BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032M07

Length=751
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009594504.1|  PREDICTED: uncharacterized protein LOC104090985    210   6e-64   Nicotiana tomentosiformis
ref|XP_009796268.1|  PREDICTED: uncharacterized protein LOC104242...    206   1e-57   Nicotiana sylvestris
ref|XP_009796266.1|  PREDICTED: uncharacterized protein LOC104242...    206   3e-57   Nicotiana sylvestris
ref|XP_010326373.1|  PREDICTED: uncharacterized protein LOC101255...    204   4e-57   Solanum lycopersicum
ref|XP_006349670.1|  PREDICTED: uncharacterized protein LOC102584...    204   5e-57   Solanum tuberosum [potatoes]
ref|XP_004247163.1|  PREDICTED: uncharacterized protein LOC101255...    204   9e-57   Solanum lycopersicum
ref|XP_006349668.1|  PREDICTED: uncharacterized protein LOC102584...    204   9e-57   Solanum tuberosum [potatoes]
ref|XP_011079846.1|  PREDICTED: uncharacterized protein LOC105163...    186   4e-50   Sesamum indicum [beniseed]
ref|XP_007050625.1|  FZO-like                                           186   7e-50   
emb|CDP03626.1|  unnamed protein product                                186   8e-50   Coffea canephora [robusta coffee]
ref|XP_006444079.1|  hypothetical protein CICLE_v10023868mg             181   2e-48   Citrus clementina [clementine]
gb|KDO68745.1|  hypothetical protein CISIN_1g002437mg                   181   2e-48   Citrus sinensis [apfelsine]
gb|KDP21464.1|  hypothetical protein JCGZ_21935                         181   3e-48   Jatropha curcas
ref|XP_008449445.1|  PREDICTED: uncharacterized protein LOC103491330    180   6e-48   Cucumis melo [Oriental melon]
ref|XP_002520749.1|  conserved hypothetical protein                     179   9e-48   Ricinus communis
ref|XP_002275196.1|  PREDICTED: uncharacterized protein LOC100256371    179   1e-47   Vitis vinifera
gb|EYU46587.1|  hypothetical protein MIMGU_mgv1a0012281mg               179   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_010090399.1|  Uncharacterized protein in xynA 3'region           178   4e-47   Morus notabilis
ref|XP_004140223.1|  PREDICTED: uncharacterized protein LOC101213431    178   4e-47   Cucumis sativus [cucumbers]
ref|XP_004167583.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    178   4e-47   
ref|XP_010255948.1|  PREDICTED: uncharacterized protein LOC104596...    176   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010255947.1|  PREDICTED: uncharacterized protein LOC104596...    176   2e-46   Nelumbo nucifera [Indian lotus]
ref|XP_002307580.2|  hypothetical protein POPTR_0005s23080g             176   3e-46   Populus trichocarpa [western balsam poplar]
ref|XP_011032720.1|  PREDICTED: uncharacterized protein LOC105131442    173   2e-45   Populus euphratica
gb|KHG12136.1|  hypothetical protein F383_07635                         167   3e-43   Gossypium arboreum [tree cotton]
gb|KCW58852.1|  hypothetical protein EUGRSUZ_H01482                     165   3e-43   Eucalyptus grandis [rose gum]
gb|KJB23088.1|  hypothetical protein B456_004G080200                    166   5e-43   Gossypium raimondii
ref|XP_010070219.1|  PREDICTED: uncharacterized protein LOC104457...    165   1e-42   Eucalyptus grandis [rose gum]
ref|XP_008235280.1|  PREDICTED: uncharacterized protein LOC103334119    162   1e-41   Prunus mume [ume]
ref|XP_007201215.1|  hypothetical protein PRUPE_ppa001060mg             162   2e-41   Prunus persica
gb|KHN03797.1|  Hypothetical protein glysoja_011026                     160   2e-41   Glycine soja [wild soybean]
ref|XP_009355473.1|  PREDICTED: uncharacterized protein LOC103946491    160   9e-41   Pyrus x bretschneideri [bai li]
ref|XP_004290657.1|  PREDICTED: uncharacterized protein LOC101291108    159   3e-40   Fragaria vesca subsp. vesca
ref|XP_009367692.1|  PREDICTED: uncharacterized protein LOC103957273    158   4e-40   Pyrus x bretschneideri [bai li]
ref|XP_007144634.1|  hypothetical protein PHAVU_007G172000g             158   5e-40   Phaseolus vulgaris [French bean]
gb|KHN18882.1|  Hypothetical protein glysoja_028251                     156   7e-40   Glycine soja [wild soybean]
ref|XP_008386504.1|  PREDICTED: uncharacterized protein LOC103449010    157   7e-40   
ref|XP_003520208.1|  PREDICTED: uncharacterized protein LOC100785...    156   2e-39   Glycine max [soybeans]
ref|XP_006575072.1|  PREDICTED: uncharacterized protein LOC100785...    156   2e-39   Glycine max [soybeans]
ref|XP_003536908.1|  PREDICTED: uncharacterized protein LOC100808213    155   3e-39   Glycine max [soybeans]
ref|XP_009401043.1|  PREDICTED: uncharacterized protein LOC103985...    155   5e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003590651.1|  GTP-binding protein engA                           153   2e-38   Medicago truncatula
ref|XP_010684259.1|  PREDICTED: uncharacterized protein LOC104898847    149   7e-37   
ref|XP_002300848.2|  hypothetical protein POPTR_0002s05420g             146   4e-36   
ref|XP_004495204.1|  PREDICTED: uncharacterized protein LOC101505...    145   1e-35   
ref|XP_004495203.1|  PREDICTED: uncharacterized protein LOC101505...    145   1e-35   Cicer arietinum [garbanzo]
ref|XP_011026335.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    144   5e-35   Populus euphratica
ref|XP_010522715.1|  PREDICTED: uncharacterized protein LOC104801...    142   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_006851107.1|  hypothetical protein AMTR_s00025p00248100          140   8e-34   
ref|XP_010927024.1|  PREDICTED: uncharacterized protein LOC105049...    139   3e-33   Elaeis guineensis
ref|XP_010927025.1|  PREDICTED: uncharacterized protein LOC105049...    138   3e-33   
ref|XP_010927023.1|  PREDICTED: uncharacterized protein LOC105049...    138   3e-33   Elaeis guineensis
ref|XP_008783175.1|  PREDICTED: uncharacterized protein LOC103702...    134   6e-32   
ref|XP_008783174.1|  PREDICTED: uncharacterized protein LOC103702...    134   1e-31   Phoenix dactylifera
ref|NP_171815.3|  FZO-like protein                                      133   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474935.1|  PREDICTED: uncharacterized protein LOC104754437    132   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010481655.1|  PREDICTED: uncharacterized protein LOC104760424    131   9e-31   Camelina sativa [gold-of-pleasure]
gb|EPS74309.1|  hypothetical protein M569_00446                         130   1e-30   Genlisea aurea
emb|CDY15452.1|  BnaA08g27360D                                          130   1e-30   Brassica napus [oilseed rape]
ref|XP_009111165.1|  PREDICTED: uncharacterized protein LOC103836629    130   2e-30   Brassica rapa
ref|XP_010474922.1|  PREDICTED: uncharacterized protein LOC104754...    130   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDX86689.1|  BnaC08g00140D                                          129   4e-30   
dbj|BAK07723.1|  predicted protein                                      129   6e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006306709.1|  hypothetical protein CARUB_v10008235mg             128   1e-29   Capsella rubella
ref|XP_002889440.1|  hypothetical protein ARALYDRAFT_470295             128   1e-29   Arabidopsis lyrata subsp. lyrata
gb|EMS57874.1|  Uncharacterized protein in xynA 3'region                127   2e-29   Triticum urartu
ref|XP_006418260.1|  hypothetical protein EUTSA_v10006729mg             126   5e-29   Eutrema salsugineum [saltwater cress]
gb|EMT28456.1|  putative Uncharacterized protein in xynA 3'region       125   5e-29   
ref|XP_004963794.1|  PREDICTED: uncharacterized protein LOC101755934    125   2e-28   
ref|XP_006655278.1|  PREDICTED: uncharacterized protein LOC102702759    120   4e-27   
ref|NP_001055439.1|  Os05g0390100                                       120   5e-27   
ref|XP_010233244.1|  PREDICTED: uncharacterized protein LOC100838168    120   6e-27   
ref|XP_002439739.1|  hypothetical protein SORBIDRAFT_09g019290          120   6e-27   Sorghum bicolor [broomcorn]
gb|EAY97909.1|  hypothetical protein OsI_19825                          120   8e-27   Oryza sativa Indica Group [Indian rice]
gb|KJB23087.1|  hypothetical protein B456_004G080200                    117   6e-26   Gossypium raimondii
ref|XP_008649599.1|  PREDICTED: uncharacterized protein LOC103630315    114   7e-25   Zea mays [maize]
ref|XP_010255949.1|  PREDICTED: uncharacterized protein LOC104596...    112   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_008368936.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    109   2e-23   
gb|KCW58853.1|  hypothetical protein EUGRSUZ_H01482                     103   2e-21   Eucalyptus grandis [rose gum]
ref|XP_010070220.1|  PREDICTED: uncharacterized protein LOC104457...    103   3e-21   Eucalyptus grandis [rose gum]
gb|ABR16920.1|  unknown                                               99.4    7e-21   Picea sitchensis
gb|EEE63597.1|  hypothetical protein OsJ_18414                        98.6    2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|AAC72117.1|  This gene may be cut off                              82.8    6e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AFW77881.1|  hypothetical protein ZEAMMB73_815508                  79.0    8e-15   
ref|XP_009796267.1|  PREDICTED: uncharacterized protein LOC104242...  82.8    2e-14   Nicotiana sylvestris
ref|XP_001774726.1|  predicted protein                                75.1    7e-12   
ref|XP_006349669.1|  PREDICTED: uncharacterized protein LOC102584...  74.3    1e-11   
ref|XP_009401044.1|  PREDICTED: uncharacterized protein LOC103985...  72.0    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001780842.1|  predicted protein                                70.9    1e-10   
gb|AAD25810.1|AC006550_18  F10O3.1                                    53.1    1e-04   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_009594504.1| PREDICTED: uncharacterized protein LOC104090985 [Nicotiana tomentosiformis]
Length=211

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+K+W S V+   Q++ D   +L RK E+S RV+ DFS  
Sbjct  7    EYTKWLQSKRDQEGQFYKQSFEKKWTSFVNPSDQVELDAIGMLERKSEVSRRVIEDFSAA  66

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFE+EIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  67   AASKLFEREIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAVSNFS  126

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQQVV KVKRT DGLARE+EEAMQKDLLET   +ED VK IGKPYQ+ AQ+RLDKLLA
Sbjct  127  TRRQQVVDKVKRTADGLARELEEAMQKDLLETTRNVEDFVKLIGKPYQDRAQHRLDKLLA  186

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT+IE KLK L+ +IQNLHVS
Sbjct  187  TAEELTNIEKKLKALRIDIQNLHVS  211



>ref|XP_009796268.1| PREDICTED: uncharacterized protein LOC104242852 isoform X3 [Nicotiana 
sylvestris]
Length=751

 Score =   206 bits (524),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+K+W S V+   Q++ D   +L RK E+S RV+ DFS  
Sbjct  547  EYTKWLQSKRDQEGQFYKQSFEKKWTSFVNPSDQVELDAIGVLERKSEVSRRVIEDFSAA  606

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFE+EIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  607  AASKLFEREIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAVSNFS  666

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+E+AMQKDLLET   +ED VK IGKPYQ+ AQ+RLDK+LA
Sbjct  667  SRRQQVVDKVKRTADGLARELEDAMQKDLLETTRTVEDFVKVIGKPYQDRAQHRLDKVLA  726

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK L+ +IQNLHVS
Sbjct  727  TAEELTKIEKKLKALRIDIQNLHVS  751



>ref|XP_009796266.1| PREDICTED: uncharacterized protein LOC104242852 isoform X1 [Nicotiana 
sylvestris]
Length=921

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+K+W S V+   Q++ D   +L RK E+S RV+ DFS  
Sbjct  717  EYTKWLQSKRDQEGQFYKQSFEKKWTSFVNPSDQVELDAIGVLERKSEVSRRVIEDFSAA  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFE+EIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  777  AASKLFEREIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAVSNFS  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+E+AMQKDLLET   +ED VK IGKPYQ+ AQ+RLDK+LA
Sbjct  837  SRRQQVVDKVKRTADGLARELEDAMQKDLLETTRTVEDFVKVIGKPYQDRAQHRLDKVLA  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK L+ +IQNLHVS
Sbjct  897  TAEELTKIEKKLKALRIDIQNLHVS  921



>ref|XP_010326373.1| PREDICTED: uncharacterized protein LOC101255731 isoform X2 [Solanum 
lycopersicum]
Length=748

 Score =   204 bits (520),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+KRW SLV+   QI+  T+ +L RK E++  V+ DFS  
Sbjct  544  EYTKWLQSKRDQEVQFYKQSFEKRWTSLVNPSDQIELGTTGVLDRKSEVTISVIEDFSAA  603

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKL E++IRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  604  AASKLLERDIREVFLGTFGGLGAAGLSASLLTSVLQTTLEDLLALGLCSAGGLLAVSNFS  663

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+EEAMQK+LLET + +ED VK IGKPYQ  AQNRLD+LLA
Sbjct  664  SRRQQVVDKVKRTADGLARELEEAMQKELLETTSNVEDFVKLIGKPYQVRAQNRLDELLA  723

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK+L+ +IQNLHVS
Sbjct  724  TAEELTIIEKKLKSLRIDIQNLHVS  748



>ref|XP_006349670.1| PREDICTED: uncharacterized protein LOC102584745 isoform X3 [Solanum 
tuberosum]
Length=748

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+  F+KRW SLV+   QI+  T+ +L RK E++  V+ DFS  
Sbjct  544  EYTKWLQSKRDQEVQFYKQCFEKRWTSLVNPSDQIELGTTGVLDRKSEVTISVIEDFSAA  603

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKL E++IRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  604  AASKLLERDIREVFLGTFGGLGAAGLSASLLTSVLQTTLEDLLALGLCSAGGLLAVSNFS  663

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+EEAMQKDLLET   +ED VK IGKPYQ  AQNRLD+LLA
Sbjct  664  SRRQQVVSKVKRTADGLARELEEAMQKDLLETTRNVEDFVKLIGKPYQVRAQNRLDELLA  723

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK+L+ +IQNLHVS
Sbjct  724  TAEELTIIEKKLKSLRVDIQNLHVS  748



>ref|XP_004247163.1| PREDICTED: uncharacterized protein LOC101255731 isoform X1 [Solanum 
lycopersicum]
Length=919

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+KRW SLV+   QI+  T+ +L RK E++  V+ DFS  
Sbjct  715  EYTKWLQSKRDQEVQFYKQSFEKRWTSLVNPSDQIELGTTGVLDRKSEVTISVIEDFSAA  774

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKL E++IRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  775  AASKLLERDIREVFLGTFGGLGAAGLSASLLTSVLQTTLEDLLALGLCSAGGLLAVSNFS  834

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+EEAMQK+LLET + +ED VK IGKPYQ  AQNRLD+LLA
Sbjct  835  SRRQQVVDKVKRTADGLARELEEAMQKELLETTSNVEDFVKLIGKPYQVRAQNRLDELLA  894

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK+L+ +IQNLHVS
Sbjct  895  TAEELTIIEKKLKSLRIDIQNLHVS  919



>ref|XP_006349668.1| PREDICTED: uncharacterized protein LOC102584745 isoform X1 [Solanum 
tuberosum]
Length=919

 Score =   204 bits (520),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+  F+KRW SLV+   QI+  T+ +L RK E++  V+ DFS  
Sbjct  715  EYTKWLQSKRDQEVQFYKQCFEKRWTSLVNPSDQIELGTTGVLDRKSEVTISVIEDFSAA  774

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKL E++IRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNF 
Sbjct  775  AASKLLERDIREVFLGTFGGLGAAGLSASLLTSVLQTTLEDLLALGLCSAGGLLAVSNFS  834

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQVV KVKRT DGLARE+EEAMQKDLLET   +ED VK IGKPYQ  AQNRLD+LLA
Sbjct  835  SRRQQVVSKVKRTADGLARELEEAMQKDLLETTRNVEDFVKLIGKPYQVRAQNRLDELLA  894

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            TA+ LT IE KLK+L+ +IQNLHVS
Sbjct  895  TAEELTIIEKKLKSLRVDIQNLHVS  919



>ref|XP_011079846.1| PREDICTED: uncharacterized protein LOC105163260 isoform X1 [Sesamum 
indicum]
Length=921

 Score =   186 bits (473),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 161/205 (79%), Gaps = 1/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL+SN   +   Y+DSF+KRWPS+V +  Q Q++ S++L  K++L   V+ DFS  
Sbjct  717  EYAVWLESNNARKGDMYKDSFEKRWPSVVPS-IQSQSEASQVLRTKHQLGITVIEDFSAA  775

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIRE  LGTFGGLG AGLSASLLTSIL TTLEDLLALGLCSAGGLLA+SNF 
Sbjct  776  AASKLFDQEIREVLLGTFGGLGAAGLSASLLTSILPTTLEDLLALGLCSAGGLLAISNFS  835

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQQVV KV+RT D LAR++EEAMQKDLL+    L + V  IGKPYQE AQ+R++KLL 
Sbjct  836  ARRQQVVSKVRRTADALARQVEEAMQKDLLDATDSLNNFVILIGKPYQETAQDRVNKLLG  895

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T D LT IE +L+TLQ EIQNLHVS
Sbjct  896  TLDELTAIEEQLETLQIEIQNLHVS  920



>ref|XP_007050625.1| FZO-like [Theobroma cacao]
 gb|EOX94782.1| FZO-like [Theobroma cacao]
Length=926

 Score =   186 bits (471),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN   E   Y++SF+KRWPSL  ++KQ   +T +LL +  +LS RV+ +FS  
Sbjct  722  EYLTWLQSNNAREGRLYKESFEKRWPSLAYSDKQHHLETYELLRKLDQLSLRVIENFSAN  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQE+RE FLGTFGGLG AGLSASLLTSIL TTLEDLLALGLCSAGG +A+SNFP
Sbjct  782  AASKLFEQEVREVFLGTFGGLGAAGLSASLLTSILPTTLEDLLALGLCSAGGFIAISNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ++++KVK+T + LARE+E+AMQKDLLET   L   V+ IG+PY++AA+ RLDKLL 
Sbjct  842  ARRQEMIEKVKKTANVLARELEDAMQKDLLETTENLGKFVRIIGEPYRDAAEERLDKLLE  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+++   L+TLQ EIQNLHVS
Sbjct  902  IKDELSNVRETLQTLQVEIQNLHVS  926



>emb|CDP03626.1| unnamed protein product [Coffea canephora]
Length=931

 Score =   186 bits (471),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS+   E   Y+++  +RW SLVD   Q+Q   + LLG + ELS +V+ DFS  
Sbjct  728  EYVIWLQSSNAREGRVYKEALAQRWSSLVDPH-QVQLHKTDLLGERGELSVKVLEDFSAS  786

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+SNFP
Sbjct  787  AASKLFEQEIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAISNFP  846

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            AR++ VV KVKR GD LARE+E AMQKDLLET+  LE  V+F+G+PYQ+  Q+RLD+L  
Sbjct  847  ARKRLVVDKVKRAGDALARELEGAMQKDLLETINNLEKYVRFVGEPYQDVMQHRLDELAG  906

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T+D L  IE KL+TL+ EI+NLHV 
Sbjct  907  TSDELIQIEKKLQTLRIEIENLHVG  931



>ref|XP_006444079.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
 ref|XP_006479727.1| PREDICTED: uncharacterized protein LOC102616592 [Citrus sinensis]
 gb|ESR57319.1| hypothetical protein CICLE_v10023868mg [Citrus clementina]
Length=921

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS    E   Y++SF+ RWPSLV  + Q+  D  +L+ +    SSRV+ DFS  
Sbjct  717  EYTMWLQSKNAREGRRYKESFENRWPSLVYLQPQVYPDMYELVRKVDGYSSRVIEDFSAS  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            + SK+FEQEIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +AV+NFP
Sbjct  777  STSKMFEQEIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYIAVANFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V++KV +  DGLAREIEEAMQKDL ET+ +LE+ V  +GKPYQ+AAQ +LD+L  
Sbjct  837  ARRQRVIEKVNKIADGLAREIEEAMQKDLQETVGHLENFVTKVGKPYQDAAQLKLDRLSE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L++++ K++TLQ EIQNLHVS
Sbjct  897  IQDELSNVQEKIQTLQVEIQNLHVS  921



>gb|KDO68745.1| hypothetical protein CISIN_1g002437mg [Citrus sinensis]
Length=921

 Score =   181 bits (460),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS    E   Y++SF+ RWPSLV  + Q+  D  +L+ +    SSRV+ DFS  
Sbjct  717  EYTMWLQSKNAREGRRYKESFENRWPSLVYLQPQVYPDMYELVRKVDGYSSRVIEDFSAS  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            + SK+FEQEIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +AV+NFP
Sbjct  777  STSKMFEQEIREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYIAVANFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V++KV +  DGLAREIEEAMQKDL ET+ +LE+ V  +GKPYQ+AAQ +LD+L  
Sbjct  837  ARRQRVIEKVNKIADGLAREIEEAMQKDLQETVGHLENFVTKVGKPYQDAAQLKLDRLSE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L++++ K++TLQ EIQNLHVS
Sbjct  897  IQDELSNVQEKIQTLQVEIQNLHVS  921



>gb|KDP21464.1| hypothetical protein JCGZ_21935 [Jatropha curcas]
Length=920

 Score =   181 bits (459),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL+SN+  E   Y++SF+KRW  L +   Q+    ++LLG+  ++S +V+ +FS  
Sbjct  716  EYALWLKSNSAHEGKLYKESFEKRWSLLTNPNTQMHFQINELLGKVDDVSLKVIQNFSTG  775

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE +LGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +AVSNFP
Sbjct  776  AASKLFEQEIREVYLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGFIAVSNFP  835

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +R++ ++ KV +  DGLAREIE+AMQKDLLET A LE+ V  IGKPYQ+AAQ RL+ LLA
Sbjct  836  SRKRGMIDKVSKIADGLAREIEKAMQKDLLETAANLENFVITIGKPYQDAAQQRLNNLLA  895

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+DI  KL TLQ EIQNLHVS
Sbjct  896  VQNELSDIAEKLITLQVEIQNLHVS  920



>ref|XP_008449445.1| PREDICTED: uncharacterized protein LOC103491330 [Cucumis melo]
Length=924

 Score =   180 bits (457),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y +WLQS   +E   Y++S QK WPS+V    Q+  +T +LL +  +LS +V+ +FSP 
Sbjct  720  DYESWLQSGNANEGTVYQESLQKLWPSIVFPATQMHLETYELLKKVDDLSLKVIKNFSPS  779

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIREAFLGTFGGLG AGLSASLLT++L TT+EDLLALGLCSAGG LA+SNFP
Sbjct  780  AASKLFDQEIREAFLGTFGGLGAAGLSASLLTTVLPTTIEDLLALGLCSAGGFLAISNFP  839

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQ+V KVKRT DG ARE+E AMQ+DL E +  LE  V  I KPY++ AQNRLDKLL 
Sbjct  840  SRRQQLVSKVKRTADGFARELEAAMQEDLNEAVRNLETFVSVISKPYRDDAQNRLDKLLE  899

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L ++  KL+ LQ++IQNLHVS
Sbjct  900  IQDELCNVGKKLQKLQSDIQNLHVS  924



>ref|XP_002520749.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41711.1| conserved hypothetical protein [Ricinus communis]
Length=921

 Score =   179 bits (455),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 163/205 (80%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL+SN+  E   Y+++F+KRWPS+++ + ++ ++T +LL +  +L  + + +FS  
Sbjct  717  EYALWLKSNSAHESKLYKEAFEKRWPSIINPDSRMHSETYELLEKADDLGLKAIQNFSTA  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE +LGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A+S+FP
Sbjct  777  AASKLFEQEIREVYLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGFIAISSFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             R+Q++V KV+R  DGL RE+EEAMQKDLLET+  L++ +K I KPYQ+AAQ RLD LL 
Sbjct  837  YRKQEMVDKVRRIADGLMREVEEAMQKDLLETLVNLDNFLKIISKPYQDAAQQRLDDLLN  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E K++TLQ EIQNLH+S
Sbjct  897  IQNELSEMEEKIRTLQVEIQNLHLS  921



>ref|XP_002275196.1| PREDICTED: uncharacterized protein LOC100256371 [Vitis vinifera]
 emb|CBI32337.3| unnamed protein product [Vitis vinifera]
Length=926

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 156/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN   E   Y++SF+++WP  V    Q+  +T +LL +  ELS + + +FS  
Sbjct  722  EYVTWLQSNNAHEGRLYKESFERKWPLFVYPHNQVGLETYELLRKGDELSLKALENFSAG  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AAS+LF+QEIRE FLG FGGLG AG SASLLTS+L TTLEDLLALGLCSAGG LA+SNFP
Sbjct  782  AASRLFDQEIREVFLGVFGGLGAAGFSASLLTSVLPTTLEDLLALGLCSAGGWLAISNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARR+ +++KV R  D  ARE+E AMQKDLLET+  LE+ VK I KPYQ+ AQNRLDKLL 
Sbjct  842  ARRKGMIEKVTRAADAFARELEVAMQKDLLETVENLENFVKLIAKPYQDEAQNRLDKLLE  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+++E KL+TLQ +IQNLHVS
Sbjct  902  IQDELSNVEKKLQTLQIQIQNLHVS  926



>gb|EYU46587.1| hypothetical protein MIMGU_mgv1a0012281mg, partial [Erythranthe 
guttata]
Length=860

 Score =   179 bits (453),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 155/205 (76%), Gaps = 1/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQSN       Y++SF+KRWPS+V + K  Q + S++L  K+E    V+ +FS  
Sbjct  656  EYATWLQSNNARRGNMYKESFEKRWPSVVPSIKS-QMEASEILRTKHERGVTVIGEFSAA  714

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE  L TFGGLG +GLSASLLTS+L TT EDLLALGLCSAGGL A+SNFP
Sbjct  715  AASKLFEQEIREVLLVTFGGLGASGLSASLLTSVLPTTSEDLLALGLCSAGGLFAISNFP  774

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            + RQ+VV KV+RT D LAR++EEAMQKDL ET   L D V  IGKPYQ+ AQ+R++KL +
Sbjct  775  SGRQRVVDKVRRTADALARQLEEAMQKDLSETTDSLNDFVTLIGKPYQQVAQDRVNKLSS  834

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T D LT IE KL+TLQ EIQNLHVS
Sbjct  835  TIDELTAIEDKLQTLQIEIQNLHVS  859



>ref|XP_010090399.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
 gb|EXB39369.1| Uncharacterized protein in xynA 3'region [Morus notabilis]
Length=926

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 158/205 (77%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN   E + Y++SF+K WPS V    Q+  +T + L +  ELS  VM +FS  
Sbjct  722  EYIEWLQSNNVREGMVYKESFEKCWPSFVYPNSQLHFETFESLKKVNELSLGVMRNFSGP  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QE+RE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVSNFP
Sbjct  782  AASKLFDQEVREVFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAVSNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ ++ KVK+T D LA E+EEAMQKDL E +  +E+ VK + KPYQ+AAQN+L+KLLA
Sbjct  842  ARRQAMIVKVKKTADALALELEEAMQKDLSEALDNIENFVKVVAKPYQDAAQNKLEKLLA  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                + D+E +L+ LQ EIQNLHVS
Sbjct  902  IQAEIADVEKELQRLQVEIQNLHVS  926



>ref|XP_004140223.1| PREDICTED: uncharacterized protein LOC101213431 [Cucumis sativus]
 gb|KGN47899.1| hypothetical protein Csa_6G410050 [Cucumis sativus]
Length=924

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y +WLQS   +E   Y++S QK WPS+V    Q+  +T +LL +  +LS +V+ +FSP 
Sbjct  720  DYESWLQSGNANEGTVYQESLQKLWPSIVFPATQMHFETYELLKKVDDLSLKVIKNFSPS  779

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIREAFLGTFGGLG AGLSASLLT++L TT+EDLLALGLCSAGG LA+SNFP
Sbjct  780  AASKLFDQEIREAFLGTFGGLGAAGLSASLLTTVLPTTIEDLLALGLCSAGGFLAISNFP  839

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQ+V KVKRT DG ARE+E AMQ+DL E +  LE  V  I KPY++  Q+RLDKLL 
Sbjct  840  SRRQQLVSKVKRTADGFARELEAAMQEDLNEAVRNLETFVSVISKPYRDDTQDRLDKLLE  899

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
              D L ++  KL+ LQNEIQNLHV
Sbjct  900  IQDELCNVGKKLQKLQNEIQNLHV  923



>ref|XP_004167583.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213431 
[Cucumis sativus]
Length=924

 Score =   178 bits (451),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y +WLQS   +E   Y++S QK WPS+V    Q+  +T +LL +  +LS +V+ +FSP 
Sbjct  720  DYESWLQSGNANEGTVYQESLQKLWPSIVFPATQMHFETYELLKKVDDLSLKVIKNFSPS  779

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIREAFLGTFGGLG AGLSASLLT++L TT+EDLLALGLCSAGG LA+SNFP
Sbjct  780  AASKLFDQEIREAFLGTFGGLGAAGLSASLLTTVLPTTIEDLLALGLCSAGGFLAISNFP  839

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQQ+V KVKRT DG ARE+E AMQ+DL E +  LE  V  I KPY++  Q+RLDKLL 
Sbjct  840  SRRQQLVSKVKRTADGFARELEAAMQEDLNEAVRNLETFVSVISKPYRDDTQDRLDKLLE  899

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
              D L ++  KL+ LQNEIQNLHV
Sbjct  900  IQDELCNVGKKLQKLQNEIQNLHV  923



>ref|XP_010255948.1| PREDICTED: uncharacterized protein LOC104596469 isoform X2 [Nelumbo 
nucifera]
Length=991

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS+   E   Y++SF+KRWP  V    ++Q +  +LL +  ELS +V+ DF+  
Sbjct  787  EYLIWLQSSNVREGRLYKESFEKRWPEFVYPHNEVQLEAYELLKKGEELSLKVIEDFNAS  846

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+KLFEQEIRE  LGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+SNFP
Sbjct  847  AAAKLFEQEIREVVLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAISNFP  906

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+++  KVKR  D LARE++EAMQ+DLL+T+  LE+ VK I KPYQ+AAQ+RLDK+L 
Sbjct  907  TRRREMEDKVKRAADILAREVKEAMQRDLLKTIEDLENFVKLISKPYQDAAQSRLDKILE  966

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L ++E +L+TLQ EIQNLHVS
Sbjct  967  IQEELLNVEKRLQTLQIEIQNLHVS  991



>ref|XP_010255947.1| PREDICTED: uncharacterized protein LOC104596469 isoform X1 [Nelumbo 
nucifera]
Length=992

 Score =   176 bits (446),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS+   E   Y++SF+KRWP  V    ++Q +  +LL +  ELS +V+ DF+  
Sbjct  788  EYLIWLQSSNVREGRLYKESFEKRWPEFVYPHNEVQLEAYELLKKGEELSLKVIEDFNAS  847

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+KLFEQEIRE  LGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+SNFP
Sbjct  848  AAAKLFEQEIREVVLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAISNFP  907

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+++  KVKR  D LARE++EAMQ+DLL+T+  LE+ VK I KPYQ+AAQ+RLDK+L 
Sbjct  908  TRRREMEDKVKRAADILAREVKEAMQRDLLKTIEDLENFVKLISKPYQDAAQSRLDKILE  967

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L ++E +L+TLQ EIQNLHVS
Sbjct  968  IQEELLNVEKRLQTLQIEIQNLHVS  992



>ref|XP_002307580.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
 gb|EEE94576.2| hypothetical protein POPTR_0005s23080g [Populus trichocarpa]
Length=926

 Score =   176 bits (445),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 157/205 (77%), Gaps = 1/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN+ +    Y++ F+KRW S+     QI  +T  L  +K +LS RV+ + S  
Sbjct  723  EYLKWLQSNSANGGKLYKEQFEKRWTSITYPTSQIHLETHDL-AKKVDLSIRVIENLSAG  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SKLFE++IREAFLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A+S FP
Sbjct  782  ATSKLFEKQIREAFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGFIAISTFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ +V KV +  DGLARE+EEAMQ DL+ET+  LE+ VK IGKPYQ+AAQ RLDKLL 
Sbjct  842  VRRQAIVDKVNKIADGLAREVEEAMQNDLMETVGNLENFVKTIGKPYQDAAQERLDKLLD  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L++++ KL+TL+ EIQN+H+S
Sbjct  902  LQEELSNVDKKLRTLRIEIQNVHLS  926



>ref|XP_011032720.1| PREDICTED: uncharacterized protein LOC105131442 [Populus euphratica]
Length=926

 Score =   173 bits (438),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 158/205 (77%), Gaps = 1/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN+ +    Y++ F+KRW S+     QI  +T  L+ ++ +LS RV+ + S  
Sbjct  723  EYLKWLQSNSANGGKLYKEQFEKRWTSITYPTSQIHLETHDLV-KEVDLSIRVIENLSAG  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SKLFE++IREAFLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A+S FP
Sbjct  782  ATSKLFEKQIREAFLGTFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGFIAISTFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ +V KV +  DGLARE+EEAMQ DL+ET+  LE+ VK IGKPYQ+AAQ RLDKLL 
Sbjct  842  VRRQAIVDKVNKIADGLAREVEEAMQNDLMETVGNLENFVKTIGKPYQDAAQERLDKLLD  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + +++++ KL+TL+ EIQN+H+S
Sbjct  902  LQEEISNVDKKLRTLRIEIQNVHLS  926



>gb|KHG12136.1| hypothetical protein F383_07635 [Gossypium arboreum]
Length=927

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y+ WLQSN   E   Y++SF+K+WPS+  ++K    +T ++L +  ELS R + + S  
Sbjct  723  DYVTWLQSNNAREGRAYKESFEKKWPSITFSDKNYPLETYEMLRKLDELSLRAIENLSAN  782

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FE+E+RE FL TFGGLG AGLSASLLTSIL TTLEDLLALGLCSAGG +A+SNFP
Sbjct  783  ATSKQFEREVREVFLETFGGLGAAGLSASLLTSILPTTLEDLLALGLCSAGGFIAISNFP  842

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ +++KVK+T D L +E+E+AMQKDL ET   LE  V+ IG+PY++AAQNRLDKLL 
Sbjct  843  ARRQGIIEKVKKTADALGQELEDAMQKDLQETTQNLEKFVRIIGEPYRDAAQNRLDKLLE  902

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+++   LK LQ EIQNLHVS
Sbjct  903  VNDELSNVRGTLKMLQVEIQNLHVS  927



>gb|KCW58852.1| hypothetical protein EUGRSUZ_H01482 [Eucalyptus grandis]
Length=751

 Score =   165 bits (418),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y++WL S+ DS+   YR+SF+KRWPSLV +  Q+  +   LL +  E   +V+ +FS  
Sbjct  547  DYVSWLHSSNDSQGRLYRESFEKRWPSLVHSNAQMTLERFDLLRKLDEQCLKVIENFSAS  606

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            +ASK F+QEIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+SNFP
Sbjct  607  SASKTFDQEIREVFLGTFGGLGAAGLSASLLTSVLDTTLEDLLALGLCSAGGLLAISNFP  666

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ VV KV +T D LAR++EEAMQKDLL+T+  +E+ +  I KPYQEAAQ+RLDK+L 
Sbjct  667  ARRQVVVNKVNKTVDALARDLEEAMQKDLLDTVTNMENFINIISKPYQEAAQSRLDKILK  726

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+ ++ +L+ LQ EIQNLH S
Sbjct  727  LQDELSAVQDRLRMLQIEIQNLHTS  751



>gb|KJB23088.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=927

 Score =   166 bits (421),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y+ WLQSN   E   Y++SF+K+WPS+  ++K    +T +LL +  ELS + + + S  
Sbjct  723  DYVTWLQSNNAREGRAYKESFEKKWPSITFSDKNYPLETYELLRKLDELSLKAIENLSAN  782

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FE+E+RE FL TFGGLG AGLSASLLTSIL TTLEDLLALGLCSAGG +A+SNFP
Sbjct  783  ATSKQFEREVREVFLETFGGLGAAGLSASLLTSILPTTLEDLLALGLCSAGGFIAISNFP  842

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ +++KVK+T D L +E+E+AMQKDL ET   LE  V+ IG+PY++AAQNRLDKLL 
Sbjct  843  ARRQGIIEKVKKTADALGQELEDAMQKDLQETTQNLEKFVRIIGEPYRDAAQNRLDKLLE  902

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+++   LK LQ EIQNLHVS
Sbjct  903  VKDELSNVRGTLKMLQVEIQNLHVS  927



>ref|XP_010070219.1| PREDICTED: uncharacterized protein LOC104457004 isoform X1 [Eucalyptus 
grandis]
Length=938

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 159/205 (78%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y++WL S+ DS+   YR+SF+KRWPSLV +  Q+  +   LL +  E   +V+ +FS  
Sbjct  734  DYVSWLHSSNDSQGRLYRESFEKRWPSLVHSNAQMTLERFDLLRKLDEQCLKVIENFSAS  793

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            +ASK F+QEIRE FLGTFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+SNFP
Sbjct  794  SASKTFDQEIREVFLGTFGGLGAAGLSASLLTSVLDTTLEDLLALGLCSAGGLLAISNFP  853

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ VV KV +T D LAR++EEAMQKDLL+T+  +E+ +  I KPYQEAAQ+RLDK+L 
Sbjct  854  ARRQVVVNKVNKTVDALARDLEEAMQKDLLDTVTNMENFINIISKPYQEAAQSRLDKILK  913

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D L+ ++ +L+ LQ EIQNLH S
Sbjct  914  LQDELSAVQDRLRMLQIEIQNLHTS  938



>ref|XP_008235280.1| PREDICTED: uncharacterized protein LOC103334119 [Prunus mume]
Length=921

 Score =   162 bits (411),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS+   E   Y ++F+KRW S V   +Q+  +TS  L +  ELS +V+  FS  
Sbjct  719  EYVIWLQSDNAREGRMYAETFEKRWSSFVYPHRQVHLETS--LEKVNELSLKVIEGFSTN  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE  L TFGGLG AGLSASLLTSIL TTLEDLLALGLCSAGGLLAVS FP
Sbjct  777  AASKLFEQEIREVSLATFGGLGAAGLSASLLTSILPTTLEDLLALGLCSAGGLLAVSKFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+++ KVKRT D LARE+EEAMQKDL ET+  +E  VK I +PYQ+ A+ RL+KLL 
Sbjct  837  ARRQEMIDKVKRTADVLAREVEEAMQKDLSETIENMESFVKNISQPYQDTARQRLEKLLE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D +++++ +L+TL+ EIQNLHVS
Sbjct  897  LQDEISNVDKQLQTLRIEIQNLHVS  921



>ref|XP_007201215.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
 gb|EMJ02414.1| hypothetical protein PRUPE_ppa001060mg [Prunus persica]
Length=921

 Score =   162 bits (410),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 154/205 (75%), Gaps = 2/205 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS+   E   Y ++F+KRW S V   +Q+  +TS  L +  ELS +V+  FS  
Sbjct  719  EYAIWLQSDNAREGRMYAETFEKRWSSFVYPHRQVHLETS--LEKVNELSLKVIEGFSTN  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE  L TFGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLAVS FP
Sbjct  777  AASKLFEQEIREVSLATFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAVSKFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+++ KVKRT D LARE+EEAMQKDL E +  +E  VK I +PYQ+ AQ RL+KLL 
Sbjct  837  ARRQEMIDKVKRTADVLAREVEEAMQKDLSEAIGNMESFVKNISQPYQDTAQQRLEKLLE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D +++++ +L+TL+ EIQNLHVS
Sbjct  897  LQDEISNVDKQLQTLRIEIQNLHVS  921



>gb|KHN03797.1| Hypothetical protein glysoja_011026 [Glycine soja]
Length=741

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   Y++SF+KRWPSL     QI   T +LL +  +  S+V+ +FS +
Sbjct  537  EYENWLYSKYTQQGRLYKESFEKRWPSLSHESSQINFGTDQLLKKVDQAGSQVIDNFSSI  596

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAGLSASLLTS+L TTLEDLLALG+CSAGG LA+S FP
Sbjct  597  AVSKSFEQEVREMILGTFGQLGVAGLSASLLTSVLQTTLEDLLALGICSAGGYLAISTFP  656

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V+ KVKR  D LA E+EEAM+KDL E +  L+  VK + KPYQ+ AQNRL++L+ 
Sbjct  657  ARRQKVIDKVKRKADTLAYELEEAMKKDLTEAIENLDTFVKVLSKPYQDEAQNRLNRLVE  716

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ +IQNLHVS
Sbjct  717  IQEELSNVEKKLRTLQIDIQNLHVS  741



>ref|XP_009355473.1| PREDICTED: uncharacterized protein LOC103946491 [Pyrus x bretschneideri]
Length=921

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS++  E   Y + F+KRWPS V     + ++ S  L +  ELS +V+  FS  
Sbjct  719  EYVTWLQSDSACEGRMYAEMFEKRWPSFVYPYSGVHSENS--LKKVNELSLKVIEGFSTS  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIRE  L TFGGLG AGLSASLLTS+L TTLEDLLALGL SAGGLL +S FP
Sbjct  777  AASKLFDQEIREVSLATFGGLGAAGLSASLLTSVLPTTLEDLLALGLASAGGLLVISKFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQ++++KVKRT D LARE+EEAMQ DL E +  +E  VK + +PYQ+ AQ RLDKLL 
Sbjct  837  SRRQEMIEKVKRTADALAREVEEAMQNDLSEAIGNMEIFVKNVSQPYQDTAQQRLDKLLE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D +++++ +L+TL+ EIQNLHVS
Sbjct  897  LQDEISNVDKQLQTLRIEIQNLHVS  921



>ref|XP_004290657.1| PREDICTED: uncharacterized protein LOC101291108 [Fragaria vesca 
subsp. vesca]
Length=914

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 155/205 (76%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS+   E   Y D+F+K  PS V  + ++  +  + L +  + S +VM DFS  
Sbjct  710  EYVIWLQSDNVREGRMYSDTFEKCLPSFVYPQSRVNLERFESLEKVNKHSLKVMEDFSAN  769

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+KLFEQEIREAFLGTFGGLG AGLSASLLT++L TTLEDLLALGLCSAGG +A+S FP
Sbjct  770  AAAKLFEQEIREAFLGTFGGLGAAGLSASLLTTVLPTTLEDLLALGLCSAGGFIAISKFP  829

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ++++KVKRT DGLARE+E++MQ DL E +  LE  VK + +PYQ+ AQ RLDKLL 
Sbjct  830  VRRQEMIEKVKRTADGLAREVEQSMQNDLSEAIENLERFVKKVSQPYQDTAQQRLDKLLE  889

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + +++++ +L+TL+ EIQNLHVS
Sbjct  890  LQNEISNVDKQLQTLRIEIQNLHVS  914



>ref|XP_009367692.1| PREDICTED: uncharacterized protein LOC103957273 [Pyrus x bretschneideri]
Length=921

 Score =   158 bits (400),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 152/205 (74%), Gaps = 2/205 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS++  E   Y + F+KRWPS V     + ++ S  L +  +LS +V+  FS  
Sbjct  719  EYVTWLQSDSACEGRMYAEMFEKRWPSFVYPYSGVHSENS--LRKVNKLSLKVIEGFSTS  776

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLF+QEIRE  L TFGGLG AGLSASLLTS+L TTLEDLLALGL SAGGLL +S FP
Sbjct  777  AASKLFDQEIREVSLATFGGLGAAGLSASLLTSVLPTTLEDLLALGLASAGGLLVISKFP  836

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RRQ++++KVKRT D LARE+EEAMQ DL E +  +E  VK + +PYQ+ AQ RLDKLL 
Sbjct  837  SRRQEMIEKVKRTADALAREVEEAMQNDLSEAIGNMEIFVKNVSQPYQDTAQQRLDKLLE  896

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D +++++ +L+TL+ EIQNLHVS
Sbjct  897  LQDEISNVDKQLQTLRIEIQNLHVS  921



>ref|XP_007144634.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
 gb|ESW16628.1| hypothetical protein PHAVU_007G172000g [Phaseolus vulgaris]
Length=914

 Score =   158 bits (399),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   YR+SF+KRWPSL     Q+  +T +LL +  + S++V+ +FS  
Sbjct  710  EYENWLYSKYTQQGRLYRESFEKRWPSLRHESSQMNFETDQLLKKVDQASTQVIDNFSSS  769

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  +GTFG LGVAGLSASLLTS+L TTLEDLLALG+CSAGG LA+S+FP
Sbjct  770  AVSKSFEQEVREMIIGTFGQLGVAGLSASLLTSVLQTTLEDLLALGICSAGGYLAISSFP  829

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ+V+ KVKR  D LA E+EEAM+KDL E +  L+  VK + KPY + A+NRL+KL+ 
Sbjct  830  GRRQRVIDKVKRKADNLAYELEEAMKKDLTEAIESLDTFVKVLSKPYHDEAENRLNKLVK  889

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ EIQNLHVS
Sbjct  890  VQEELSNVEKKLRTLQIEIQNLHVS  914



>gb|KHN18882.1| Hypothetical protein glysoja_028251, partial [Glycine soja]
Length=764

 Score =   156 bits (395),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   Y++SF+KRWPSL     QI  +T +LL +  +  S+V+ +FS  
Sbjct  560  EYGNWLYSKYTQQGRLYKESFEKRWPSLSHESSQINFETDQLLKKVDQAGSQVIDNFSSN  619

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAGLSASLLTS+L TTL+DLLALG+CSAGG LA+S FP
Sbjct  620  AVSKSFEQEVREMILGTFGQLGVAGLSASLLTSVLQTTLDDLLALGICSAGGYLAISTFP  679

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V+ KVKR  D LA E+EEAM+KDL E +  L+  VK + KPYQ+ AQNRL++L+ 
Sbjct  680  ARRQKVIDKVKRKADTLAYELEEAMKKDLTEAIENLDTFVKVLSKPYQDEAQNRLNRLVE  739

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ +IQNL+VS
Sbjct  740  IQEELSNVEKKLRTLQIDIQNLNVS  764



>ref|XP_008386504.1| PREDICTED: uncharacterized protein LOC103449010 [Malus domestica]
Length=918

 Score =   157 bits (398),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 150/205 (73%), Gaps = 5/205 (2%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQS++  E   Y + F+KRWPS V     + +     + +  ELS +V+  FS  
Sbjct  719  EYVTWLQSDSAREGRMYAEMFEKRWPSFVYPYSGVHS-----VKKVNELSLKVIEGFSTS  773

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASKLFEQEIRE  L TFGGLG AGLSASLLTS+L  TLEDLLALGL SAGGLLA+S FP
Sbjct  774  AASKLFEQEIREVSLATFGGLGAAGLSASLLTSVLPNTLEDLLALGLASAGGLLAISKFP  833

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ++++KVKRT D LARE+EEAMQ DL E +  +E  VK + +PYQ+ AQ RLDKLL 
Sbjct  834  ARRQEMIEKVKRTADALAREVEEAMQNDLSEAIGNMEIFVKNVSQPYQDTAQQRLDKLLE  893

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              D +++++ +L+TL+ EIQNLHVS
Sbjct  894  LQDEISNVDKQLQTLRIEIQNLHVS  918



>ref|XP_003520208.1| PREDICTED: uncharacterized protein LOC100785233 isoform X1 [Glycine 
max]
Length=914

 Score =   156 bits (395),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   Y++SF+KRWPSL     QI  +T +LL +  +  S+V+ +FS  
Sbjct  710  EYGNWLYSKYTQQGRLYKESFEKRWPSLSHESSQINFETDQLLKKVDQAGSQVIDNFSSN  769

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAGLSASLLTS+L TTL+DLLALG+CSAGG LA+S FP
Sbjct  770  AVSKSFEQEVREMILGTFGQLGVAGLSASLLTSVLQTTLDDLLALGICSAGGYLAISTFP  829

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V+ KVKR  D LA E+EEAM+KDL E +  L+  VK + KPYQ+ AQNRL++L+ 
Sbjct  830  ARRQKVIDKVKRKADTLAYELEEAMKKDLTEAIENLDTFVKVLSKPYQDEAQNRLNRLVE  889

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ +IQNL+VS
Sbjct  890  IQEELSNVEKKLRTLQIDIQNLNVS  914



>ref|XP_006575072.1| PREDICTED: uncharacterized protein LOC100785233 isoform X2 [Glycine 
max]
Length=869

 Score =   156 bits (394),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 151/205 (74%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   Y++SF+KRWPSL     QI  +T +LL +  +  S+V+ +FS  
Sbjct  665  EYGNWLYSKYTQQGRLYKESFEKRWPSLSHESSQINFETDQLLKKVDQAGSQVIDNFSSN  724

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAGLSASLLTS+L TTL+DLLALG+CSAGG LA+S FP
Sbjct  725  AVSKSFEQEVREMILGTFGQLGVAGLSASLLTSVLQTTLDDLLALGICSAGGYLAISTFP  784

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V+ KVKR  D LA E+EEAM+KDL E +  L+  VK + KPYQ+ AQNRL++L+ 
Sbjct  785  ARRQKVIDKVKRKADTLAYELEEAMKKDLTEAIENLDTFVKVLSKPYQDEAQNRLNRLVE  844

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ +IQNL+VS
Sbjct  845  IQEELSNVEKKLRTLQIDIQNLNVS  869



>ref|XP_003536908.1| PREDICTED: uncharacterized protein LOC100808213 [Glycine max]
Length=915

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 150/205 (73%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    +   Y++SF+KRWPSL     QI   T +LL +  +  S+V+ +FS +
Sbjct  711  EYENWLYSKYTQQGRLYKESFEKRWPSLSHESSQINFGTDQLLKKVDQAGSQVIDNFSSI  770

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAGLSASLLTS+L TTLEDLLALG+CSAGG LA+S FP
Sbjct  771  AVSKSFEQEVREMILGTFGQLGVAGLSASLLTSVLQTTLEDLLALGICSAGGYLAISTFP  830

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ+V+ KVK   + LA E+EEAM+KDL E +  L+  VK + KPYQ+ AQNRL++L+ 
Sbjct  831  ARRQKVIDKVKTKAETLAYELEEAMKKDLTEAIENLDTFVKVLSKPYQDEAQNRLNRLVE  890

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L+++E KL+TLQ +IQNLHVS
Sbjct  891  IQEELSNVEKKLRTLQIDIQNLHVS  915



>ref|XP_009401043.1| PREDICTED: uncharacterized protein LOC103985144 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=926

 Score =   155 bits (391),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 145/205 (71%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL+S    E   Y + F+KRWP+ VD E+++  +T   L    + S +V+ +FS  
Sbjct  722  DYSMWLESRNSDEANLYMECFEKRWPASVDYERKVYLETCASLDTSEDFSMKVLENFSSA  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA++LFEQEIRE  +GTFGGLG AGLSASLLTS+L TTLEDLLAL  CSAGG LA+SNFP
Sbjct  782  AAARLFEQEIREVVVGTFGGLGAAGLSASLLTSVLPTTLEDLLALAFCSAGGWLAISNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARR+Q V+KVKR  D LA EIE+AMQKDL  ++  L   V+  GKPY EAAQ+R+D L  
Sbjct  842  ARRRQAVEKVKRVADKLAHEIEKAMQKDLQHSIEKLNHFVEATGKPYAEAAQDRIDWLAK  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T D L  +E  L+ ++ EIQNLHVS
Sbjct  902  TQDELAKVEQNLQAMKVEIQNLHVS  926



>ref|XP_003590651.1| GTP-binding protein engA [Medicago truncatula]
 gb|AES60902.1| FZO-like protein [Medicago truncatula]
Length=914

 Score =   153 bits (386),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 149/205 (73%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL +    +   Y++SF+KRW SL+    Q  ++T +LL +  +   +V+ +FS  
Sbjct  710  DYENWLSAKNTQQGRLYKESFEKRWSSLIHENSQKNSETYELLKKGDQAGYQVIENFSSS  769

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            A SK FEQE+RE  LGTFG LGVAG SASLLTS+L TTLEDLLALG+CS GG +A+SNFP
Sbjct  770  AVSKSFEQEVRETILGTFGQLGVAGFSASLLTSVLQTTLEDLLALGICSVGGYIAISNFP  829

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            +RR++V+ KVKR  D LA E+EEAM++DL E +  L+  V+ IGKPYQ+  QNRL+KL+ 
Sbjct  830  SRRRRVIDKVKRKADTLANELEEAMKRDLTEAVENLDTFVRVIGKPYQDQVQNRLNKLVE  889

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + +++IE KL+TLQ +IQNLHVS
Sbjct  890  IQEEISNIEKKLRTLQIDIQNLHVS  914



>ref|XP_010684259.1| PREDICTED: uncharacterized protein LOC104898847 [Beta vulgaris 
subsp. vulgaris]
Length=930

 Score =   149 bits (375),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 125/209 (60%), Positives = 151/209 (72%), Gaps = 4/209 (2%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTS---KLLGRKYELSSRV-MAD  584
            EY +WL+ N   E + Y+++F KRWP LVD+  Q    T+    L  R+ +  S +    
Sbjct  722  EYTSWLRENNIREGMRYKETFAKRWPLLVDSHNQADFTTNLQNCLAPREVDTQSLISTGK  781

Query  583  FSPMAASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAV  404
            FS   ASKLFEQEIR+ F G FGGLG AGLSASLLTS+L TTLEDLLALGLCSAGGLLA+
Sbjct  782  FSATTASKLFEQEIRQVFFGAFGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGLLAI  841

Query  403  SNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLD  224
            SNFPARRQ+VV KVK   D + +EI EAMQKDLL T+  +ED V  +GKPY+EAAQ RLD
Sbjct  842  SNFPARRQKVVDKVKSIADTVEQEIVEAMQKDLLMTIKNMEDFVSLVGKPYEEAAQQRLD  901

Query  223  KLLATADNLTDIESKLKTLQNEIQNLHVS  137
            KLL T + LT IE KL+TLQ E+QN H++
Sbjct  902  KLLDTQEQLTIIEKKLQTLQVELQNFHLT  930



>ref|XP_002300848.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
 gb|EEE80121.2| hypothetical protein POPTR_0002s05420g [Populus trichocarpa]
Length=797

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 143/205 (70%), Gaps = 19/205 (9%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WL+SN D             +P+      QI  +T   L ++ +LS RV  +FS  
Sbjct  612  EYVIWLKSNID-------------YPT-----SQIHLET-HYLAKQVDLSMRVTENFSAR  652

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SKLFE++IRE FLGTFG LG A LSASLLTS+L TTLEDLL LGLC+AGG +A+S FP
Sbjct  653  VTSKLFEKQIREVFLGTFGRLGAANLSASLLTSVLPTTLEDLLVLGLCTAGGFVAISTFP  712

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARRQ +V +V R  DGLA E+EEAMQKDL+ET+  LE+ VK IGKPYQ+AAQ RL KLL 
Sbjct  713  ARRQAMVDQVNRIADGLAGEVEEAMQKDLMETVGNLENFVKTIGKPYQDAAQKRLGKLLD  772

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + L++++ K +TL+ EIQN+HVS
Sbjct  773  LQEELSNVDKKHRTLRIEIQNVHVS  797



>ref|XP_004495204.1| PREDICTED: uncharacterized protein LOC101505859 isoform X2 [Cicer 
arietinum]
Length=892

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 149/205 (73%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY +WL S    +   Y++SF+KRW SL+    Q+  +T +LL +  E   +V+ +FS  
Sbjct  688  EYKSWLCSKNTQQGRSYKESFEKRWSSLIHENSQMSVETYELLKKGDEAGYKVIENFSSS  747

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASK FEQE+R+  LGTFG LGVAG SASLLTS+L TTLEDLLALG+CS GG LA+SNFP
Sbjct  748  AASKSFEQEVRDTILGTFGQLGVAGFSASLLTSVLHTTLEDLLALGICSVGGYLAISNFP  807

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ V+ KVKR  D LA E+EEAM+KDL E +  L+  V+ IGKPYQ+ A NRL+KL+ 
Sbjct  808  TRRQSVIDKVKRKADTLAYELEEAMKKDLTEAVENLDTFVRVIGKPYQDQAHNRLNKLVE  867

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + +++I+ KL+TLQ EIQNLHVS
Sbjct  868  IQEEISNIDKKLRTLQMEIQNLHVS  892



>ref|XP_004495203.1| PREDICTED: uncharacterized protein LOC101505859 isoform X1 [Cicer 
arietinum]
Length=926

 Score =   145 bits (366),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 149/205 (73%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY +WL S    +   Y++SF+KRW SL+    Q+  +T +LL +  E   +V+ +FS  
Sbjct  722  EYKSWLCSKNTQQGRSYKESFEKRWSSLIHENSQMSVETYELLKKGDEAGYKVIENFSSS  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AASK FEQE+R+  LGTFG LGVAG SASLLTS+L TTLEDLLALG+CS GG LA+SNFP
Sbjct  782  AASKSFEQEVRDTILGTFGQLGVAGFSASLLTSVLHTTLEDLLALGICSVGGYLAISNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ V+ KVKR  D LA E+EEAM+KDL E +  L+  V+ IGKPYQ+ A NRL+KL+ 
Sbjct  842  TRRQSVIDKVKRKADTLAYELEEAMKKDLTEAVENLDTFVRVIGKPYQDQAHNRLNKLVE  901

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
              + +++I+ KL+TLQ EIQNLHVS
Sbjct  902  IQEEISNIDKKLRTLQMEIQNLHVS  926



>ref|XP_011026335.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105126973 
[Populus euphratica]
Length=1020

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 142/205 (69%), Gaps = 2/205 (1%)
 Frame = -1

Query  751   EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
             EY+ WL+SN+      Y++SF+K W S+     QI  +T   L ++ ELS RV  DFS  
Sbjct  818   EYVIWLKSNSARGGKLYKESFEKXWTSVDYPTSQIHLET-HYLAKQVELSMRVTQDFSAR  876

Query  571   AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
               SKLFE++I E FL TFG LG A LSASLLTS+L T LEDLL LGLC+AGG +A+S FP
Sbjct  877   VTSKLFEKQIHEVFLRTFGRLGAANLSASLLTSVLPTILEDLLVLGLCTAGGFVAISTFP  936

Query  391   ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             ARRQ +V +V R    LA E+EEAMQKDL+ET+  LE  VK IGKPYQ+AAQ RL KLL 
Sbjct  937   ARRQAMVDQVNRIAGCLAGEVEEAMQKDLMETVGNLEIFVKTIGKPYQDAAQKRLGKLLD  996

Query  211   TADNLTDIESKLKTLQNEIQNLHVS  137
               +  ++++ K  TL+ EI+N+HVS
Sbjct  997   LQEP-SNVDKKTLTLRIEIRNVHVS  1020



>ref|XP_010522715.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522716.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522717.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522719.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522720.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522721.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522722.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522723.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522724.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522725.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522726.1| PREDICTED: uncharacterized protein LOC104801235 isoform X1 [Tarenaya 
hassleriana]
Length=932

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 144/207 (70%), Gaps = 2/207 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY+ WLQSN   E    + SF+ +WP  V+    +  +T  LL +  E S +++ + S  
Sbjct  720  EYVEWLQSNNAREGSLSKKSFENKWPRYVNPNALVDMETYDLLRKMDEFSLKIIQNLSTT  779

Query  571  AAS--KLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSN  398
            +++  K  EQ+IRE F GT GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A+SN
Sbjct  780  SSTTSKKLEQDIREVFFGTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAISN  839

Query  397  FPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKL  218
            FP+RRQ ++ KV R  D LA+++E+AMQKDL   M  LE+ V  IG+PY+E AQ RLD+L
Sbjct  840  FPSRRQAIIDKVNRAADALAQQLEDAMQKDLSRAMVNLENFVDIIGRPYREEAQQRLDRL  899

Query  217  LATADNLTDIESKLKTLQNEIQNLHVS  137
            L     L+DI SKL+TLQ EI NLHVS
Sbjct  900  LGVQKELSDIRSKLQTLQVEIDNLHVS  926



>ref|XP_006851107.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
 gb|ERN12688.1| hypothetical protein AMTR_s00025p00248100 [Amborella trichopoda]
Length=947

 Score =   140 bits (353),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 139/204 (68%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL  +   E + Y   F+K WP  V  E    ++ ++LL R+ E S +V+  FS  
Sbjct  742  DYSTWLDCSNAREGMQYTQIFEKEWPGFVFPEGLTLSEKNQLLDRREEHSIKVLEQFSAS  801

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+KLF+QEIRE  LGT GGLG AGLSASLLT++L TT EDLLALGLCSAGGLL +SN+P
Sbjct  802  AATKLFDQEIREVVLGTIGGLGAAGLSASLLTTVLETTAEDLLALGLCSAGGLLVISNYP  861

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARR+++V KV +  D L RE+E AMQKDL +T+  L    + I +PYQEA QN+L+ LL 
Sbjct  862  ARRKELVNKVNKVADSLGRELELAMQKDLDDTIGNLAGFAECISRPYQEATQNKLNYLLD  921

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L     KL+TLQNEIQN+H+
Sbjct  922  IQKELLSTGEKLRTLQNEIQNIHI  945



>ref|XP_010927024.1| PREDICTED: uncharacterized protein LOC105049151 isoform X2 [Elaeis 
guineensis]
Length=881

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS    E   Y + F K+  +  + +    ++   LLG   ELS +V+ +FS  
Sbjct  677  EYSKWLQSKIAHEGKLYMEFFNKQCQASGNVKGMSHSEPYGLLGNGEELSMKVIENFSAS  736

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              ++LFE E+RE  LGTFGGLG AGLSASLLTS+L TT+EDL+AL  CSAGG LA+S FP
Sbjct  737  TVARLFENEVREVVLGTFGGLGAAGLSASLLTSVLPTTVEDLIALSFCSAGGFLAISKFP  796

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR++ ++KV+R  D LAREIE+ MQKDL  +   L   V+ I KPYQ+AAQ R+D+LL 
Sbjct  797  TRRKEAIQKVRRVADSLAREIEDGMQKDLQHSTEKLTHFVEIISKPYQDAAQRRIDQLLT  856

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T   L ++E +L+ L+ EIQNLHVS
Sbjct  857  TQGELANVEQRLQALKVEIQNLHVS  881



>ref|XP_010927025.1| PREDICTED: uncharacterized protein LOC105049151 isoform X3 [Elaeis 
guineensis]
Length=872

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS    E   Y + F K+  +  + +    ++   LLG   ELS +V+ +FS  
Sbjct  668  EYSKWLQSKIAHEGKLYMEFFNKQCQASGNVKGMSHSEPYGLLGNGEELSMKVIENFSAS  727

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              ++LFE E+RE  LGTFGGLG AGLSASLLTS+L TT+EDL+AL  CSAGG LA+S FP
Sbjct  728  TVARLFENEVREVVLGTFGGLGAAGLSASLLTSVLPTTVEDLIALSFCSAGGFLAISKFP  787

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR++ ++KV+R  D LAREIE+ MQKDL  +   L   V+ I KPYQ+AAQ R+D+LL 
Sbjct  788  TRRKEAIQKVRRVADSLAREIEDGMQKDLQHSTEKLTHFVEIISKPYQDAAQRRIDQLLT  847

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T   L ++E +L+ L+ EIQNLHVS
Sbjct  848  TQGELANVEQRLQALKVEIQNLHVS  872



>ref|XP_010927023.1| PREDICTED: uncharacterized protein LOC105049151 isoform X1 [Elaeis 
guineensis]
Length=928

 Score =   138 bits (348),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS    E   Y + F K+  +  + +    ++   LLG   ELS +V+ +FS  
Sbjct  724  EYSKWLQSKIAHEGKLYMEFFNKQCQASGNVKGMSHSEPYGLLGNGEELSMKVIENFSAS  783

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              ++LFE E+RE  LGTFGGLG AGLSASLLTS+L TT+EDL+AL  CSAGG LA+S FP
Sbjct  784  TVARLFENEVREVVLGTFGGLGAAGLSASLLTSVLPTTVEDLIALSFCSAGGFLAISKFP  843

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR++ ++KV+R  D LAREIE+ MQKDL  +   L   V+ I KPYQ+AAQ R+D+LL 
Sbjct  844  TRRKEAIQKVRRVADSLAREIEDGMQKDLQHSTEKLTHFVEIISKPYQDAAQRRIDQLLT  903

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T   L ++E +L+ L+ EIQNLHVS
Sbjct  904  TQGELANVEQRLQALKVEIQNLHVS  928



>ref|XP_008783175.1| PREDICTED: uncharacterized protein LOC103702498 isoform X2 [Phoenix 
dactylifera]
Length=750

 Score =   134 bits (337),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQS    E   Y + F K+  +L + +    ++   LL  + EL  +V+  F+  
Sbjct  546  DYSKWLQSKIADEGKLYMECFNKQCQALGNVKGMGLSEPYGLLVNEEELCMKVIEKFNAS  605

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
             A++L E+E+RE  LGTFGGLG AGLSASLLTS+L TT+EDL+AL  CSAGG LA+S FP
Sbjct  606  TAARLIEKEVREVVLGTFGGLGAAGLSASLLTSVLPTTVEDLIALSFCSAGGWLAISKFP  665

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARR+  ++KV+R  D L REIE+AMQKDL  +   L   V+ I KPYQEAAQ+R+D+LL 
Sbjct  666  ARRKDAIEKVRRVADSLTREIEDAMQKDLQHSTEKLTHFVEIISKPYQEAAQHRMDRLLM  725

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T   LT +  KL+ L+ EIQNLHVS
Sbjct  726  TQGELTHVAQKLQALKVEIQNLHVS  750



>ref|XP_008783174.1| PREDICTED: uncharacterized protein LOC103702498 isoform X1 [Phoenix 
dactylifera]
Length=922

 Score =   134 bits (337),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQS    E   Y + F K+  +L + +    ++   LL  + EL  +V+  F+  
Sbjct  718  DYSKWLQSKIADEGKLYMECFNKQCQALGNVKGMGLSEPYGLLVNEEELCMKVIEKFNAS  777

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
             A++L E+E+RE  LGTFGGLG AGLSASLLTS+L TT+EDL+AL  CSAGG LA+S FP
Sbjct  778  TAARLIEKEVREVVLGTFGGLGAAGLSASLLTSVLPTTVEDLIALSFCSAGGWLAISKFP  837

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
            ARR+  ++KV+R  D L REIE+AMQKDL  +   L   V+ I KPYQEAAQ+R+D+LL 
Sbjct  838  ARRKDAIEKVRRVADSLTREIEDAMQKDLQHSTEKLTHFVEIISKPYQEAAQHRMDRLLM  897

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
            T   LT +  KL+ L+ EIQNLHVS
Sbjct  898  TQGELTHVAQKLQALKVEIQNLHVS  922



>ref|NP_171815.3| FZO-like protein [Arabidopsis thaliana]
 gb|ABE96616.1| FZL [Arabidopsis thaliana]
 gb|AEE27537.1| FZO-like protein [Arabidopsis thaliana]
Length=912

 Score =   133 bits (335),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 140/205 (68%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP+ V+++ Q+  DT  LL +  ++S + + + S  
Sbjct  702  KYAEWLQSNTAREGSLSLKSFENKWPTYVNSKTQLGIDTYDLLQKTDKVSLKTIQNLSAG  761

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  762  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  821

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +  + L + V  + KPY+E AQ RLD+LL 
Sbjct  822  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATSNLVNFVNIVAKPYREEAQLRLDRLLG  881

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+DI SKL+ LQ +I NLHVS
Sbjct  882  IQKELSDIRSKLQLLQVDIDNLHVS  906



>ref|XP_010474935.1| PREDICTED: uncharacterized protein LOC104754437 [Camelina sativa]
Length=930

 Score =   132 bits (332),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 106/204 (52%), Positives = 138/204 (68%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+K+WP+ V+++ Q+  DT  LL +  ++S + + + S  
Sbjct  720  KYAEWLQSNTAREGSLSLKSFEKKWPTYVNSKTQLGIDTYDLLRKTDKISLKTIQNLSAG  779

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +AV+NFP
Sbjct  780  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAVANFP  839

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD LL 
Sbjct  840  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDHLLG  899

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ +I NLHV
Sbjct  900  IQKELSDIRSKLQLLQVDIDNLHV  923



>ref|XP_010481655.1| PREDICTED: uncharacterized protein LOC104760424 [Camelina sativa]
Length=930

 Score =   131 bits (330),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 137/204 (67%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+K+WP+ V+++ Q+  DT  LL +  ++S + + + S  
Sbjct  720  KYAEWLQSNTAREGSLSLKSFEKKWPTYVNSKTQLGIDTYDLLRKTDKISLKTIQNLSAG  779

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLA GLCSAGG +A++NFP
Sbjct  780  TTSKRLEQDIREVFFVTVGGLGSAGLSASLLTSVLPTTLEDLLAFGLCSAGGYVAIANFP  839

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD LL 
Sbjct  840  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDHLLG  899

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ +I NLHV
Sbjct  900  IQKELSDIRSKLQLLQVDIDNLHV  923



>gb|EPS74309.1| hypothetical protein M569_00446, partial [Genlisea aurea]
Length=721

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 139/200 (70%), Gaps = 2/200 (1%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSS-RVMADFSP  575
            EY  WL S++  +  F RDSF+KRWP +V A  Q Q + ++LL  K+E    RV+ADFS 
Sbjct  523  EYCLWLHSSSSRKANFCRDSFEKRWPFVV-ASVQSQVEANQLLRTKHEEGGVRVVADFSV  581

Query  574  MAASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNF  395
             AA++LF+QEIR+ F+ T+GGLG AGLSASLLTSIL T LEDLLALGLCSAGG L++ NF
Sbjct  582  AAAARLFDQEIRQVFVSTYGGLGAAGLSASLLTSILPTALEDLLALGLCSAGGYLSIFNF  641

Query  394  PARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLL  215
            PARR++ V+KVKR  + L REIE+ M KDL E+   L   V   G PY+E A+ R+D++ 
Sbjct  642  PARRKRAVEKVKRAAEALRREIEDGMDKDLSESQNRLRRSVWLFGGPYREMAEERVDRIA  701

Query  214  ATADNLTDIESKLKTLQNEI  155
             T + + D + KL  L  EI
Sbjct  702  TTLNEIADADGKLSNLHREI  721



>emb|CDY15452.1| BnaA08g27360D [Brassica napus]
Length=907

 Score =   130 bits (328),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP  V+++ Q+  DT  LL +  + S + + + S  
Sbjct  702  KYAEWLQSNTAREGSLSLKSFENKWPQYVNSKTQLGIDTYDLLRKTNKFSLKTIQNLSAG  761

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  762  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  821

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  822  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  881

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ EI NLHV
Sbjct  882  IQKELSDIRSKLQLLQVEIDNLHV  905



>ref|XP_009111165.1| PREDICTED: uncharacterized protein LOC103836629 [Brassica rapa]
Length=909

 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP  V+++ Q+  DT  LL +  + S + + + S  
Sbjct  704  KYAEWLQSNTAREGSLSLKSFENKWPQYVNSKTQLGIDTYDLLRKTDKFSLKTIQNLSAG  763

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  764  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  823

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  824  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  883

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ EI NLHV
Sbjct  884  IQKELSDIRSKLQLLQVEIDNLHV  907



>ref|XP_010474922.1| PREDICTED: uncharacterized protein LOC104754425 isoform X1 [Camelina 
sativa]
Length=932

 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 138/204 (68%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+K+WP+  +++ Q+  DT  LL +  ++S + + + S  
Sbjct  722  KYAEWLQSNTAREGSMSLKSFEKKWPTYFNSKTQLGIDTYDLLRKTDKISLKTIQNLSAG  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  782  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  842  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  901

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ +I NLHV
Sbjct  902  IQKELSDIRSKLQLLQVDIDNLHV  925



>emb|CDX86689.1| BnaC08g00140D [Brassica napus]
Length=909

 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 136/204 (67%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP  V+++ Q+  DT  LL +  + S + + + S  
Sbjct  704  KYGEWLQSNTAREGSLSLKSFENKWPQYVNSKTQLGIDTYDLLRKTDKFSLKTIQNLSAG  763

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  764  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  823

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  824  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  883

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+DI SKL+ LQ EI NLHV
Sbjct  884  IQKELSDIRSKLQLLQVEIDNLHV  907



>dbj|BAK07723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=967

 Score =   129 bits (324),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S+   E   Y + F +RW SLV  E+++ +D ++L+    +LS   +  FS  
Sbjct  763  EYSKWLSSSNTCEANLYLECFHERWDSLVSQEERVSSDPTELVSEGEKLSINALDGFSAT  822

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LTTTLEDLLAL LCSAGG  A+SNFP
Sbjct  823  AAAKVFEEEIREVATGTFGGLGVAGLSASLLTSVLTTTLEDLLALALCSAGGFFAISNFP  882

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  V+KV +  D L+R+++EA+QKD+ ++ + L   V    KPYQEA Q ++D L  
Sbjct  883  GRRKLAVEKVSKAADELSRKVDEAIQKDISQSASKLVQFVDTASKPYQEACQRKIDWLQG  942

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ +IQNLH S
Sbjct  943  VQGELSAVERKLQTLKVDIQNLHGS  967



>ref|XP_006306709.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
 gb|EOA39607.1| hypothetical protein CARUB_v10008235mg [Capsella rubella]
Length=929

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 136/205 (66%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQS    E      SF+ +WP+ V+++ Q+  DT  LL +  + S + + + S  
Sbjct  719  KYAEWLQSTTAREGSMSLKSFENKWPTYVNSKTQLGIDTYDLLRKNDKFSLKTIQNLSAG  778

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  779  TTSKRLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  838

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  839  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  898

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L DI SKL+ LQ +I NLHVS
Sbjct  899  IQKELLDIRSKLQLLQVDIDNLHVS  923



>ref|XP_002889440.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65699.1| hypothetical protein ARALYDRAFT_470295 [Arabidopsis lyrata subsp. 
lyrata]
Length=923

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP+ V+++ Q+  DT  LL +  + S + + + S  
Sbjct  713  KYAEWLQSNTAREGSLSLKSFENKWPTYVNSKTQLGIDTYDLLRKTDKFSLKTIQNLSAG  772

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F+ T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  773  TTSKRLEQDIREVFVVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  832

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E++M+KDL +    L + V  + KPY+E AQ RLD LL 
Sbjct  833  YRRQAIIGKVNKVADALAQQLEDSMRKDLSDATDNLVNFVNIVAKPYREEAQLRLDHLLG  892

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+DI SKL+ LQ +I NLHVS
Sbjct  893  IQKELSDIRSKLQLLQVDIDNLHVS  917



>gb|EMS57874.1| Uncharacterized protein in xynA 3'region [Triticum urartu]
Length=1201

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 142/205 (69%), Gaps = 0/205 (0%)
 Frame = -1

Query  751   EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
             EY  WL S+   E   Y + F +RW SLV  E+ + +D ++L+    +LS + +  FS  
Sbjct  997   EYSKWLSSSNTREANLYLECFHERWNSLVSQEESVSSDRTELVNEGEKLSIKALDGFSAT  1056

Query  571   AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
             AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LTTTLEDLLAL LCSAGG LA+SNFP
Sbjct  1057  AAAKVFEEEIREVATGTFGGLGVAGLSASLLTSVLTTTLEDLLALALCSAGGFLAISNFP  1116

Query  391   ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
              RR+  V+KV +  D L+R+++EA+QKD+ ++ + L   V    KPYQEA Q ++D L  
Sbjct  1117  GRRKLAVEKVSKAADELSRKVDEAIQKDISKSASQLVQFVDTASKPYQEACQRKIDWLQG  1176

Query  211   TADNLTDIESKLKTLQNEIQNLHVS  137
                 L+ +E KL+TL+ +IQNLH S
Sbjct  1177  VQGELSAVERKLQTLKIDIQNLHGS  1201



>ref|XP_006418260.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
 gb|ESQ36613.1| hypothetical protein EUTSA_v10006729mg [Eutrema salsugineum]
Length=926

 Score =   126 bits (317),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 135/204 (66%), Gaps = 0/204 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP  V+++ Q+  DT  LL +  + S + + + S  
Sbjct  719  KYAEWLQSNTAREGSLLLKSFENKWPKYVNSKTQLGIDTYDLLRKTDKFSLKTIQNLSAG  778

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
              SK  EQ+IRE F  T GGLG AGLSASLLTS+L TTLEDLLALGLCSAGG +A++NFP
Sbjct  779  TTSKQLEQDIREVFFVTVGGLGAAGLSASLLTSVLPTTLEDLLALGLCSAGGYVAIANFP  838

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RRQ ++ KV +  D LA+++E+AMQKDL +    L + V  + KPY+E AQ RLD+LL 
Sbjct  839  YRRQAIIGKVNKVADALAQQLEDAMQKDLSDATNNLVNFVNIVAKPYREEAQLRLDRLLG  898

Query  211  TADNLTDIESKLKTLQNEIQNLHV  140
                L+D+ S+L  L+ EI NLHV
Sbjct  899  IQKKLSDMRSRLHLLEVEIDNLHV  922



>gb|EMT28456.1| putative Uncharacterized protein in xynA 3'region [Aegilops tauschii]
Length=765

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 140/205 (68%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S+   E   Y + F +RW SLV  E+   +D ++L+    +LS + +  FS  
Sbjct  561  EYSKWLSSSNTREANLYLECFHERWNSLVSQEESGSSDRTELVNEGEKLSIKALDGFSAT  620

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LTTTLEDLLAL LCSAGG LA+SNFP
Sbjct  621  AAAKVFEEEIREVATGTFGGLGVAGLSASLLTSVLTTTLEDLLALALCSAGGFLAISNFP  680

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  V+KV +  D L+R++ EA+QKD+ ++ + L   V    KPYQEA Q ++D L  
Sbjct  681  GRRKLAVEKVSKAADELSRKVNEAIQKDISQSASQLVQFVDTASKPYQEACQRKIDWLQG  740

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ +IQNLH S
Sbjct  741  VQGELSAVERKLQTLKIDIQNLHGS  765



>ref|XP_004963794.1| PREDICTED: uncharacterized protein LOC101755934, partial [Setaria 
italica]
Length=895

 Score =   125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 140/205 (68%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S+   E   Y + F KRW +LV  E+++ +D + L+    +L+ + +  F   
Sbjct  691  EYSTWLSSSNTREANLYLECFHKRWAALVAQEERVLSDPNGLVNEGEKLTVKALDGFDAS  750

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            + +K+FE+EIRE   GTFGGLGVAGLSASLLTS+L+TTLEDLLAL LCSAGG + +S+FP
Sbjct  751  STAKVFEEEIREVAFGTFGGLGVAGLSASLLTSVLSTTLEDLLALALCSAGGFIVLSSFP  810

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  ++KV +  D L+R+++EA+QKD+ ++   L   V+ I KPYQEA Q ++D L  
Sbjct  811  GRRKLAIEKVNKAADELSRKVDEAIQKDISQSANNLVRFVEVISKPYQEACQQKIDWLQG  870

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ EIQNLH S
Sbjct  871  VQGELSAVERKLQTLKVEIQNLHGS  895



>ref|XP_006655278.1| PREDICTED: uncharacterized protein LOC102702759 [Oryza brachyantha]
Length=772

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    E   Y + F +RW  LV  E++I ++ ++L+    +LS + +  FS  
Sbjct  568  EYSTWLSSTNIREANIYVECFHERWGVLVAQEQRIPSEKNELINEGEKLSVKALDGFSAS  627

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE  LGTFGGLGVAGLSASLLTS+LT+TLEDLLAL LCSAGG  A+SNFP
Sbjct  628  AAAKVFEEEIREVALGTFGGLGVAGLSASLLTSVLTSTLEDLLALALCSAGGFFAISNFP  687

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  ++K+ +  + L+ +++EA+Q+D+  +   L + V+ I KPYQ+A Q ++D L  
Sbjct  688  TRRKLALEKISKAAEKLSSKVDEAIQEDISRSANKLVNFVETISKPYQDACQQKIDWLQG  747

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+T++ EIQNLH S
Sbjct  748  VQGELSAVERKLQTMKVEIQNLHES  772



>ref|NP_001055439.1| Os05g0390100 [Oryza sativa Japonica Group]
 gb|AAT47445.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17353.1| Os05g0390100 [Oryza sativa Japonica Group]
 dbj|BAG99883.1| unnamed protein product [Oryza sativa Japonica Group]
Length=803

 Score =   120 bits (301),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    E   Y D F +RW +LV  E++I  + ++L+  + +L  + +  FS  
Sbjct  599  EYSTWLSSTNVREANIYVDCFHERWGALVAQEQRIPPEKNELVNEEEKLCVKALDGFSAS  658

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LT+TLEDLLAL LCSAGG  A+SNFP
Sbjct  659  AAAKVFEEEIREVAWGTFGGLGVAGLSASLLTSVLTSTLEDLLALALCSAGGFFAISNFP  718

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  V+K+ +  + L+ +++EA+Q+D+  +   L   V+ + KPYQ+A Q ++D L  
Sbjct  719  TRRKLAVEKIGKAAEKLSSKVDEAIQQDISRSANQLVHFVETVSKPYQDACQQKIDWLQG  778

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ EIQNLH S
Sbjct  779  VQGELSTVERKLQTLKVEIQNLHES  803



>ref|XP_010233244.1| PREDICTED: uncharacterized protein LOC100838168 [Brachypodium 
distachyon]
Length=965

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 140/203 (69%), Gaps = 0/203 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S+   E   Y + F +RW SL+  E+++ +D ++L+    +LS + +  FS  
Sbjct  761  EYSTWLSSSNIREANLYLECFHERWSSLLTQEERLPSDPNELVNEGEKLSIKALNGFSAY  820

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE EIRE   GTFGGLGVAGLSASLLTS+LTTTLEDLLAL LCSAGG  A+SNFP
Sbjct  821  AAAKVFEAEIREVATGTFGGLGVAGLSASLLTSVLTTTLEDLLALALCSAGGFFAISNFP  880

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  ++KV +  D L+R+++EA+Q+D+ ++ + L   V  + KPYQ+A Q ++D L  
Sbjct  881  GRRKLALEKVSKAADDLSRKVDEAIQEDISQSASKLVQFVDVLSKPYQDACQRKIDWLQG  940

Query  211  TADNLTDIESKLKTLQNEIQNLH  143
                ++ +E KL+T + +IQNLH
Sbjct  941  VQGEMSAVERKLQTFKVDIQNLH  963



>ref|XP_002439739.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
 gb|EES18169.1| hypothetical protein SORBIDRAFT_09g019290 [Sorghum bicolor]
Length=922

 Score =   120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 138/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL S+   E   Y + F  RW +LV  E++   D + L+    +L+ + +  F+  
Sbjct  718  DYSTWLSSSNTREAKVYLECFSARWDALVGPEERALLDPNGLVNEGEKLTIKALDGFNAS  777

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLG+AGLSASLLTS+L+TTLEDLLAL LCSAGG   +S+FP
Sbjct  778  AAAKVFEEEIREVAFGTFGGLGIAGLSASLLTSVLSTTLEDLLALALCSAGGFFVLSSFP  837

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  ++KV +  D L+R+++EA+QKD+ ++   L   V+ I KPYQEA Q ++D L  
Sbjct  838  GRRKLAIQKVNKAADELSRKVDEAIQKDISQSANDLIRFVEVISKPYQEACQRKIDWLQG  897

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ EIQNLH S
Sbjct  898  VQGELSAVERKLQTLKVEIQNLHGS  922



>gb|EAY97909.1| hypothetical protein OsI_19825 [Oryza sativa Indica Group]
Length=925

 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    E   Y D F +RW +LV  E++I  + ++L+  + +L  + +  FS  
Sbjct  721  EYSTWLSSTNVREANIYVDCFHERWGALVAQEQRIPPEKNELVNEEEKLCVKALDGFSAS  780

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LT+TLEDLLAL LCSAGG  A+SNFP
Sbjct  781  AAAKVFEEEIREVAWGTFGGLGVAGLSASLLTSVLTSTLEDLLALALCSAGGFFAISNFP  840

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  V+K+ +  + L+ +++EA+Q+D+  +   L   V+ + KPYQ+A Q ++D L  
Sbjct  841  TRRKLAVEKIGKAAEKLSSKVDEAIQQDISRSANQLVHFVETVSKPYQDACQQKIDWLQG  900

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ EIQNLH S
Sbjct  901  VQGELSTVERKLQTLKVEIQNLHES  925



>gb|KJB23087.1| hypothetical protein B456_004G080200 [Gossypium raimondii]
Length=850

 Score =   117 bits (293),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +SNFPARRQ +++KVK+T D L +E+E+AMQKDL ET   LE  V+ IG+PY++AAQNRL
Sbjct  761  ISNFPARRQGIIEKVKKTADALGQELEDAMQKDLQETTQNLEKFVRIIGEPYRDAAQNRL  820

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            DKLL   D L+++   LK LQ EIQNLHVS
Sbjct  821  DKLLEVKDELSNVRGTLKMLQVEIQNLHVS  850



>ref|XP_008649599.1| PREDICTED: uncharacterized protein LOC103630315 [Zea mays]
Length=917

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 137/205 (67%), Gaps = 0/205 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL S+   E   Y + F +RW +LV  E++   D + L+    +L+ + +  F+  
Sbjct  713  DYSTWLSSSNTREANVYLECFCERWDALVAPEERALLDPNGLVNEGEKLTIKALEGFNAS  772

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K FE+EIRE   GTFGGLG+AGLSASLLTS+L+TTLEDLLAL LCSAGG   +S+FP
Sbjct  773  AAAKDFEEEIRELAFGTFGGLGIAGLSASLLTSVLSTTLEDLLALALCSAGGFFVLSSFP  832

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLA  212
             RR+  + K+ +  D L+R+++EA+QKD+ ++   L   V+ I KPYQEA Q ++D L  
Sbjct  833  GRRKHAIDKINKAADELSRKVDEAIQKDISQSANNLIRFVEVISKPYQEACQRKIDWLQG  892

Query  211  TADNLTDIESKLKTLQNEIQNLHVS  137
                L+ +E KL+TL+ EIQNL+ S
Sbjct  893  VQGELSAVERKLQTLKVEIQNLNGS  917



>ref|XP_010255949.1| PREDICTED: uncharacterized protein LOC104596469 isoform X3 [Nelumbo 
nucifera]
Length=915

 Score =   112 bits (279),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +SNFP RR+++  KVKR  D LARE++EAMQ+DLL+T+  LE+ VK I KPYQ+AAQ+RL
Sbjct  826  ISNFPTRRREMEDKVKRAADILAREVKEAMQRDLLKTIEDLENFVKLISKPYQDAAQSRL  885

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            DK+L   + L ++E +L+TLQ EIQNLHVS
Sbjct  886  DKILEIQEELLNVEKRLQTLQIEIQNLHVS  915



>ref|XP_008368936.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103432519 
[Malus domestica]
Length=737

 Score =   109 bits (273),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +S FPARRQ++++KVKRT D LARE+EEAMQ DL E +  +E  VK + +PYQ+ AQ RL
Sbjct  648  ISKFPARRQEMIEKVKRTADALAREVEEAMQNDLSEAIGNMEIFVKNVSQPYQDTAQQRL  707

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            DKLL   D +++++ +L+TL+ EIQNLHVS
Sbjct  708  DKLLELQDEISNVDKQLQTLRIEIQNLHVS  737



>gb|KCW58853.1| hypothetical protein EUGRSUZ_H01482 [Eucalyptus grandis]
Length=674

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +SNFPARRQ VV KV +T D LAR++EEAMQKDLL+T+  +E+ +  I KPYQEAAQ+RL
Sbjct  585  ISNFPARRQVVVNKVNKTVDALARDLEEAMQKDLLDTVTNMENFINIISKPYQEAAQSRL  644

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            DK+L   D L+ ++ +L+ LQ EIQNLH S
Sbjct  645  DKILKLQDELSAVQDRLRMLQIEIQNLHTS  674



>ref|XP_010070220.1| PREDICTED: uncharacterized protein LOC104457004 isoform X2 [Eucalyptus 
grandis]
Length=861

 Score =   103 bits (257),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +SNFPARRQ VV KV +T D LAR++EEAMQKDLL+T+  +E+ +  I KPYQEAAQ+RL
Sbjct  772  ISNFPARRQVVVNKVNKTVDALARDLEEAMQKDLLDTVTNMENFINIISKPYQEAAQSRL  831

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            DK+L   D L+ ++ +L+ LQ EIQNLH S
Sbjct  832  DKILKLQDELSAVQDRLRMLQIEIQNLHTS  861



>gb|ABR16920.1| unknown [Picea sitchensis]
Length=297

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 95/207 (46%), Positives = 132/207 (64%), Gaps = 5/207 (2%)
 Frame = -1

Query  748  YMAWLQSNADSEEIFYRDSFQKRWPSLVDAEK---QIQADTSKLLGRKYELSSRVMADFS  578
            Y  WL+SN   +E ++R+ F K WPSL +  K    I+  + + + + +  S +V+ +F+
Sbjct  93   YWTWLRSNNAQQERWFREIFDKEWPSLANPGKLNTGIEKKSEEQIQQAH--SMKVLEEFN  150

Query  577  PMAASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSN  398
              AA+ LFEQEIRE  + TFGGLGVAG SAS+LTSIL TT+EDL+ALGLCSAGG   V  
Sbjct  151  VKAAAILFEQEIREVVIETFGGLGVAGFSASILTSILPTTIEDLMALGLCSAGGFYGVWK  210

Query  397  FPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKL  218
             P RR +V  KV+RT +  AR++EEAMQ+DL + M   E  V  I KPY+ AA+ + + L
Sbjct  211  LPQRRLEVKNKVQRTANSFARQLEEAMQEDLEQAMRDAEHQVDLISKPYEHAAELKANHL  270

Query  217  LATADNLTDIESKLKTLQNEIQNLHVS  137
                  +  +E KL+ LQ ++QN   S
Sbjct  271  NGLLVEIKHVERKLQLLQFKVQNFRAS  297



>gb|EEE63597.1| hypothetical protein OsJ_18414 [Oryza sativa Japonica Group]
Length=922

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 122/178 (69%), Gaps = 0/178 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WL S    E   Y D F +RW +LV  E++I  + ++L+  + +L  + +  FS  
Sbjct  722  EYSTWLSSTNVREANIYVDCFHERWGALVAQEQRIPPEKNELVNEEEKLCVKALDGFSAS  781

Query  571  AASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsaggllAVSNFP  392
            AA+K+FE+EIRE   GTFGGLGVAGLSASLLTS+LT+TLEDLLAL LCSAGG  A+SNFP
Sbjct  782  AAAKVFEEEIREVAWGTFGGLGVAGLSASLLTSVLTSTLEDLLALALCSAGGFFAISNFP  841

Query  391  ARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKL  218
             RR+  V+K+ +  + L+ +++EA+Q+D+  +   L   V+ + KPYQ+A Q ++D L
Sbjct  842  TRRKLAVEKIGKAAEKLSSKVDEAIQQDISRSANQLVHFVETVSKPYQDACQQKIDWL  899



>gb|AAC72117.1| This gene may be cut off [Arabidopsis thaliana]
Length=160

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = -1

Query  388  RRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRLDKLLAT  209
            R + ++ KV +  D LA+++E+AMQKDL +  + L + V  + KPY+E AQ RLD+LL  
Sbjct  71   RWRAIIGKVNKVADALAQQLEDAMQKDLSDATSNLVNFVNIVAKPYREEAQLRLDRLLGI  130

Query  208  ADNLTDIESKLKTLQNEIQNLHVS  137
               L+DI SKL+ LQ +I NLHVS
Sbjct  131  QKELSDIRSKLQLLQVDIDNLHVS  154



>gb|AFW77881.1| hypothetical protein ZEAMMB73_815508, partial [Zea mays]
Length=132

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 60/90 (67%), Gaps = 0/90 (0%)
 Frame = -1

Query  406  VSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAAQNRL  227
            +S+FP RR+  + K+ +  D L+R+++EA+QKD+ ++   L   V+ I KPYQEA Q ++
Sbjct  43   LSSFPGRRKHAIDKINKAADELSRKVDEAIQKDISQSANNLIRFVEVISKPYQEACQRKI  102

Query  226  DKLLATADNLTDIESKLKTLQNEIQNLHVS  137
            D L      L+ +E KL+TL+ EIQNL+ S
Sbjct  103  DWLQGVQGELSAVERKLQTLKVEIQNLNGS  132



>ref|XP_009796267.1| PREDICTED: uncharacterized protein LOC104242852 isoform X2 [Nicotiana 
sylvestris]
Length=825

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+ SF+K+W S V+   Q++ D   +L RK E+S RV+ DFS  
Sbjct  717  EYTKWLQSKRDQEGQFYKQSFEKKWTSFVNPSDQVELDAIGVLERKSEVSRRVIEDFSAA  776

Query  571  AASKLFEQEIREAFLG  524
            AASKLFE+EIRE   G
Sbjct  777  AASKLFEREIREVVFG  792



>ref|XP_001774726.1| predicted protein [Physcomitrella patens]
 gb|EDQ60397.1| predicted protein [Physcomitrella patens]
Length=823

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 84/212 (40%), Positives = 128/212 (60%), Gaps = 11/212 (5%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLL---GRKYEL-------S  602
            E+  W++SN++ +   YR     RWP     E    AD+  L+    R  EL       S
Sbjct  611  EHKDWIESNSNRQLSSYRSLIMSRWPQ-AKEEYGSSADSLPLVELRNRDTELMAEQNNSS  669

Query  601  SRVMADFSPMAASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsa  422
              V+ DF   AA+ L EQE +E    TF G+GVAG+SAS+LTSIL TTLEDL+ALG+CSA
Sbjct  670  LTVLKDFDTNAAAILLEQECKEVVFSTFSGVGVAGISASVLTSILPTTLEDLIALGVCSA  729

Query  421  ggllAVSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEA  242
            GGL+ V N P++R+   KKV+R  D  A++IEEAM+ DL +++  +    + +  PY+ A
Sbjct  730  GGLVGVWNLPSQREAAKKKVRRVADSFAKQIEEAMKDDLQKSIDAVRAEFQTLAAPYRNA  789

Query  241  AQNRLDKLLATADNLTDIESKLKTLQNEIQNL  146
            A+ +L ++    + L  ++++LK L+  +Q++
Sbjct  790  AEEKLRRVKILQEELLKLDTELKRLRQSVQSI  821



>ref|XP_006349669.1| PREDICTED: uncharacterized protein LOC102584745 isoform X2 [Solanum 
tuberosum]
Length=802

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            EY  WLQS  D E  FY+  F+KRW SLV+   QI+  T+ +L RK E++  V+ DFS  
Sbjct  715  EYTKWLQSKRDQEVQFYKQCFEKRWTSLVNPSDQIELGTTGVLDRKSEVTISVIEDFSAA  774

Query  571  AASKLFEQEIR  539
            AASKL E++IR
Sbjct  775  AASKLLERDIR  785



>ref|XP_009401044.1| PREDICTED: uncharacterized protein LOC103985144 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=833

 Score = 72.0 bits (175),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WL+S    E   Y + F+KRWP+ VD E+++  +T   L    + S +V+ +FS  
Sbjct  722  DYSMWLESRNSDEANLYMECFEKRWPASVDYERKVYLETCASLDTSEDFSMKVLENFSSA  781

Query  571  AASKLFEQEIREAFLGTF  518
            AA++LFEQEIRE  +GTF
Sbjct  782  AAARLFEQEIREVVVGTF  799



>ref|XP_001780842.1| predicted protein [Physcomitrella patens]
 gb|EDQ54321.1| predicted protein [Physcomitrella patens]
Length=839

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 80/213 (38%), Positives = 126/213 (59%), Gaps = 9/213 (4%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLV-DAEKQIQADT--------SKLLGRKYELSS  599
            EY  W++SN+  +   YR     RWP +  D++  +++          SK +  +   S 
Sbjct  627  EYKEWMESNSIRQLSSYRSLIISRWPQVKEDSQHNVESSPVVDLRNRDSKHMAEQSSRSL  686

Query  598  RVMADFSPMAASKLFEQEIREAFLGTFgglgvaglsaslltsiltttledllalglcsag  419
              + DF   AA  L EQE +E  +  F G+G AG+SAS+LTSIL TTLEDL+ALG+CSAG
Sbjct  687  TTLMDFDTNAAIILLEQEFKEVVVSIFSGVGAAGISASVLTSILPTTLEDLIALGVCSAG  746

Query  418  gllAVSNFPARRQQVVKKVKRTGDGLAREIEEAMQKDLLETMAYLEDIVKFIGKPYQEAA  239
            GL+ V   P++R+ V KKV+R  D LAR+IEEAM+ DL +++  +   V+ +  PY  A 
Sbjct  747  GLVGVWKLPSQREVVKKKVRRVADSLARQIEEAMKDDLQKSIDAVRAEVETLTAPYLNAV  806

Query  238  QNRLDKLLATADNLTDIESKLKTLQNEIQNLHV  140
            + +L ++    +    ++S+LK L+  +Q++ +
Sbjct  807  EEKLRRVEILQEESQKLDSELKRLRQSVQSIGI  839



>gb|AAD25810.1|AC006550_18 F10O3.1, partial [Arabidopsis thaliana]
Length=823

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = -1

Query  751  EYMAWLQSNADSEEIFYRDSFQKRWPSLVDAEKQIQADTSKLLGRKYELSSRVMADFSPM  572
            +Y  WLQSN   E      SF+ +WP+ V+++ Q+  DT  LL +  ++S + + + S  
Sbjct  751  KYAEWLQSNTAREGSLSLKSFENKWPTYVNSKTQLGIDTYDLLQKTDKVSLKTIQNLSAG  810

Query  571  AASKLFEQEIREA  533
              SK  EQ+IRE 
Sbjct  811  TTSKRLEQDIREV  823



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840