein AALP_AA2G215300 [Arabis alpina]
Length=476

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HL+GAYQVYCQPLFAFIEK    ++PD + I K+I + +PG
Sbjct  310  FGFYNPYWLLDIANAAIVVHLIGAYQVYCQPLFAFIEKQASLRFPDSDFIAKDIKIPVPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P +LN FRL+WRT FV++TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  Y-KPLRLNFFRLIWRTVFVIITTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +WSTRW+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  429  KIARWSTRWVCLQVFSLACLVVSIAAAAGSIAGVVLDLKSYKPFRSNY  476



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY+P+WLLDIAN AI++HLVGAYQVYCQPLFAF+EKW   KWP  + +T+E +L IP 
Sbjct  346  FGFYDPYWLLDIANIAIIVHLVGAYQVYCQPLFAFVEKWSAHKWPKSDFVTEEYDLPIPC  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+I+MLLPFFNDVVGILGAFGFWPLTVYFPV MYISQK
Sbjct  406  YGV-YQLNFFRLVWRTIFVVLTTLIAMLLPFFNDVVGILGAFGFWPLTVYFPVEMYISQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RW+ LQ+LS ACL +SLAAA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRWTSRWVALQILSFACLLISLAAAVGSVAGVVLDLKTYKPFKTSY  512



>ref|XP_011002450.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=487

 Score =   228 bits (580),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK    ++PD + +TK+I + IPG
Sbjct  321  FGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ +N FR +WRT FV++TTVISMLLPFFND+VG+LGAFGFWPLTVYFPV +YISQK
Sbjct  381  L-RPFNINLFRTVWRTTFVVITTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEIYISQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PFKTSY
Sbjct  440  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>ref|XP_010444306.1| PREDICTED: amino acid permease 4-like [Camelina sativa]
Length=466

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+AN AIVIHLVGAYQV+ QP+FAFIEK   A++P+ +++ KE  ++IPG
Sbjct  299  FGFYNPFWLLDVANVAIVIHLVGAYQVFAQPIFAFIEKQAAARFPNNDLVIKEHEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISMLLPFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  LKSPYKVNVFRTVYRSGFVVLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL ++L A  GS AGV+LDLK+Y+PFK++Y
Sbjct  419  KVERWSMKWVCLQMLSAGCLMITLVAGVGSIAGVMLDLKVYKPFKSTY  466



>emb|CDY39844.1| BnaC02g42740D [Brassica napus]
Length=466

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PD ++++KE  ++IPG
Sbjct  299  FGFYNPFWLLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  VRAPYKVNVFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KWS +W+CL+MLSG CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVEKWSMKWVCLKMLSGGCLVITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_009379863.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=495

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQV+ QPLFAFIEKW    WPD   I+KEI + +  
Sbjct  329  FGFYNPYWLLDIANAAIVVHLVGAYQVFSQPLFAFIEKWALKTWPDATFISKEIAVPLTP  388

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKL+ FRL+WR+AFV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  389  TKR-YKLSLFRLVWRSAFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQK  447

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IP+WSTRW+CLQMLS ACL +++AA  GS AG+V DLK+YRPFKTSY
Sbjct  448  RIPRWSTRWVCLQMLSSACLVITVAAVIGSVAGIVTDLKVYRPFKTSY  495



>gb|KHN44307.1| Amino acid permease 3 [Glycine soja]
Length=487

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK      PD + + KEI + IPG
Sbjct  321  FGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAARMLPDSDFVNKEIEIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F + YK+N FRL+WRT +V+++TVISMLLPFFND+ G+LGAFGFWPLTVYFPV MYI+QK
Sbjct  381  F-HSYKVNLFRLVWRTIYVMVSTVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYINQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WICLQ+LS ACL +++ AAAGS AG+ +DL+ Y+PFKT+Y
Sbjct  440  RIPKWSTKWICLQILSMACLLMTIGAAAGSIAGIAIDLQTYKPFKTNY  487



>ref|XP_003522571.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006578960.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=487

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVG+YQVYCQPLFAF+EK      PD + + KEI + IPG
Sbjct  321  FGFYNPYWLLDIANAAIVIHLVGSYQVYCQPLFAFVEKHAARMLPDSDFVNKEIEIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F + YK+N FRL+WRT +V+++TVISMLLPFFND+ G+LGAFGFWPLTVYFPV MYI+QK
Sbjct  381  F-HSYKVNLFRLVWRTIYVMVSTVISMLLPFFNDIGGLLGAFGFWPLTVYFPVEMYINQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WICLQ+LS ACL +++ AAAGS AG+ +DL+ Y+PFKT+Y
Sbjct  440  RIPKWSTKWICLQILSMACLLMTIGAAAGSIAGIAIDLQTYKPFKTNY  487



>ref|XP_004289864.1| PREDICTED: amino acid permease 4-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGA+QV+CQPLFAF+EKW   KWP  + +T E ++ IP 
Sbjct  346  FGFYNPYWLLDIANVAIVVHLVGAFQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+
Sbjct  406  YGV-YQLNLFRLVWRTLFVILTTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQ  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWS+RW+ LQMLS +CL VS+ AA GSFAGVVLDLK Y+PFKT+Y
Sbjct  465  KIEKWSSRWLGLQMLSMSCLVVSIVAAVGSFAGVVLDLKSYKPFKTTY  512



>ref|XP_009130275.1| PREDICTED: amino acid permease 4 [Brassica rapa]
 ref|XP_009130276.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PD ++++KE  ++IPG
Sbjct  299  FGFYNPFWLLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  VRSPYKVNVFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CL+MLSG CL +++ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLKMLSGGCLVITVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P  + ITKE+++ IPG
Sbjct  314  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKELDVPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  374  F-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  433  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_002520322.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF42108.1| amino acid transporter, putative [Ricinus communis]
Length=485

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    ++PD E ITK+I + IPG
Sbjct  319  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAVQRFPDSEFITKDIKIPIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  379  C-KPYNLNLFRMVWRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV++DLK  +PF+T+Y
Sbjct  438  KIPKWSTRWLCLQILSAACLIITIAAAAGSIAGVIVDLKTVKPFQTTY  485



>ref|XP_006383588.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
 gb|ERP61385.1| hypothetical protein POPTR_0005s20390g [Populus trichocarpa]
Length=484

 Score =   226 bits (577),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A++PD EIITK+I + +PG
Sbjct  318  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAVARFPDSEIITKDIKVAVPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+Q+
Sbjct  378  F-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQR  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+ LQ+LS ACL +++AAAAGS AGVV+DLK  +PF+TSY
Sbjct  437  RIPKWSTRWLGLQVLSIACLIITIAAAAGSIAGVVVDLKSIKPFQTSY  484



>emb|CDY31348.1| BnaA02g33930D [Brassica napus]
Length=466

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 143/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+AN AIVIHLVGAYQV+ QP+FAF++K   A++PD ++++KE  ++IPG
Sbjct  299  FGFYNPFWLLDVANVAIVIHLVGAYQVFAQPIFAFVDKQAAARFPDSDLVSKEFEIRIPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA GFWPLTVYFPV MYI Q+
Sbjct  359  VRAPYKVNVFRAVFRSCFVVLTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CL+MLSG CL +S+ A  GS AGV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLKMLSGGCLVISVVAGVGSVAGVMLDLKVYKPFKTTY  466



>ref|XP_010546306.1| PREDICTED: amino acid permease 4 isoform X1 [Tarenaya hassleriana]
Length=472

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FG+Y PFWLLD+ANAAIVIHLVGAYQV+CQP+FAF+EKWV  ++P   ++ KE  +++PG
Sbjct  305  FGYYEPFWLLDVANAAIVIHLVGAYQVFCQPIFAFVEKWVSERFPGNGLLGKEFEIRVPG  364

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY+ N FR ++R+ FV+ TTVISML+PFFNDVVGILGA GFWPLTVYFPV MY+ Q+
Sbjct  365  FRAPYRANVFRAVFRSGFVVSTTVISMLMPFFNDVVGILGALGFWPLTVYFPVEMYVRQR  424

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS RW+CLQMLS +CL +S+ A  GS AGV+LDLK+Y+PFK++Y
Sbjct  425  KVERWSVRWVCLQMLSVSCLVISVVAGVGSIAGVMLDLKVYKPFKSTY  472



>ref|XP_010232650.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
 ref|XP_010232651.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=487

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 140/166 (84%), Gaps = 4/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EK+ G +WP+   +T+EI L + G
Sbjct  326  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKYAGQRWPESRYVTREIELSVGG  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F    ++N FRL WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MYI Q+
Sbjct  386  F----RVNMFRLTWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQR  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+P+WSTRW+CLQMLSG CL +SLAAAAGS AG+  DLK+Y PFK+
Sbjct  442  KVPRWSTRWVCLQMLSGGCLVISLAAAAGSIAGIKSDLKVYHPFKS  487



>ref|XP_007222611.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
 gb|EMJ23810.1| hypothetical protein PRUPE_ppa004936mg [Prunus persica]
Length=484

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK    K+P    ITK+I  +IPG
Sbjct  318  FGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTAAEKYPHSHFITKDIKFRIPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  + LN FRL+WRT FV+LTTVISM+LPFFNDVVG+LGA GFWPLTVYFPV MYI+ K
Sbjct  378  FGL-FNLNLFRLVWRTCFVILTTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIATK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQ+LSGACL V++AAAAGS AGV+ DLK+Y+PFKTSY
Sbjct  437  RIPKWSTRWICLQILSGACLIVTIAAAAGSIAGVISDLKIYKPFKTSY  484



>emb|CAA10608.1| amino acid carrier [Ricinus communis]
Length=466

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    ++PD E I K+I + IPG
Sbjct  300  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAVQRFPDSEFILKDIKIPIPG  359

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY LN FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  360  C-KPYNLNLFRMVWRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV++DLK  +PF+T+Y
Sbjct  419  KIPKWSTRWLCLQILSAACLIITIAAAAGSIAGVIVDLKTVKPFQTTY  466



>ref|XP_011027691.1| PREDICTED: amino acid permease 3-like, partial [Populus euphratica]
Length=369

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIH VGAY+V CQPL+AFIEK    ++PD E ITK+I + IPG
Sbjct  203  FGFYNPYWLLDIANAAIVIHHVGAYRVSCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPG  262

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FR++WRT FV+LTTVISMLLPFFND+V +LGA GFWPLTVYFPV MYI QK
Sbjct  263  F-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVRLLGALGFWPLTVYFPVEMYIVQK  321

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS RW+CLQ+LS ACL +++AAAAGS AG+V DLK  +PF+TSY
Sbjct  322  KIPKWSKRWLCLQILSVACLIITMAAAAGSVAGIVGDLKSIKPFQTSY  369



>ref|XP_009609434.1| PREDICTED: amino acid permease 3-like [Nicotiana tomentosiformis]
Length=482

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 147/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK     +P+ + ITKEI++ I G
Sbjct  316  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAAEWYPESKFITKEISVPIMG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +   +KLN FR++WRT FV++TTVISMLLPFFND+VGILGAFGFWPLTVYFPV MYI QK
Sbjct  376  Y-KSFKLNLFRIIWRTIFVIITTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWST+WICLQMLS ACL +S+AAAAGSFAGVV DL++Y+PFKT+Y
Sbjct  435  KITKWSTKWICLQMLSVACLIISIAAAAGSFAGVVSDLQVYKPFKTTY  482



>ref|XP_010911284.1| PREDICTED: amino acid permease 3-like isoform X2 [Elaeis guineensis]
Length=489

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW    WPD + ITKE+ + + G
Sbjct  323  FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWALQTWPDSKFITKEVEVPL-G  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y+LN  RL WRT FV+ TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  382  PSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQK  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            K+PKWST+W+CLQ+LS ACLA+S+AAAAGS AGVV DLK+Y+PFKTS
Sbjct  442  KVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVNDLKVYQPFKTS  488



>ref|XP_008810907.1| PREDICTED: amino acid permease 3-like [Phoenix dactylifera]
Length=468

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW    WP+ + ITK I + + G
Sbjct  302  FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWALQTWPESKFITKGIEVPL-G  360

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y+LN FRL WRT FV+ TTVISMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  361  PSRSYRLNLFRLTWRTVFVICTTVISMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQK  420

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+PKWST+W+CLQ+LS ACL +S+AAAAGS AGV+ DLK+YRPF TSY
Sbjct  421  KVPKWSTKWVCLQLLSLACLIISVAAAAGSIAGVMNDLKVYRPFTTSY  468



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGA+QVYCQPLFAF+EKW   +WP  + +T E ++ IP 
Sbjct  345  FGFYNPYWLLDIANVAIVVHLVGAFQVYCQPLFAFVEKWSAQRWPKSDFVTAEYDIPIPF  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT FV++TT+ISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+
Sbjct  405  HGV-YQLNLFRLVWRTIFVIITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQ  463

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWS+RW+ L+MLS +CL V++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  464  KIGKWSSRWVGLKMLSISCLLVTIAAAVGSVAGVVLDLKTYKPFKTSY  511



>emb|CDX88365.1| BnaC06g38090D [Brassica napus]
Length=476

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAA+V+ LVGAYQVYCQPLFAFIE+    ++PD + I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAVVVLLVGAYQVYCQPLFAFIERQASTRFPDSDFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  F-KPFRLNFFRLIWRTVFVIITTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIP+WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF+++Y
Sbjct  429  KIPRWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFQSNY  476



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIAN AIV+HL+GAYQV+CQPLFAFIEKW    WP    ITKE+ + +  
Sbjct  322  FGFYNPFWLLDIANTAIVVHLIGAYQVFCQPLFAFIEKWALQTWPKSTFITKEMRISLTS  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y LN FRL+WR+AFV+LTT+ISMLLPFFND+VG+LGA  FWPLTVYFP+ MY+ QK
Sbjct  382  -TKSYNLNLFRLVWRSAFVVLTTIISMLLPFFNDIVGLLGALSFWPLTVYFPIEMYVVQK  440

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+P+WSTRW+CLQ+LS ACL VS+AAA GS AGVV DLK+YRPFKTSY
Sbjct  441  KVPRWSTRWVCLQILSVACLIVSIAAATGSIAGVVTDLKVYRPFKTSY  488



>ref|XP_010911278.1| PREDICTED: amino acid permease 3-like isoform X1 [Elaeis guineensis]
Length=492

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW    WPD + ITKE+ + + G
Sbjct  326  FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWALQTWPDSKFITKEVEVPL-G  384

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y+LN  RL WRT FV+ TTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  385  PSRCYRLNPLRLTWRTLFVICTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            K+PKWST+W+CLQ+LS ACLA+S+AAAAGS AGVV DLK+Y+PFKTS
Sbjct  445  KVPKWSTKWVCLQLLSMACLAISVAAAAGSIAGVVNDLKVYQPFKTS  491



>ref|XP_002520323.1| amino acid transporter, putative [Ricinus communis]
 emb|CAA07563.1| amino acid carrier [Ricinus communis]
 gb|EEF42109.1| amino acid transporter, putative [Ricinus communis]
Length=486

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK    ++PD   ITK+I + +PG
Sbjct  320  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKAAAQRYPDSGFITKDIKIPVPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+ LN FR +WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  380  F-RPFNLNLFRSVWRTLFVVFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGVV DLK  +PF+TSY
Sbjct  439  KIPKWSTRWLCLQILSAACLVITIAAAAGSIAGVVGDLKSVKPFQTSY  486



>ref|XP_009596721.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P  + ITK+I++ IPG
Sbjct  312  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPG  371

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  372  Y-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  430

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  431  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  476



>ref|XP_009596720.1| PREDICTED: amino acid permease 3-like isoform X1 [Nicotiana tomentosiformis]
Length=480

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P  + ITK+I++ IPG
Sbjct  314  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  374  Y-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  433  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_006654425.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=495

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    IT EI++ +P 
Sbjct  322  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRYITGEIDVPLPL  381

Query  428  ----GFGYP-YKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  264
                G G   ++LN FRL WR+AFV++TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV 
Sbjct  382  PSSSGAGRRCFRLNLFRLTWRSAFVVVTTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVE  441

Query  263  MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            MYI QK+IPKWSTRW+CLQ+LS ACL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  442  MYIVQKRIPKWSTRWVCLQLLSLACLIITVASAAGSVAGIISDLKVYKPFATTY  495



>gb|KHN39882.1| Amino acid permease 2 [Glycine soja]
Length=450

 Score =   224 bits (570),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP    +T E ++ IP 
Sbjct  284  FGFYNPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPC  343

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  344  FGV-YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  402

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RW+ LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  403  KIGRWTSRWLGLQLLSASCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  450



>emb|CDY43761.1| BnaA06g22970D [Brassica napus]
Length=466

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PD ++++KE  ++ PG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+
Sbjct  359  VRSPYKVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>ref|XP_009150448.1| PREDICTED: amino acid permease 4 [Brassica rapa]
Length=466

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++PD ++++KE  ++ PG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPDSDLVSKEFEIRFPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+
Sbjct  359  VRSPYKVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>gb|AIL30502.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK     +P  + ITK+I++ IPG
Sbjct  314  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAFEWYPSNKFITKDIDVPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  374  Y-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  433  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>gb|KDP32819.1| hypothetical protein JCGZ_12111 [Jatropha curcas]
Length=482

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 142/168 (85%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL DIAN AIV+HLVGAYQVYCQPLFAFIEK    ++PD + ITKEI + IPG
Sbjct  315  FGFYNPYWLPDIANVAIVVHLVGAYQVYCQPLFAFIEKTAAQRYPDSDFITKEIKIPIPG  374

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y LN FRL++RT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  375  LKSSYNLNLFRLVFRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ DLK  +PF+++Y
Sbjct  435  KIPKWSTRWLCLQILSAACLIITIAAAAGSIAGVITDLKTVKPFQSTY  482



>ref|XP_002306650.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
 gb|ABK95777.1| unknown [Populus trichocarpa]
 gb|EEE93646.2| hypothetical protein POPTR_0005s20400g [Populus trichocarpa]
Length=487

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAFIEK    ++PD + +TK+I + IPG
Sbjct  321  FGFYNPYWLLDIANTAIVIHLVGAYQVYCQPLFAFIEKEAARRFPDSDFVTKDIKISIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                + +N FR++ RT FV+LTTVISMLLPFFND+VG+LGAFGFWPLTVYFPV MYISQK
Sbjct  381  LS-AFNINLFRMVSRTIFVVLTTVISMLLPFFNDIVGLLGAFGFWPLTVYFPVEMYISQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LS ACL +++AAAAGS AGV+ D+K  +PFKTSY
Sbjct  440  KIPKWSTRWLCLQILSVACLIITIAAAAGSIAGVIDDVKTIKPFKTSY  487



>gb|AII99817.1| amino acid transporter [Nicotiana tabacum]
Length=479

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P  + ITK+I++ IPG
Sbjct  313  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPG  372

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  373  Y-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  431

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  432  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  477



>ref|XP_009388107.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=471

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EKW    WP  + I KEI + +P 
Sbjct  306  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKWALETWPRSQFIGKEIQVPLPA  365

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKLN FRL+WRT FV+++TV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  366  R-RSYKLNLFRLIWRTTFVVISTVVSMLLPFFNDVVGLLGAIGFWPLTVYFPVEMYIVQK  424

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            K+ +WSTRW+CLQ+LS ACLA+++A+AAGS AGVV DLK+YRPFK S
Sbjct  425  KVARWSTRWVCLQLLSLACLAITIASAAGSIAGVVSDLKVYRPFKAS  471



>ref|XP_009377726.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
 ref|XP_009343981.1| PREDICTED: amino acid permease 3 [Pyrus x bretschneideri]
Length=484

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 148/168 (88%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK V  K+P  + ITK+I  ++P 
Sbjct  318  FGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTVKEKYPHSQFITKDIKFRLPV  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y LN FRL+WRT+FV++TTVISM+LPFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  378  FG-SYNLNLFRLVWRTSFVIVTTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIAQK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+CLQ LSGACL +++AAAAGS AGV+ DLK+Y+PFKTSY
Sbjct  437  RIPKWSTRWLCLQTLSGACLIITIAAAAGSIAGVISDLKIYKPFKTSY  484



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAI +HLVGAYQVYCQPLFAF+EKW   +WP    IT E+++ +P 
Sbjct  308  FGFYEPFWLLDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPL  367

Query  428  --GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
                G  YKL+ FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI
Sbjct  368  GTAGGRCYKLSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYI  427

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
             QKK+P+WSTRW+CLQ+LS ACL +++A+AAGS AG+V DLK+Y+PF T+
Sbjct  428  VQKKVPRWSTRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|XP_006390096.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
 gb|ESQ27382.1| hypothetical protein EUTSA_v10018484mg [Eutrema salsugineum]
Length=476

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HL+GAYQVYCQPLFAFIEK    ++P  + I K+I + IPG
Sbjct  310  FGFYNPYWLLDIANAAIVVHLIGAYQVYCQPLFAFIEKQASIRFPGNKFIAKDIKIPIPG  369

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P++LN FRL+WRT FV++TT+ISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  370  F-KPFRLNFFRLIWRTVFVMITTLISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIEQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +WST+W+CLQ+ S ACL VS+AAAAGS AGVVLDLK Y+PF++ Y
Sbjct  429  KIARWSTQWVCLQVFSSACLVVSIAAAAGSIAGVVLDLKSYKPFRSDY  476



>gb|AIS71894.1| amino acid transporter [Nicotiana tabacum]
Length=480

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 128/166 (77%), Positives = 146/166 (88%), Gaps = 1/166 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EK     +P  + ITK+I++ IPG
Sbjct  314  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKDIDVPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +  P+KLN FRL+WRT FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  374  Y-KPFKLNLFRLVWRTIFVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KIPKWS RWI LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT
Sbjct  433  KIPKWSARWISLQILSGACLVISIAAAAGSFAGVVSDLKVYRPFKT  478



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 141/170 (83%), Gaps = 3/170 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAI +HLVGAYQVYCQPLFAF+EKW   +WP    IT E+++ +P 
Sbjct  308  FGFYEPFWLLDVANAAIAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPL  367

Query  428  --GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
                G  YKL+ FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI
Sbjct  368  GTAGGRCYKLSLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYI  427

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
             QKK+P+WSTRW+CLQ+LS ACL +++A+AAGS AG+V DLK+Y+PF T+
Sbjct  428  VQKKVPRWSTRWVCLQLLSVACLVITVASAAGSVAGIVSDLKVYKPFVTT  477



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGA+QV+CQPLFAF+EKW   +WP+ + +T E  + IP 
Sbjct  348  FGFYNPYWLLDIANVAIVVHLVGAFQVFCQPLFAFVEKWSAKRWPNSDFVTAEYEIPIPF  407

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV++TT+ISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+
Sbjct  408  YGV-YQLNLFRLVWRTIFVIITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQE  466

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWS++W+ LQMLS +CL VS+AAA GS AGVVLDL+ Y+PFKTSY
Sbjct  467  KIRKWSSKWVGLQMLSVSCLFVSIAAAVGSVAGVVLDLQTYKPFKTSY  514



>ref|XP_011002449.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A++PD EIITK+I +  PG
Sbjct  318  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAAARFPDSEIITKDIKVAFPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+Q+
Sbjct  378  F-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQR  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+ L++LS ACL V++AAAAGS AGVV DLK  +PF+TSY
Sbjct  437  RIPKWSTRWLGLRVLSFACLIVTIAAAAGSIAGVVDDLKSIKPFQTSY  484



>ref|XP_011003419.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=484

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHLVGAYQV+CQPLFAF+EK   A++PD EIITK+I +  PG
Sbjct  318  FGFYNPYWLLDIANAAIVIHLVGAYQVFCQPLFAFVEKEAAARFPDSEIITKDIKVAFPG  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+ +N FR++WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+Q+
Sbjct  378  F-RPFNINLFRMIWRTLFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQR  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRW+ L++LS ACL V++AAAAGS AGVV DLK  +PF+TSY
Sbjct  437  RIPKWSTRWLGLRVLSFACLIVTIAAAAGSIAGVVDDLKSIKPFQTSY  484



>gb|AAK33098.1| amino acid transporter [Glycine max]
Length=513

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP    +T E ++ IP 
Sbjct  347  FGFYNPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPC  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  407  FGV-YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RW+ LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  466  KIGRWTSRWLGLQLLSASCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_006590854.1| PREDICTED: amino acid permease 2-like [Glycine max]
Length=513

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP    +T E ++ IP 
Sbjct  347  FGFYNPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPC  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  407  FGV-YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RW+ LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  466  KIGRWTSRWLGLQLLSASCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_008444195.1| PREDICTED: amino acid permease 3-like [Cucumis melo]
Length=480

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAFIEK+   ++PD + I ++IN+ IPG
Sbjct  314  FGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFIEKYASNRFPDSQFINEDINIPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WRT FV++TT++SMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  374  F-RPFKLNLFRLVWRTIFVIITTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWI LQ+LS ACL +++AAAAGS AGV+ D K  +PF+T+Y
Sbjct  433  KIPKWSTRWISLQILSMACLIITIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 140/171 (82%), Gaps = 3/171 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    IT E+++ +  
Sbjct  315  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSYITGEVDVPLSL  374

Query  428  --GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
                G  YKLN FRL WRTAFV+ TTV+SMLLPFFNDVVG+LGA GFWPLTVYFPV MYI
Sbjct  375  AGAAGRCYKLNLFRLTWRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYI  434

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
             QKK+P+WST W+CLQ+LS  CL +++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  435  VQKKVPRWSTLWVCLQLLSLGCLIITVASAAGSVAGIISDLKVYKPFVTTY  485



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY P+WLLDIAN AIV+HLVGA+QVYCQPLFAF+EKW   +WP  + +T E ++ IP 
Sbjct  345  FGFYKPYWLLDIANVAIVVHLVGAFQVYCQPLFAFVEKWSAQRWPKRDFVTAEYDIPIPF  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV++TT+ISMLLPFFNDVVGILGAFGFWPLTVYFPV MYI+Q+
Sbjct  405  YGV-YQLNLFRLVWRTIFVMITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQ  463

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWS+RW+ L+MLS +CL V++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  464  KIGKWSSRWVGLKMLSISCLLVTIAAAVGSVAGVVLDLKTYKPFKTSY  511



>gb|EMS58805.1| hypothetical protein TRIUR3_05113 [Triticum urartu]
Length=242

 Score =   216 bits (550),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP+   +T E+  ++P 
Sbjct  80   FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEV--EVPL  137

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK+N FR  WRTAFV  TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  138  F-RTYKVNMFRATWRTAFVATTTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  196

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+PKWST+W+CLQMLS  CLA+SLAAAAGS AG+  DLK+Y PFKT
Sbjct  197  KVPKWSTQWVCLQMLSVGCLAISLAAAAGSIAGIKSDLKVYHPFKT  242



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW   KWP  + +T E ++ IP 
Sbjct  345  FGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIPF  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y++N FRL+WRT FV+LTTVI+ML+PFFNDVVGILGAFGFWPLTVYFPV MYI+QK
Sbjct  405  YGV-YQVNFFRLVWRTIFVMLTTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQK  463

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ RW+ LQ+LS  CL VS+AAA GSFAGVVLDLK Y+PFKTSY
Sbjct  464  KIGRWTGRWLGLQILSVTCLFVSIAAAVGSFAGVVLDLKTYKPFKTSY  511



>ref|XP_008219594.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=484

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK    K+P    ITK+I  +IP 
Sbjct  318  FGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTAAEKYPHSHFITKDIKFRIPC  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  + LN FRL+WRT FV+LTTVISM+LPFFNDVVG+LGA GFWPLTVYFPV MYI+ K
Sbjct  378  FGL-FNLNLFRLVWRTCFVILTTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIAAK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWSTRWICLQ+LSGACL V++AAAAGS AGV+ DLK+Y+PFKTSY
Sbjct  437  RIPKWSTRWICLQILSGACLIVTIAAAAGSVAGVISDLKIYKPFKTSY  484



>ref|XP_009421017.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 136/165 (82%), Gaps = 1/165 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY P+WLLDIAN AIVIHLVGAYQV+CQPLFAF+EKW    WP+ E +T+EI + I  
Sbjct  255  FGFYEPYWLLDIANTAIVIHLVGAYQVFCQPLFAFVEKWAARAWPNSEFVTREIQVPIAS  314

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL WR  FV++TTVISMLLPFFNDVVG LGA GFWPLTVYFP+ MYI Q 
Sbjct  315  -GTSYKLNLFRLTWRAVFVIVTTVISMLLPFFNDVVGFLGAIGFWPLTVYFPIEMYIVQT  373

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  111
            K+PKWSTRW+CLQ+LS ACL +++A+AAGS AGVV DLK+YRPF 
Sbjct  374  KVPKWSTRWVCLQLLSFACLIITIASAAGSIAGVVSDLKVYRPFN  418



>emb|CDX84450.1| BnaC03g50500D [Brassica napus]
Length=466

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLD+ANAAIV+HLVGAYQV+ QP+FAF+EK   A++P+ ++++KE  ++ PG
Sbjct  299  FGFYNPFWLLDVANAAIVVHLVGAYQVFAQPIFAFVEKQAAARFPNSDLVSKEFEIRFPG  358

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYK+N FR ++R+ FV+LTTVISML+PFFNDVVGILGA  FWPLTVYFPV MYI Q+
Sbjct  359  VRSPYKVNVFRTVFRSCFVVLTTVISMLMPFFNDVVGILGALAFWPLTVYFPVEMYIKQR  418

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ +WS +W+CLQMLS  CL V++ A  GS  GV+LDLK+Y+PFKT+Y
Sbjct  419  KVERWSMKWVCLQMLSCGCLVVTVVAGVGSVVGVMLDLKVYKPFKTTY  466



>gb|EYU23867.1| hypothetical protein MIMGU_mgv1a005496mg [Erythranthe guttata]
Length=481

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 144/167 (86%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EK     +P  E ITKEI + IPG
Sbjct  316  FGFYNPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKTAREWFPHSEFITKEIAIPIPG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                 KLN FRL+WRT FV++TT+ISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  376  L-KSLKLNLFRLVWRTVFVIITTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            +IPKWS RW+ LQ+LSGACL +S+AAAAGSFAGVV DLK+YRPFKT+
Sbjct  435  RIPKWSPRWLSLQILSGACLMISIAAAAGSFAGVVSDLKVYRPFKTT  481



>gb|KJB80668.1| hypothetical protein B456_013G109500 [Gossypium raimondii]
Length=406

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAF++K    K+PD +  T +I + IPG
Sbjct  240  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFVQKTASEKFPDSKFTTNDIKISIPG  299

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FRL+WRT FV++TT+ISMLLPFFND+V +LGA GFWPLTVYFPV MYISQK
Sbjct  300  F-RPYNLNLFRLVWRTCFVMITTLISMLLPFFNDIVRLLGALGFWPLTVYFPVEMYISQK  358

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+PKWST W+C Q+LS ACL +++AAAAGS AG+VLDLK Y  F T Y
Sbjct  359  KMPKWSTTWLCRQVLSIACLVITIAAAAGSIAGIVLDLKSYTSFSTGY  406



>ref|XP_003540867.1| PREDICTED: amino acid permease 2 [Glycine max]
Length=513

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP    +T E ++ IP 
Sbjct  347  FGFYNPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPC  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  407  FGV-YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RWI LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  466  KIGRWTSRWIGLQLLSVSCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+ QPLFAF+EKW   KWP    +T E ++ IP 
Sbjct  347  FGFYNPYWLLDIANLAIVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPC  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FVLLTT+I+ML+PFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  407  FGV-YQLNFFRLVWRTIFVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RWI LQ+LS +CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  466  KIGRWTSRWIGLQLLSVSCLIISLLAAVGSMAGVVLDLKTYKPFKTSY  513



>ref|XP_004142635.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 ref|XP_004170719.1| PREDICTED: amino acid permease 3-like [Cucumis sativus]
 gb|KGN54544.1| Amino acid permease [Cucumis sativus]
Length=480

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 146/168 (87%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAFIEK   +++PD + I ++IN+ IPG
Sbjct  314  FGFYNPYWLLDIANVAIVVHLVGAYQVFCQPLFAFIEKNASSRFPDSKFINEDINIPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  P+KLN FRL+WRT FV++TT++SMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  374  F-RPFKLNLFRLVWRTIFVIITTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRWI LQ+LS ACL +S+AAAAGS AGV+ D K  +PF+T+Y
Sbjct  433  KIPKWSTRWISLQILSMACLIISIAAAAGSVAGVIQDSKSIKPFQTTY  480



>ref|XP_007041865.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007041866.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97696.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX97697.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=512

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E ++ IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEKWCAQKWPKSDLVTAEYDIPIP-  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL WRT FV++TTVI+ML+PFFNDVVG LGA GFWPLTVYFPV MYISQK
Sbjct  405  FGGVYQLNLFRLAWRTIFVVMTTVIAMLMPFFNDVVGFLGAMGFWPLTVYFPVEMYISQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ++S AC  V++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRGTTRWLALQIISVACFFVTVAAAVGSVAGVVLDLKTYKPFKTSY  512



>ref|XP_009801366.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=481

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 145/167 (87%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEK     +P+ + I KEI++ I G
Sbjct  316  FGFYNPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKTAAEWYPESKFIAKEISVPIIG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +   +KLN FR++WRT FV++TTVISMLLPFFND+VGILGAFGFWPLTVYFPV MYI QK
Sbjct  376  Y-KSFKLNLFRIIWRTIFVIITTVISMLLPFFNDIVGILGAFGFWPLTVYFPVEMYIVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KI KWST+WICLQMLS ACL +S+AAAAGSFAGVV DL++Y+PFKT+
Sbjct  435  KITKWSTKWICLQMLSVACLIISIAAAAGSFAGVVSDLQVYKPFKTT  481



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQV+ QPLFAF+EKW   KWP    +T E  + IP 
Sbjct  347  FGFYNPYWLLDIANFAIVVHLIGAYQVFSQPLFAFVEKWSARKWPKNNFVTAEYEIAIPC  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL+WRT FVLLTT+I+MLLPFFNDVVGILGAFGFWPLTVYFP+ MYISQK
Sbjct  407  TGV-YKLNFFRLIWRTIFVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYFPIDMYISQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +WI LQMLS  CL +SL AA GS AGVVLDLK Y+PFKTSY
Sbjct  466  KIGRWTNKWIGLQMLSVCCLIISLLAAVGSIAGVVLDLKTYKPFKTSY  513



>ref|XP_002312967.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
 gb|EEE86922.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
Length=414

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EKW   KWP  + +T E  + IP 
Sbjct  248  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFAFVEKWSARKWPKSDFVTAEYEVPIPF  307

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+I+ML+PFFNDVVG+LG+ GFWPLTV+FP+ MYISQK
Sbjct  308  YGV-YQLNFFRLVWRTIFVMLTTLIAMLMPFFNDVVGLLGSMGFWPLTVFFPIEMYISQK  366

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+++WI LQ+LS  CL +++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  367  KIGRWTSQWIGLQILSMTCLMITIAAAVGSVAGVVLDLKTYKPFKTSY  414



>gb|ACR35411.1| unknown [Zea mays]
 tpg|DAA56511.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=341

 Score =   218 bits (554),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WPD   IT E+ + +P 
Sbjct  172  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAQRWPDSAYITGEVEVPLPL  231

Query  428  --GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
                    K+N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+
Sbjct  232  PASRRRCCKVNLFRATWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYV  291

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
             QKK+P+WS+RW+CLQMLS  CL +S+AAAAGS AG+  DLK+YRPFK+
Sbjct  292  VQKKVPRWSSRWVCLQMLSLGCLVISIAAAAGSIAGIASDLKVYRPFKS  340



>gb|EMT11988.1| hypothetical protein F775_30582 [Aegilops tauschii]
Length=408

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    IT EI  ++P 
Sbjct  243  FGFYEPFWLLDIANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRFITGEI--QVPL  300

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +KLN FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  301  VSCGFKLNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQK  360

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KIPKWS++W+CLQ+LS ACL +++AAAAGS AG++ DLK+Y+PF T+
Sbjct  361  KIPKWSSQWVCLQLLSLACLIITIAAAAGSIAGIMSDLKVYKPFSTT  407



>gb|KDP32820.1| hypothetical protein JCGZ_12112 [Jatropha curcas]
Length=487

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLF+FIEK    K+PD + IT++I + IP 
Sbjct  321  FGFYNPYWLLDIANVAIVVHLVGAYQVYCQPLFSFIEKTAAQKYPDSDFITRDIKIPIPC  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  + LN FR+++RT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI+QK
Sbjct  381  LG-TFNLNLFRMVFRTVFVIFTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIAQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWSTRW+CLQ+LSGACL +++AAAAGS AGV+ DLK  +PF+TSY
Sbjct  440  KIPKWSTRWLCLQILSGACLIITIAAAAGSIAGVITDLKTVKPFQTSY  487



>dbj|BAJ95327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP+   +T E+  ++P 
Sbjct  318  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEV--EVPL  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK+N FR  WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  376  F-RTYKVNMFRATWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+PKWSTRW+CLQMLS  CLA+SLAAAAGS AG+  DLK+Y PFKT
Sbjct  435  KVPKWSTRWVCLQMLSVGCLAISLAAAAGSIAGIKSDLKVYHPFKT  480



>gb|AAX56951.1| amino acid transporter [Pisum sativum]
Length=482

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHL+GAYQVYCQPL+AF+E ++  ++PD   + K I + IPG
Sbjct  316  FGFYNPFWLLDIANAAIVIHLIGAYQVYCQPLYAFVENYMVKRFPDNYFLNKNIKIPIPG  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKLN F+L+WRT FV+LTT++SMLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  376  LDM-YKLNLFKLVWRTVFVILTTLVSMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIIQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWST+W CLQ+LSGACL +++AA+ GS AG+ LDLK+++PFKT Y
Sbjct  435  KIPKWSTKWTCLQLLSGACLIITIAASVGSIAGIYLDLKVFKPFKTIY  482



>ref|XP_009404321.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404322.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=485

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLL+IANAAIV+HLVGAYQV+CQPLFAFIEKW    WP+   I KEI + +  
Sbjct  319  FGFYNPYWLLNIANAAIVVHLVGAYQVFCQPLFAFIEKWAVKTWPESTFIAKEIAVPLTP  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                Y L+ FRL+WR++FV+LTTVISMLLPFFNDVVG+LGA GFWPLTVYFPV MYI ++
Sbjct  379  -TRRYNLSLFRLVWRSSFVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVRQ  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IP+WSTRW+CLQMLS ACLAVS+AAA GS AGVV DL LYRPFKTSY
Sbjct  438  RIPRWSTRWVCLQMLSLACLAVSIAAAIGSVAGVVTDLNLYRPFKTSY  485



>emb|CAA70778.1| amino acid transporter [Vicia faba]
Length=509

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+ QP FAF+EKW   KWP  + +T+E ++ IP 
Sbjct  343  FGFYNPYWLLDIANFAIVVHLVGAYQVFSQPFFAFVEKWSAHKWPKNKFVTEEYDIPIPC  402

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL+WRT FVLLTT+I+MLLPFFNDVVG+LGAFGFWPLTVYFP+ MYISQK
Sbjct  403  IGV-YKLNLFRLIWRTIFVLLTTLIAMLLPFFNDVVGLLGAFGFWPLTVYFPIDMYISQK  461

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ RW+ LQMLSG CL +S  AA GS AGVVLDLK Y+PFKTSY
Sbjct  462  KIGRWTNRWLGLQMLSGCCLIISTLAAVGSIAGVVLDLKTYKPFKTSY  509



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EKW   +W +G+ +T E ++ IP 
Sbjct  346  FGFYNPYWLLDIANVAIVIHLVGAYQVYCQPLFAFVEKWSAQRWSNGDFVTAEYDIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL WRTAFV++TT+I+ML+PFFNDVVGILGA GFWPLTVYFP+ +Y++QK
Sbjct  406  YGV-YQLNFFRLSWRTAFVIVTTIIAMLVPFFNDVVGILGALGFWPLTVYFPIEIYVAQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+T+WI LQ+LS ACL VSL+AA GS AGVVL+LK Y+PFKTSY
Sbjct  465  KIGRWTTQWIGLQILSAACLLVSLSAAIGSVAGVVLELKTYKPFKTSY  512



>gb|EPS68727.1| hypothetical protein M569_06043, partial [Genlisea aurea]
Length=174

 Score =   211 bits (538),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWL+DIAN AIVIHL+GAYQVYCQPLFAF+EK     +P     TKE+++ IPG
Sbjct  8    FGFYNPFWLVDIANVAIVIHLIGAYQVYCQPLFAFVEKAAAGFFPGNRFFTKEVDIPIPG  67

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK++ FRL+WRTAFV++TT ISM LPFFNDVVGILGA GFWPLTVYFPV MY  Q+
Sbjct  68   FSRSYKVSLFRLMWRTAFVVVTTSISMALPFFNDVVGILGAIGFWPLTVYFPVAMYTKQE  127

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            ++ KWS +WICLQ+LS ACL VS+AAAAGS  GV+ DLK+Y+PF+ +
Sbjct  128  RLRKWSRKWICLQILSLACLLVSIAAAAGSIVGVMSDLKVYKPFEAN  174



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQV+CQPLFAF+EKW   +W   E IT E    +P 
Sbjct  347  FGFYNPYWLLDIANLAIVVHLVGAYQVFCQPLFAFVEKWSAQRWDKSEFITHEYEAHLPL  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  YKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA GFWPLTVYFPV MYI QK
Sbjct  407  VGSSYKLNLFRLVWRTIFVVVTTLISMLMPFFNDVVGILGAIGFWPLTVYFPVEMYIVQK  466

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +WS RW+ L++LS  CL VSLAAA GS AGVVLDLK YRPFK++Y
Sbjct  467  KIRRWSARWVGLRLLSFTCLVVSLAAACGSVAGVVLDLKSYRPFKSTY  514



>dbj|BAK03421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=480

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP+   +T E+  ++P 
Sbjct  318  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAKRWPESTFVTGEV--EVPL  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK+N FR  WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  376  F-RTYKVNMFRATWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+PKWSTRW+CLQMLS  CLA+SLAAAAGS AG+  DLK+Y PFK+
Sbjct  435  KVPKWSTRWVCLQMLSVGCLAISLAAAAGSIAGIKSDLKVYHPFKS  480



>gb|KDO68036.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=273

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  107  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  166

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  167  WGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  225

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  226  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  273



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY+P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   KW   + +T E ++ IP 
Sbjct  346  FGFYDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWSAQKWSTSDFVTAEYDIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT FV+LTTVI+ML+PFFNDVVGILGAFGFWPLTVYFPV MYIS +
Sbjct  406  CGM-YQLNFFRLVWRTLFVILTTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYISSR  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +I +W+T W+ LQ+LS  CL +S+AAA GS AGVVLDLK Y+PFKTSY
Sbjct  465  RIKRWTTMWVGLQILSMTCLLISIAAAVGSVAGVVLDLKTYKPFKTSY  512



>ref|XP_004498350.1| PREDICTED: amino acid permease 3-like isoform X1 [Cicer arietinum]
 ref|XP_004498351.1| PREDICTED: amino acid permease 3-like isoform X2 [Cicer arietinum]
Length=487

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 140/168 (83%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPL++ +EK    ++PD   I K+I + IPG
Sbjct  320  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLYSVVEKTASQRFPDSNFINKDIEIPIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P K+N FRL+WR+ FV+LTT+ISMLLPFFND+VG++GA GFWPLTVYFPV MYI Q 
Sbjct  380  VISPLKINLFRLVWRSFFVILTTIISMLLPFFNDIVGLIGAIGFWPLTVYFPVEMYIVQM  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WICL +LS ACL +SLA+AAGS AGV+ DL++Y+PF T Y
Sbjct  440  RIPKWSTKWICLHLLSAACLVISLASAAGSVAGVIADLQVYKPFHTVY  487



>ref|XP_006386360.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
 gb|ERP64157.1| hypothetical protein POPTR_0002s08040g [Populus trichocarpa]
Length=485

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 122/168 (73%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAA+VIHLVG YQ  CQPL+AFIEK    ++PD E ITK+I + IPG
Sbjct  319  FGFYNPYWLLDIANAAMVIHLVGIYQFSCQPLYAFIEKEAAQRFPDSEFITKDIKIPIPG  378

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PY LN FR++WRT FV+LTTVISMLLPFFND+V +LGA GFWPLTVYFPV MYI QK
Sbjct  379  F-RPYNLNLFRMIWRTLFVVLTTVISMLLPFFNDIVRLLGALGFWPLTVYFPVEMYIVQK  437

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KWSTRW+CLQ+LS ACL +S+AAAAGS AG+V DLK  +PF+TSY
Sbjct  438  KIRKWSTRWLCLQILSVACLIISIAAAAGSVAGIVGDLKSIKPFQTSY  485



>dbj|BAK03497.1| predicted protein [Hordeum vulgare subsp. vulgare]
 emb|CCI51007.2| amino acid permease [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 139/167 (83%), Gaps = 2/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    IT EI  ++P 
Sbjct  324  FGFYEPFWLLDIANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRFITGEI--QVPL  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                +K+N FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  382  ISSGFKINLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGAIGFWPLTVYFPVEMYIVQK  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KIPKWS++W+CLQ+LS ACL +++AAAAGS AG++ DLK+Y+PF T+
Sbjct  442  KIPKWSSQWVCLQLLSLACLIITIAAAAGSIAGIMSDLKVYKPFSTT  488



>ref|XP_002458869.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
 gb|EES03989.1| hypothetical protein SORBIDRAFT_03g041840 [Sorghum bicolor]
Length=491

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WPD   +T E+ + +P 
Sbjct  324  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAQRWPDSAFVTGEVEVPLPA  383

Query  425  FGY-PYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  249
                  K+N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ Q
Sbjct  384  TRRRSCKVNLFRATWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQ  443

Query  248  KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            KK+P+WS RW+CLQMLS  CL +S+AAAAGS AG+  DLK+YRPFK+
Sbjct  444  KKVPRWSPRWVCLQMLSLGCLVISVAAAAGSIAGIASDLKVYRPFKS  490



>emb|CDM85442.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 137/166 (83%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   +WP+   +T E+  ++P 
Sbjct  318  FGFYEPFWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEV--EVPL  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK+N FR  WRTAFV  TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  376  F-RTYKVNMFRATWRTAFVTATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+PKWST+W+CLQMLS  CLA+SLAAAAGS AG+  DLK+Y PFKT
Sbjct  435  KVPKWSTQWVCLQMLSLGCLAISLAAAAGSIAGIKSDLKVYHPFKT  480



>ref|NP_001045010.1| Os01g0882800 [Oryza sativa Japonica Group]
 dbj|BAB90366.1| putative amino acid carrier [Oryza sativa Japonica Group]
 dbj|BAF06924.1| Os01g0882800 [Oryza sativa Japonica Group]
 gb|EAY76727.1| hypothetical protein OsI_04682 [Oryza sativa Indica Group]
 gb|EAZ14390.1| hypothetical protein OsJ_04310 [Oryza sativa Japonica Group]
Length=488

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW   +WP+   IT E+ L++  
Sbjct  322  FGFYEPFWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAAQRWPESPYITGEVELRLSP  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                 ++N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  382  SSRRCRVNLFRSTWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  441

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  111
            K+P+WSTRW+CLQMLS  CL +S+AAAAGS AGV+ DLK+YRPFK
Sbjct  442  KVPRWSTRWVCLQMLSVGCLVISIAAAAGSIAGVMSDLKVYRPFK  486



>emb|CDP10973.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AI IHLVGAYQVYCQPLFAFIEK   + +P+ + ITKEI + IPG
Sbjct  321  FGFYNPYWLLDIANIAIAIHLVGAYQVYCQPLFAFIEKTARSWFPESQFITKEIEIPIPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKLN FRL+WR+ FV++TTVISML+PFFNDVVGILGAFGFWPLTVYFPV MYI QK
Sbjct  381  F-KPYKLNLFRLVWRSIFVVITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQK  439

Query  245  KIPKWSTRWICLQM  204
            KIPKWSTRW+CLQ+
Sbjct  440  KIPKWSTRWLCLQI  453



>gb|KEH35328.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=479

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHL+G+YQVYCQPL+AF+E +   ++P  + + K I + IPG
Sbjct  313  FGFYNPFWLLDIANAAIVIHLIGSYQVYCQPLYAFVESYTAKRFPQSDFVNKNIKIPIPG  372

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKLN FRL+WRT FV+L+T+++MLLPFFND+VG+LGA GFWPLTVYFPV MYI QK
Sbjct  373  IQM-YKLNLFRLVWRTIFVILSTLVAMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYIVQK  431

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS++WICLQ+LS  CL +S+AAA GS AG+VLDLK+++PFK+ Y
Sbjct  432  RIPKWSSKWICLQLLSVVCLIISIAAAVGSIAGIVLDLKVFKPFKSVY  479



>emb|CDM85443.1| unnamed protein product [Triticum aestivum]
Length=480

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   +WP+   +T E+  ++P 
Sbjct  318  FGFYEPFWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWAAKRWPESTYVTGEV--EVPL  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   YK+N FR  WRTAFV+ TTV+SM+LPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  376  F-RTYKVNMFRAAWRTAFVVATTVVSMMLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
            K+PKWST+W+CLQMLS  CLA+SLAAAAGS AG+  DLK+Y PFK+
Sbjct  435  KVPKWSTQWVCLQMLSLGCLAISLAAAAGSIAGIKSDLKVYHPFKS  480



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 137/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HLVGAYQVYCQPLFAF+EKW   +WP  E +++E   +IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLVGAYQVYCQPLFAFVEKWSAQRWPKSEFVSREYEARIPV  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKLN FR++WRT FV++TT ISML+PFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  406  METTYKLNLFRVIWRTIFVVVTTTISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +WS  W+ L++LS  CL VS+AAA GS AGVVLDLK YRPFK +Y
Sbjct  466  KIRRWSAPWVGLRLLSFTCLVVSVAAACGSVAGVVLDLKSYRPFKATY  513



>ref|XP_007137460.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
 gb|ESW09454.1| hypothetical protein PHAVU_009G128600g [Phaseolus vulgaris]
Length=487

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVG+YQV+ QPLFAF+EK V +++PD + + KEI + +PG
Sbjct  321  FGFYNPYWLLDIANAAIVVHLVGSYQVFSQPLFAFVEKIVASRFPDSDFVKKEIEIGVPG  380

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WRT +V+++TVI+MLLPFFND+ G+LGA GFWPL VYFPV MYI QK
Sbjct  381  L-RPYKLNLFRLVWRTIYVVISTVIAMLLPFFNDMGGLLGALGFWPLAVYFPVEMYIVQK  439

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WIC Q+L+ +CL V+L AA GS AG+V DLK Y+PFKT+Y
Sbjct  440  RIPKWSTKWICFQILNISCLLVTLCAAVGSLAGIVFDLKTYKPFKTNY  487



>ref|NP_001055592.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|AAV24773.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF17506.1| Os05g0424000 [Oryza sativa Japonica Group]
 gb|EAY98107.1| hypothetical protein OsI_20024 [Oryza sativa Indica Group]
 gb|EEE63778.1| hypothetical protein OsJ_18601 [Oryza sativa Japonica Group]
Length=496

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 144/174 (83%), Gaps = 6/174 (3%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    ITK+I++ +  
Sbjct  323  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSWYITKDIDVPLSL  382

Query  428  -----GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVR  264
                 G G  YKLN FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV 
Sbjct  383  SGGGGGGGRCYKLNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGAVGFWPLTVYFPVE  442

Query  263  MYISQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            MYI QK+IP+WSTRW+CLQ+LS ACLA+++A+AAGS AG++ DLK+Y+PF T+Y
Sbjct  443  MYIVQKRIPRWSTRWVCLQLLSLACLAITVASAAGSIAGILSDLKVYKPFATTY  496



>ref|XP_004290905.1| PREDICTED: amino acid permease 3-like [Fragaria vesca subsp. 
vesca]
Length=480

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIVIHLVGAYQV+ QPLFAF+EK    K+PD + I+K I ++IP 
Sbjct  314  FGFYNPYWLIDIANAAIVIHLVGAYQVFVQPLFAFVEKSAAEKFPDSQFISKNIKIQIPC  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y LN FRL+WRT FV+ TTVISM+LPFFNDVVG+LGA GFWPLTVYFPV MYI QK
Sbjct  374  VGL-YNLNMFRLVWRTLFVITTTVISMILPFFNDVVGLLGALGFWPLTVYFPVEMYIVQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+W+CLQ LSGACL +++AAAAGS AGV+ DLK Y+PF++SY
Sbjct  433  RIPKWSTKWLCLQTLSGACLIITIAAAAGSIAGVISDLKTYKPFQSSY  480



>ref|NP_001142349.1| hypothetical protein [Zea mays]
 ref|XP_008672537.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672538.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008672539.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF88256.1| unknown [Zea mays]
 tpg|DAA56510.1| TPA: hypothetical protein ZEAMMB73_220445 [Zea mays]
Length=494

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 3/169 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIP-  429
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WPD   IT E+ + +P 
Sbjct  325  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAAQRWPDSAYITGEVEVPLPL  384

Query  428  --GFGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYI  255
                    K+N FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+
Sbjct  385  PASRRRCCKVNLFRATWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYV  444

Query  254  SQKKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKT  108
             QKK+P+WS+RW+CLQMLS  CL +S+AAAAGS AG+  DLK+YRPFK+
Sbjct  445  VQKKVPRWSSRWVCLQMLSLGCLVISIAAAAGSIAGIASDLKVYRPFKS  493



>gb|KDO68037.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=381

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  215  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  274

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  275  WGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  333

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  334  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  381



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AI +HLVGAYQVYCQPLFAF+EKW   KWP    +T E  + IP 
Sbjct  345  FGFYNPYWLLDIANVAIFVHLVGAYQVYCQPLFAFVEKWSARKWPQSNFVTAEYEVPIPF  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+I+ML+PFFNDVVG+LGA GFWPLTV+FP+ MYISQK
Sbjct  405  YGV-YQLNFFRLVWRTIFVMLTTLIAMLMPFFNDVVGLLGALGFWPLTVFFPIEMYISQK  463

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +WI LQ+LS  CL +++AAA GS AGVVLDLK YRPFKTSY
Sbjct  464  KIGRWTNQWIGLQILSMTCLVITIAAAVGSVAGVVLDLKTYRPFKTSY  511



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AI++HLVGAYQVYCQPLFAF+EKW   KWP  + +T E  + IP 
Sbjct  356  FGFYNPYWLLDIANIAIIVHLVGAYQVYCQPLFAFVEKWSAHKWPKNDFVTAEYEIPIPH  415

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FR++WR+ FV++TT+I+ML+PFFND+VG+LGA GFWPLTVYFP+ MYISQK
Sbjct  416  CGV-YRLNFFRIVWRSIFVIVTTLIAMLMPFFNDIVGLLGALGFWPLTVYFPIEMYISQK  474

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W++RWI LQ+LS  CL +++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  475  KIGQWTSRWIALQILSVCCLFITIAAAVGSVAGVVLDLKTYKPFKTSY  522



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF++P+WLLDIANAAIVIHL+GAYQVYCQPLFAF+EKW   KW +   +T E  ++IP 
Sbjct  346  FGFFDPYWLLDIANAAIVIHLIGAYQVYCQPLFAFVEKWSAKKWSNSNFVTAEHGIRIPL  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FR++WRT FV+LTT+I+MLLPFFNDVVG+LGA GFWPLTVYFP+ MYI QK
Sbjct  406  FGV-YQLNFFRVIWRTIFVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +WI LQMLS ACL VS+AAA GS AGVVLDLK Y+PF T+Y
Sbjct  465  KIGRWTNQWIGLQMLSAACLFVSIAAAVGSIAGVVLDLKTYKPFNTTY  512



>ref|XP_008338672.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 145/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF+NP+WL+DIANAAIVIHLVGAYQV+ QPL+AF+EK V  K+P    ITK+I  ++P 
Sbjct  318  FGFFNPYWLIDIANAAIVIHLVGAYQVFVQPLYAFVEKTVKEKYPHSRFITKDIKFRLPV  377

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y LN FRL+WRT+FV++TTVISM+LPFFNDVVG+LGA GFWPLTVY PV MYI+QK
Sbjct  378  FG-SYBLNLFRLVWRTSFVIVTTVISMILPFFNDVVGLLGALGFWPLTVYXPVEMYIAQK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST W+CLQ LSGACL +++AAAAGS AGV+ DLK+Y+PFKTSY
Sbjct  437  RIPKWSTXWLCLQTLSGACLIITIAAAAGSIAGVISDLKIYKPFKTSY  484



>ref|XP_008368062.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=484

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 137/166 (83%), Gaps = 1/166 (1%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK     +P+ + +TK+I ++IPGF
Sbjct  319  GFSNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTTTKNFPNSQFVTKDIKIQIPGF  378

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
             Y Y LN FRL+WRT FV+LTTVISM+ PFFND+VG LGA GFWPLTVYFPV MYI+QKK
Sbjct  379  SY-YTLNLFRLVWRTIFVILTTVISMIFPFFNDIVGFLGALGFWPLTVYFPVEMYIAQKK  437

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            IP WSTRW+CLQ LS   L ++L+AAAGS  GV+ +LK+YRPFKTS
Sbjct  438  IPMWSTRWMCLQTLSLCVLIIALSAAAGSVTGVIHNLKVYRPFKTS  483



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF++P+WLLDIAN +IV+HLVGAYQVYCQPLFAF+EKW  AKW     +T E ++ +P 
Sbjct  347  FGFFDPYWLLDIANVSIVVHLVGAYQVYCQPLFAFVEKWSAAKWSRSNFVTAEYDIPVPF  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FR++WRT FV+LTT+I+ML+PFFNDVVGILGA GFWPLTVYFPV MYI++ 
Sbjct  407  FGV-YQLNFFRVVWRTCFVVLTTLIAMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAKN  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI KW++RWI LQMLS ACL VS+AAA GS AGVVLDL+ Y+PFKTSY
Sbjct  466  KIGKWTSRWIGLQMLSMACLLVSVAAAVGSVAGVVLDLQTYKPFKTSY  513



>gb|KEH35330.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=480

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIAN AIVIHL+GAYQVYCQPL+AF+E +   ++P  +++ K I + IPG
Sbjct  314  FGFYNPFWLLDIANVAIVIHLIGAYQVYCQPLYAFVENYTAKRFPQSDLVNKNIKIPIPG  373

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                 KLN FRL+WRT FV+LTT++SMLLPFFND+ G+LGA GFWPLTVYFPV MYI QK
Sbjct  374  RQM-CKLNLFRLVWRTIFVILTTLVSMLLPFFNDIAGLLGALGFWPLTVYFPVEMYIIQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS++WICLQ+LS ACL +S+AAA GS AG+VLDLK+++PFKT Y
Sbjct  433  RIPKWSSKWICLQLLSVACLIISIAAAVGSIAGIVLDLKVFKPFKTVY  480



>ref|XP_010063420.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70648.1| hypothetical protein EUGRSUZ_F03820 [Eucalyptus grandis]
Length=480

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+W++DIANAAIVIHL+GAYQVYCQPLFAF+EK    K+P+ + IT++I  +IP 
Sbjct  317  FGFYNPYWMVDIANAAIVIHLIGAYQVYCQPLFAFVEKAANKKFPNSQFITRDI--EIPT  374

Query  425  FG-YPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  249
             G   YKLN FRL+WRT FV+ TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI Q
Sbjct  375  LGLRTYKLNLFRLVWRTVFVITTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIKQ  434

Query  248  KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  111
            K+IPKWST+W+CLQ+LS ACL +++AAAAGS AGVVLDLK Y+PF 
Sbjct  435  KQIPKWSTKWVCLQILSMACLIITIAAAAGSVAGVVLDLKSYKPFN  480



>ref|XP_006422618.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
 gb|ESR35858.1| hypothetical protein CICLE_v10028230mg [Citrus clementina]
Length=512

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  346  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  406  WGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTSY  512



>gb|KEH30491.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF+EKW   KWP    +T E  + IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIPC  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDVVGILGAFGFWPLTVY+P+ MYISQK
Sbjct  406  IGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +W+ LQMLSG CL +S+ AA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRWTKKWLALQMLSGCCLIISILAAVGSIAGVVLDLKTYKPFKTSY  512



>gb|KEH30492.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   218 bits (554),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF+EKW   KWP    +T E  + IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIPC  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDVVGILGAFGFWPLTVY+P+ MYISQK
Sbjct  406  IGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +W+ LQMLSG CL +S+ AA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRWTKKWLALQMLSGCCLIISILAAVGSIAGVVLDLKTYKPFKTSY  512



>gb|KHN19623.1| Amino acid permease 3 [Glycine soja]
Length=478

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN  IVIHLVGAYQVYCQPLF+F+E    A++P+ + +++E  + IPG
Sbjct  312  FGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIPG  371

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY+LN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV MYI+Q 
Sbjct  372  C-KPYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQT  430

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKW  RWICLQMLS AC  V+L AAAGS AGV+ DLK+Y+PF TSY
Sbjct  431  KIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPFVTSY  478



>gb|KDO68034.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=404

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  238  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  297

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  298  WGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  356

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  357  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  404



>ref|XP_006596218.1| PREDICTED: amino acid permease 3-like isoform X1 [Glycine max]
 ref|XP_006596219.1| PREDICTED: amino acid permease 3-like isoform X2 [Glycine max]
Length=479

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIAN  IVIHLVGAYQVYCQPLF+F+E    A++P+ + +++E  + IPG
Sbjct  313  FGFYNPYWLIDIANVGIVIHLVGAYQVYCQPLFSFVESHAAARFPNSDFMSREFEVPIPG  372

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PY+LN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV MYI+Q 
Sbjct  373  C-KPYRLNLFRLVWRTIFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQT  431

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKW  RWICLQMLS AC  V+L AAAGS AGV+ DLK+Y+PF TSY
Sbjct  432  KIPKWGPRWICLQMLSAACFVVTLLAAAGSIAGVIDDLKVYKPFVTSY  479



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    I  EI +    
Sbjct  326  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS---  382

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
              + +K+N FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  383  --FGFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQK  440

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KIP+W ++W+CLQ+LS ACL +++A+AAGS AG++ DLK+Y+PF TS
Sbjct  441  KIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKVYKPFSTS  487



>ref|XP_009390766.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390767.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=492

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW    WPD   ITKE+ + +  
Sbjct  326  FGFYNPYWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAVRTWPDSTFITKEVAVPLTP  385

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                ++L+ FRL+WR+ FV+LTTVISMLLPFFNDVV +LGA GFWPLTVYFPV MYI QK
Sbjct  386  TKR-FRLSLFRLVWRSTFVVLTTVISMLLPFFNDVVALLGALGFWPLTVYFPVEMYIVQK  444

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            +IP+WS RW+CLQMLS  CL +++AAA GS AG+  DLK+Y PFKT+
Sbjct  445  RIPRWSLRWVCLQMLSLGCLVITIAAAVGSVAGIFTDLKVYHPFKTT  491



>ref|XP_009342937.1| PREDICTED: amino acid permease 2-like [Pyrus x bretschneideri]
Length=416

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK     +P+ + +TK+I + IPGF
Sbjct  251  GFSNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTATKNFPNSQFVTKDIKILIPGF  310

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
             Y Y LN FRL+WRT FV+LTTVISM+LPFFN++VG LGA GFWPLTVYFPV MYI+QKK
Sbjct  311  SY-YTLNLFRLVWRTIFVILTTVISMILPFFNNIVGFLGALGFWPLTVYFPVEMYIAQKK  369

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            IP WSTRW+CLQ LS   L ++L+AAAGS  GV+  LK+YRPFKTS
Sbjct  370  IPMWSTRWMCLQTLSLCVLIIALSAAAGSVTGVIDSLKVYRPFKTS  415



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLD+ANAAIV+HLVGAYQVYCQPLFAF+EKW   +WP    I  EI +    
Sbjct  320  FGFYEPFWLLDVANAAIVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS---  376

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
              + +K+N FRL WR+AFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MYI QK
Sbjct  377  --FGFKVNLFRLTWRSAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQK  434

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            KIP+W ++W+CLQ+LS ACL +++A+AAGS AG++ DLK+Y+PF TS
Sbjct  435  KIPRWGSQWVCLQLLSLACLVITVASAAGSVAGIMSDLKVYKPFSTS  481



>ref|XP_008219720.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=483

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 141/166 (85%), Gaps = 1/166 (1%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF+NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK     +P+ + IT++I + IPGF
Sbjct  318  GFHNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTAAEFFPNSQFITEDIRIPIPGF  377

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
            G  Y LN FRL+WRT +V++TT+ISM+LPFFNDVVG LGA G+WPLTVYFPV MYI+QKK
Sbjct  378  G-AYNLNLFRLVWRTFYVIITTLISMILPFFNDVVGFLGALGYWPLTVYFPVEMYIAQKK  436

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            +PKWSTRWICLQ+LS + L ++LAAAAGS  GVV DLK+Y+PFKTS
Sbjct  437  VPKWSTRWICLQILSLSVLVIALAAAAGSVIGVVQDLKIYKPFKTS  482



>ref|XP_006645132.1| PREDICTED: amino acid permease 2-like [Oryza brachyantha]
Length=484

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFY PFWLLDIANAAIV+HLVGAYQV+CQPLFAF+EKW   +WP+   IT+E+ +++  
Sbjct  322  FGFYEPFWLLDIANAAIVVHLVGAYQVFCQPLFAFVEKWAAQRWPESPYITREVEVRLSP  381

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
                YKL+ FR  WRTAFV+ TTV+SMLLPFFNDVVG LGA GFWPLTVYFPV MY+ QK
Sbjct  382  -SRRYKLSLFRSTWRTAFVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYVVQK  440

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPF  114
            K+P+WST+W+CLQMLS  CL +S+AAAAGS AG++ DLK+YRPF
Sbjct  441  KVPRWSTQWVCLQMLSVGCLVISIAAAAGSIAGIMSDLKVYRPF  484



>ref|XP_009764610.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana sylvestris]
Length=414

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF++P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   KW     +T E ++ IP 
Sbjct  248  FGFFDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWSAKKWSKSNFVTAEHDIPIPF  307

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FR++WRT FV+LTT+I+MLLPFFNDVVG+LGA GFWPLTVYFP+ MYI QK
Sbjct  308  VGV-YQLNFFRVIWRTIFVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQK  366

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +WI L+MLS ACL VS+AAA GS AGVVLDLK Y+PFKT Y
Sbjct  367  KIGRWTNQWIGLEMLSAACLFVSIAAAVGSIAGVVLDLKTYKPFKTIY  414



>ref|XP_006486755.1| PREDICTED: amino acid permease 3-like [Citrus sinensis]
Length=512

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  346  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  406  WGV-YQLNLFRLVWRTIFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  465  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  512



>ref|XP_010063423.1| PREDICTED: amino acid permease 3-like [Eucalyptus grandis]
 gb|KCW70652.1| hypothetical protein EUGRSUZ_F03827 [Eucalyptus grandis]
Length=483

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+W++DIANAAIVIHL+G YQVYCQPLFAF+EK    K+P+ + IT++I  +IP 
Sbjct  320  FGFYNPYWMVDIANAAIVIHLIGTYQVYCQPLFAFVEKAAIKKFPNSQFITRDI--EIPT  377

Query  425  FG-YPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQ  249
             G   YKLN FRL+WRT FV++TTVISMLLPFFND+VG+LGA GFWPLTVYFPV MYI Q
Sbjct  378  LGLRTYKLNLFRLVWRTVFVIMTTVISMLLPFFNDIVGLLGALGFWPLTVYFPVEMYIKQ  437

Query  248  KKIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFK  111
            K+IPKWST+W+CLQ+LS ACL +++AAAAGS AGVVLDLK Y+PF 
Sbjct  438  KQIPKWSTKWVCLQILSMACLIITIAAAAGSVAGVVLDLKSYKPFN  483



>gb|KDO68035.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=512

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 140/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+CQPLFAF+EKW   KWP  +++T E  + IP 
Sbjct  346  FGFYNPYWLIDIANAAIVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPF  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +G  Y+LN FRL+WRT FV+LTT+ISMLLPFFNDVVGILGA GFWPLTVYFP+ MY +QK
Sbjct  406  WGV-YQLNLFRLVWRTLFVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI + +TRW+ LQ+L+ +C  ++L AA GS AGVVLDLK Y+PFKT Y
Sbjct  465  KIGRGTTRWLGLQILNVSCFFITLVAAIGSVAGVVLDLKTYKPFKTRY  512



>ref|XP_011102300.1| PREDICTED: amino acid permease 3 isoform X1 [Sesamum indicum]
Length=491

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQVYCQPLFAFIEK     +PD + IT EI + IPG
Sbjct  325  FGFYNPYWLLDIANVAIVVHLIGAYQVYCQPLFAFIEKTALEWYPDSKFITAEITIPIPG  384

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  385  I-KPYKLNLFRLIWRTIFVIITTIISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  443

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS RW+CLQ+LS ACL +S+AA  GSFAGVV DLK+Y+PFKTSY
Sbjct  444  RIPKWSARWMCLQILSMACLVISVAALVGSFAGVVSDLKVYKPFKTSY  491



>ref|XP_011102302.1| PREDICTED: amino acid permease 3 isoform X2 [Sesamum indicum]
Length=486

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 144/168 (86%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQVYCQPLFAFIEK     +PD + IT EI + IPG
Sbjct  320  FGFYNPYWLLDIANVAIVVHLIGAYQVYCQPLFAFIEKTALEWYPDSKFITAEITIPIPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WRT FV++TT+ISML+PFFNDVVGILGA GFWPLTVYFPV MYI+QK
Sbjct  380  I-KPYKLNLFRLIWRTIFVIITTIISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS RW+CLQ+LS ACL +S+AA  GSFAGVV DLK+Y+PFKTSY
Sbjct  439  RIPKWSARWMCLQILSMACLVISVAALVGSFAGVVSDLKVYKPFKTSY  486



>gb|AFK37021.1| unknown [Medicago truncatula]
Length=512

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIV+HL+GAYQV+ QP FAF+EKW   KWP    +T E  + IP 
Sbjct  346  FGFYNPYWLLDIANLAIVVHLIGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIPC  405

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT FVLLTT+I+MLLPFFNDVVGILGAFGFWPLTVY+P+ MYISQK
Sbjct  406  IGV-YQLNFFRLIWRTLFVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +W+ LQ+LSG CL +S+ AA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KIGRWTKKWLALQVLSGCCLIISILAAVGSIAGVVLDLKTYKPFKTSY  512



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+ QP+FAF+EK    +WP+   I KE  +++P 
Sbjct  312  FGFYNPYWLIDIANAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPN---IEKEYKIELPC  368

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FR+LWRT FV LTTVISMLLPFFND+VG++GA GFWPLTVYFPV MYI+QK
Sbjct  369  LP-PYKLNLFRMLWRTVFVTLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYIAQK  427

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKW+ +WICLQ+ S ACL VS+AAA GS AGV++DLK Y PF++SY
Sbjct  428  KIPKWNKKWICLQIFSFACLVVSIAAAVGSIAGVLVDLKKYTPFQSSY  475



>ref|XP_004503904.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=486

 Score =   214 bits (545),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 140/168 (83%), Gaps = 4/168 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIV+HLVGAYQV+ QP+FAF+EK    +WP+   I KE  + +PG
Sbjct  323  FGFYNPYWLIDIANAAIVVHLVGAYQVFSQPIFAFVEKSATQRWPN---IEKEFKIAVPG  379

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WRT FV+LTTVISMLLPFFND+VG++GA GFWPLTVYFPV MYISQK
Sbjct  380  VP-PYKLNLFRLVWRTVFVVLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYISQK  438

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWS RWI LQ+ S ACL VS+ AA GS AGV+LDLK Y+PF+++Y
Sbjct  439  RIPKWSNRWIWLQIFSVACLVVSVVAAVGSVAGVLLDLKKYKPFQSNY  486



>gb|AAX56952.1| amino acid transporter, partial [Pisum sativum]
Length=468

 Score =   213 bits (543),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (80%), Gaps = 4/168 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIVIHLVGAYQVY QPLFAF+EK +  +WP    I KE  + IPG
Sbjct  305  FGFYNPYWLIDIANAAIVIHLVGAYQVYAQPLFAFVEKIMIKRWPK---INKEYIVTIPG  361

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F +PY LN FRL+WRT FV+ TTVISML+PFFNDV+G++GA GFWPLTVYFPV MYI QK
Sbjct  362  F-HPYHLNLFRLIWRTIFVITTTVISMLIPFFNDVLGLIGAVGFWPLTVYFPVEMYIKQK  420

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKW+ +WIC+Q LS  C  VS+ A  GS A +VLDLK Y+PF T Y
Sbjct  421  KIPKWNYKWICMQTLSVICFVVSVVATVGSVASIVLDLKKYKPFTTDY  468



>ref|XP_009339433.1| PREDICTED: amino acid permease 3-like [Pyrus x bretschneideri]
Length=484

 Score =   214 bits (544),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 136/166 (82%), Gaps = 1/166 (1%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF NPFWL+DIANAAIVIHLVGAYQV+ QP+FA +EK     +P+ + +TK+I + IPGF
Sbjct  319  GFSNPFWLIDIANAAIVIHLVGAYQVFAQPIFALVEKTATKNFPNSQFVTKDIKILIPGF  378

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
             Y Y LN FRL+WRT FV++TTVISM+LPFFN++VG LGA GFWPLTVYFPV MYI+QKK
Sbjct  379  SY-YTLNLFRLVWRTIFVIITTVISMILPFFNNIVGFLGALGFWPLTVYFPVEMYIAQKK  437

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTS  105
            IP WSTRW+CLQ LS   L ++L+AAAGS  GV+  LK+YRPFKTS
Sbjct  438  IPMWSTRWMCLQTLSLCVLIIALSAAAGSVTGVIDSLKVYRPFKTS  483



>gb|KJB15783.1| hypothetical protein B456_002G196200 [Gossypium raimondii]
Length=512

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AIVIHLVGAYQV+CQPLFAF+EKW   KWP+   +T E  +  P 
Sbjct  346  FGFYNPYWLLDIANLAIVIHLVGAYQVFCQPLFAFVEKWCAQKWPNCNFVTAEYEIPTP-  404

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            FG  Y+LN FRL+WRT FV +TT+I+ML+PFFNDVVG LGA GFWPLTVYFP+ MYIS K
Sbjct  405  FGGVYELNLFRLVWRTIFVAITTIIAMLMPFFNDVVGFLGAMGFWPLTVYFPIEMYISHK  464

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ + ++RW+ LQ++S AC  V++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  465  KVGRGTSRWLALQIISVACFFVTVAAAVGSIAGVVLDLKTYKPFKTSY  512



>gb|KEH40510.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=483

 Score =   213 bits (543),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 0/168 (0%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWLLDIANAAIVIHLVGA+QVY QPL++ +EK    ++PD + + K+I + IP 
Sbjct  316  FGFYNPFWLLDIANAAIVIHLVGAFQVYVQPLYSVVEKTAAERFPDSDFVNKDIEISIPC  375

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P K+N FRL+WR+ FV++TTVISMLLPFFND+VG++GA GFWPLTVYFPV MYI QK
Sbjct  376  VASPLKINLFRLVWRSIFVIITTVISMLLPFFNDIVGLIGAIGFWPLTVYFPVEMYIVQK  435

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +IPKWST+WICL MLS ACL +SLAAAAGS AGV+ DL +Y+PF   Y
Sbjct  436  QIPKWSTKWICLHMLSAACLVISLAAAAGSVAGVIADLGVYKPFHAMY  483



>emb|CAH59424.1| amino acid permease [Plantago major]
Length=195

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF++P+WLLDIAN AIV+HLVGAYQVYCQPLFAFIEKW   KW   + +T E ++ IP 
Sbjct  29   FGFFDPYWLLDIANIAIVVHLVGAYQVYCQPLFAFIEKWSVRKWSRSDFVTAEYDIPIPL  88

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FRL+WRT +V+ TT+I+MLLPFFNDVVGILGA GFWPLTVYFPV MYI+Q 
Sbjct  89   CGV-YQLNLFRLVWRTIYVVFTTLIAMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQN  147

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            K+ KW+++WI LQ+LS ACL VS+AAA GS AGV+LDL+ ++PFKT Y
Sbjct  148  KVRKWTSQWIGLQLLSIACLLVSVAAAVGSIAGVILDLRTFKPFKTVY  195



>ref|XP_009764609.1| PREDICTED: amino acid permease 4-like isoform X1 [Nicotiana sylvestris]
Length=513

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 139/168 (83%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGF++P+WLLDIANAAIVIHLVGAYQVYCQPLFAF+EKW   KW     +T E ++ IP 
Sbjct  347  FGFFDPYWLLDIANAAIVIHLVGAYQVYCQPLFAFVEKWSAKKWSKSNFVTAEHDIPIPF  406

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
             G  Y+LN FR++WRT FV+LTT+I+MLLPFFNDVVG+LGA GFWPLTVYFP+ MYI QK
Sbjct  407  VGV-YQLNFFRVIWRTIFVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQK  465

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KI +W+ +WI L+MLS ACL VS+AAA GS AGVVLDLK Y+PFKT Y
Sbjct  466  KIGRWTNQWIGLEMLSAACLFVSIAAAVGSIAGVVLDLKTYKPFKTIY  513



>ref|XP_010527720.1| PREDICTED: amino acid permease 5-like isoform X2 [Tarenaya hassleriana]
Length=480

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF+NP+WL+DIAN  IVIHLVGAYQVYCQPLFAF+E     ++PD ++ITKEI +++   
Sbjct  314  GFFNPYWLIDIANLTIVIHLVGAYQVYCQPLFAFVENQASKRFPDSKLITKEIKIRLFPG  373

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
              PY LN FRL+WRT FV+LTT+ISML+PFFNDV+G LGA GFWPLTVYFPV MYI  K+
Sbjct  374  REPYNLNLFRLVWRTLFVILTTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEMYIEHKR  433

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            I +WSTRW+CLQ+LS ACL V+LA+AAGS  G+V DLK Y+PFKT +
Sbjct  434  IQRWSTRWVCLQVLSFACLVVTLASAAGSVVGIVTDLKTYKPFKTDF  480



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNPFWL+DIANA IVIHLVGAYQVYCQPLF+F+E     ++P+ + +++E  + IPG
Sbjct  313  FGFYNPFWLIDIANAGIVIHLVGAYQVYCQPLFSFVESNAAERFPNSDFMSREFEVPIPG  372

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               PYKLN FRL+WRT FV+L+TVI+MLLPFFND+VG++GA GFWPLTVY PV MYI+Q 
Sbjct  373  C-KPYKLNLFRLVWRTLFVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQT  431

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKW  +WI LQMLS AC  +++ AAAGS AGV+ DLK+Y+PF TSY
Sbjct  432  KIPKWGIKWIGLQMLSVACFVITILAAAGSIAGVIDDLKVYKPFVTSY  479



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 141/168 (84%), Gaps = 1/168 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIAN AI++HLVGAYQV+CQPLFAFIEKW   KWP+ + +T E  ++I  
Sbjct  318  FGFYNPYWLLDIANVAIIVHLVGAYQVFCQPLFAFIEKWSARKWPNSDFVTAEYEIRIL-  376

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F   Y+LN FR++WRT FV++TT+I+ML+PFFNDVVGILGA GFWPLTVYFP+ MYISQK
Sbjct  377  FSGVYQLNFFRIVWRTIFVIVTTLIAMLMPFFNDVVGILGAMGFWPLTVYFPIEMYISQK  436

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            +I + +++W+ LQ+LS  CL +++AAA GS AGVVLDLK Y+PFKTSY
Sbjct  437  RIGRRTSQWLALQILSVCCLFITIAAAVGSVAGVVLDLKTYKPFKTSY  484



>emb|CDY60629.1| BnaAnng17090D [Brassica napus]
Length=415

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 0/167 (0%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+ + IT E  + +   
Sbjct  249  GFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASKRYPESKFITNETKIHLFPG  308

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
              P+KLN FRL+WRT FV+ TT+ISML+PFFNDV+G+LGA GFWPLTVYFPV MYI QK 
Sbjct  309  SKPFKLNLFRLVWRTIFVITTTLISMLMPFFNDVLGLLGAIGFWPLTVYFPVEMYIVQKN  368

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            + +WSTRW+CLQ+LS ACL VS+AAAAGS  G+V DLK YRPFKT +
Sbjct  369  VRRWSTRWVCLQVLSLACLVVSVAAAAGSVVGIVTDLKSYRPFKTDF  415



>gb|KHN16938.1| Amino acid permease 2 [Glycine soja]
Length=425

 Score =   210 bits (535),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 138/168 (82%), Gaps = 4/168 (2%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WL+DIANAAIVIHLVGAYQV+ QP+FAF+EK V  +WP+     +E  + IPG
Sbjct  262  FGFYNPYWLIDIANAAIVIHLVGAYQVFSQPIFAFVEKEVTQRWPN---FNREFKIPIPG  318

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            F  PYKL  FRL+ RT FV+LTTVISMLLPFFND+VG++GA GFWPLTVYFPV MYISQK
Sbjct  319  FS-PYKLKVFRLVLRTVFVVLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYISQK  377

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            KIPKWS RWI L++ S ACL VS+ AA GS AGV+LDLK Y+PF ++Y
Sbjct  378  KIPKWSNRWISLKIFSMACLIVSVVAAVGSVAGVLLDLKKYKPFHSNY  425



>ref|NP_175076.2| amino acid permease 5 [Arabidopsis thaliana]
 sp|Q8GUM3.1|AAP5_ARATH RecName: Full=Amino acid permease 5; AltName: Full=Amino acid 
transporter AAP5 [Arabidopsis thaliana]
 gb|AAO00749.1| amino acid permease, putative [Arabidopsis thaliana]
 gb|AAP81798.1| At1g44100 [Arabidopsis thaliana]
 gb|AEE32020.1| amino acid permease 5 [Arabidopsis thaliana]
Length=480

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKI-PG  426
            GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+ E +TKEI +++ PG
Sbjct  315  GFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPG  374

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ LN FRL+WRT FV+ TT+ISML+PFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  375  --KPFNLNLFRLVWRTFFVMTTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQK  432

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
             +P+W T+W+CLQ+LS  CL VS+AAAAGS  G+V DLK+Y+PF++ +
Sbjct  433  NVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQSEF  480



>ref|XP_006847199.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
 gb|ERN08780.1| hypothetical protein AMTR_s00017p00252280 [Amborella trichopoda]
Length=497

 Score =   212 bits (539),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = -2

Query  605  FGFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPG  426
            FGFYNP+WLLDIANAAIV+HLVGAYQVYCQPLFAF+EK+   KWP    I  E  L++P 
Sbjct  329  FGFYNPYWLLDIANAAIVVHLVGAYQVYCQPLFAFVEKYAVRKWPKSWFINHEFELRVPF  388

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
            +   + LN FRL+WRT+FV +TT+I+ML PFFN VVGILGAFGFWPLTVYFPV MYIS  
Sbjct  389  YSKSFSLNLFRLVWRTSFVCMTTLIAMLFPFFNGVVGILGAFGFWPLTVYFPVEMYISHM  448

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLK-LYRPFKTSY  102
             IPKWST+W+CL+ LS ACL +S+ AA GS AG++ ++K  YRPF T+Y
Sbjct  449  HIPKWSTKWVCLRALSLACLVISMLAATGSVAGMIFEMKAAYRPFHTNY  497



>gb|AAG50558.1|AC074228_13 amino acid permease, putative [Arabidopsis thaliana]
Length=476

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 140/168 (83%), Gaps = 3/168 (2%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKI-PG  426
            GF NP+WLLDIAN AIVIHLVGAYQVYCQPLFAF+EK    ++P+ E +TKEI +++ PG
Sbjct  311  GFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPG  370

Query  425  FGYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQK  246
               P+ LN FRL+WRT FV+ TT+ISML+PFFNDVVG+LGA GFWPLTVYFPV MYI+QK
Sbjct  371  --KPFNLNLFRLVWRTFFVMTTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQK  428

Query  245  KIPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
             +P+W T+W+CLQ+LS  CL VS+AAAAGS  G+V DLK+Y+PF++ +
Sbjct  429  NVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQSEF  476



>ref|XP_010527719.1| PREDICTED: amino acid permease 5-like isoform X1 [Tarenaya hassleriana]
Length=525

 Score =   213 bits (541),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 137/167 (82%), Gaps = 0/167 (0%)
 Frame = -2

Query  602  GFYNPFWLLDIANAAIVIHLVGAYQVYCQPLFAFIEKWVGAKWPDGEIITKEINLKIPGF  423
            GF+NP+WL+DIAN  IVIHLVGAYQVYCQPLFAF+E     ++PD ++ITKEI +++   
Sbjct  359  GFFNPYWLIDIANLTIVIHLVGAYQVYCQPLFAFVENQASKRFPDSKLITKEIKIRLFPG  418

Query  422  GYPYKLNTFRLLWRTAFVLLTTVISMLLPFFNDVVGILGAFGFWPLTVYFPVRMYISQKK  243
              PY LN FRL+WRT FV+LTT+ISML+PFFNDV+G LGA GFWPLTVYFPV MYI  K+
Sbjct  419  REPYNLNLFRLVWRTLFVILTTLISMLMPFFNDVLGFLGAIGFWPLTVYFPVEMYIEHKR  478

Query  242  IPKWSTRWICLQMlsgaclavslaaaagsfagvVLDLKLYRPFKTSY  102
            I +WSTRW+CLQ+LS ACL V+LA+AAGS  G+V DLK Y+PFKT +
Sbjct  479  IQRWSTRWVCLQVLSFACLVVTLASAAGSVVGIVTDLKTYKPFKTDF  525



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 815770585800