BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032K14

Length=616
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006385204.1|  hypothetical protein POPTR_0003s011002g            158   2e-45   
dbj|BAF01745.1|  putative endomembrane protein EMP70 precusor isolog    154   8e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001140443.1|  uncharacterized protein LOC100272502               153   1e-43   
ref|NP_001182857.1|  uncharacterized protein LOC100501115 precursor     153   2e-42   
ref|XP_009600607.1|  PREDICTED: transmembrane 9 superfamily membe...    160   3e-42   Nicotiana tomentosiformis
gb|KJB79239.1|  hypothetical protein B456_013G038900                    159   3e-42   Gossypium raimondii
ref|XP_009796637.1|  PREDICTED: transmembrane 9 superfamily membe...    160   3e-42   Nicotiana sylvestris
ref|XP_008218557.1|  PREDICTED: transmembrane 9 superfamily member 3    159   4e-42   Prunus mume [ume]
gb|KJB12212.1|  hypothetical protein B456_002G006200                    159   4e-42   Gossypium raimondii
ref|XP_007221993.1|  hypothetical protein PRUPE_ppa003254mg             159   4e-42   Prunus persica
gb|EYU28222.1|  hypothetical protein MIMGU_mgv1a003468mg                159   4e-42   Erythranthe guttata [common monkey flower]
gb|KJB47459.1|  hypothetical protein B456_008G027700                    157   5e-42   Gossypium raimondii
ref|XP_008339497.1|  PREDICTED: transmembrane 9 superfamily membe...    159   5e-42   
ref|XP_009355251.1|  PREDICTED: transmembrane 9 superfamily membe...    159   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_009348753.1|  PREDICTED: transmembrane 9 superfamily membe...    159   5e-42   Pyrus x bretschneideri [bai li]
emb|CDO97576.1|  unnamed protein product                                159   5e-42   Coffea canephora [robusta coffee]
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             159   5e-42   Phaseolus vulgaris [French bean]
ref|XP_006431823.1|  hypothetical protein CICLE_v10000670mg             159   5e-42   Citrus clementina [clementine]
ref|XP_008378878.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    159   5e-42   Malus domestica [apple tree]
gb|KDP38816.1|  hypothetical protein JCGZ_04973                         159   6e-42   Jatropha curcas
ref|XP_006471014.1|  PREDICTED: transmembrane 9 superfamily membe...    159   6e-42   Citrus sinensis [apfelsine]
ref|XP_002530674.1|  endomembrane protein emp70, putative               159   6e-42   Ricinus communis
ref|XP_010030126.1|  PREDICTED: transmembrane 9 superfamily member 3    159   6e-42   Eucalyptus grandis [rose gum]
ref|XP_011096274.1|  PREDICTED: transmembrane 9 superfamily membe...    159   6e-42   Sesamum indicum [beniseed]
ref|XP_008456054.1|  PREDICTED: transmembrane 9 superfamily member 3    159   6e-42   Cucumis melo [Oriental melon]
emb|CDY20974.1|  BnaA08g25510D                                          159   7e-42   Brassica napus [oilseed rape]
emb|CDX94774.1|  BnaC07g17830D                                          159   7e-42   
ref|XP_004146261.1|  PREDICTED: transmembrane 9 superfamily membe...    159   7e-42   
gb|KGN57596.1|  hypothetical protein Csa_3G222780                       159   7e-42   Cucumis sativus [cucumbers]
gb|KJB79238.1|  hypothetical protein B456_013G038900                    159   7e-42   Gossypium raimondii
ref|XP_011464826.1|  PREDICTED: transmembrane 9 superfamily member 1    159   7e-42   Fragaria vesca subsp. vesca
gb|KFK43390.1|  hypothetical protein AALP_AA1G119800                    159   8e-42   Arabis alpina [alpine rockcress]
emb|CDY19333.1|  BnaC05g08420D                                          159   8e-42   Brassica napus [oilseed rape]
gb|AGE46034.1|  putative transmembrane 9 superfamily member 3 pro...    159   8e-42   Elaeis guineensis
ref|XP_009763454.1|  PREDICTED: transmembrane 9 superfamily membe...    159   9e-42   Nicotiana sylvestris
gb|KHG21692.1|  Transmembrane 9 superfamily member 3                    159   9e-42   Gossypium arboreum [tree cotton]
gb|KJB77692.1|  hypothetical protein B456_012G151500                    159   9e-42   Gossypium raimondii
ref|XP_009148436.1|  PREDICTED: transmembrane 9 superfamily membe...    159   9e-42   Brassica rapa
emb|CDY34861.1|  BnaA09g47870D                                          159   9e-42   Brassica napus [oilseed rape]
emb|CDY20592.1|  BnaC08g14660D                                          159   9e-42   Brassica napus [oilseed rape]
emb|CDX97924.1|  BnaA06g06750D                                          159   9e-42   
ref|XP_006417401.1|  hypothetical protein EUTSA_v10007167mg             159   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_007042269.1|  Transmembrane nine 1                               159   1e-41   
emb|CDY34667.1|  BnaC08g42260D                                          159   1e-41   Brassica napus [oilseed rape]
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    158   1e-41   Glycine soja [wild soybean]
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    158   1e-41   Glycine soja [wild soybean]
ref|XP_009144405.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-41   Brassica rapa
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-41   Glycine max [soybeans]
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-41   Glycine max [soybeans]
gb|AAL07091.2|  putative endomembrane protein EMP70 precusor isolog     157   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB79240.1|  hypothetical protein B456_013G038900                    158   1e-41   Gossypium raimondii
emb|CAN77106.1|  hypothetical protein VITISV_037096                     158   1e-41   Vitis vinifera
ref|XP_011028284.1|  PREDICTED: transmembrane 9 superfamily member 1    158   1e-41   Populus euphratica
ref|XP_008783371.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-41   Phoenix dactylifera
ref|XP_010910845.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-41   Elaeis guineensis
ref|XP_010682931.1|  PREDICTED: transmembrane 9 superfamily member 1    158   1e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009615816.1|  PREDICTED: transmembrane 9 superfamily membe...    147   2e-41   
ref|XP_010665394.1|  PREDICTED: transmembrane 9 superfamily member 1    159   2e-41   
gb|KJB47458.1|  hypothetical protein B456_008G027700                    158   2e-41   Gossypium raimondii
gb|KHG27380.1|  Tm9sf3                                                  158   2e-41   Gossypium arboreum [tree cotton]
ref|XP_006384984.1|  endomembrane protein 70                            157   2e-41   
ref|XP_009602812.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Nicotiana tomentosiformis
ref|XP_008667101.1|  PREDICTED: uncharacterized protein LOC100192...    157   2e-41   
ref|NP_563881.1|  transmembrane nine 1                                  157   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006304923.1|  hypothetical protein CARUB_v10011995mg             157   2e-41   Capsella rubella
ref|XP_004248848.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Solanum lycopersicum
ref|XP_010458475.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010492178.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Camelina sativa [gold-of-pleasure]
gb|ACG29787.1|  transmembrane 9 superfamily protein member 3 prec...    157   2e-41   Zea mays [maize]
ref|XP_009390071.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002889842.1|  hypothetical protein ARALYDRAFT_471233             157   2e-41   Arabidopsis lyrata subsp. lyrata
gb|AAB65482.1|  endomembrane protein EMP70 precusor isolog; 68664...    157   2e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912523.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   
ref|XP_010272575.1|  PREDICTED: transmembrane 9 superfamily membe...    156   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010475983.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010912522.1|  PREDICTED: transmembrane 9 superfamily membe...    157   2e-41   Elaeis guineensis
gb|EYU22789.1|  hypothetical protein MIMGU_mgv1a003460mg                157   3e-41   Erythranthe guttata [common monkey flower]
ref|XP_002449107.1|  hypothetical protein SORBIDRAFT_05g005240          157   3e-41   Sorghum bicolor [broomcorn]
ref|XP_009776073.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Nicotiana sylvestris
ref|XP_010553598.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_006339920.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Solanum tuberosum [potatoes]
ref|XP_006662781.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   
ref|XP_001785033.1|  predicted protein                                  153   3e-41   
ref|XP_011009384.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Populus euphratica
ref|XP_006367366.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Solanum tuberosum [potatoes]
ref|NP_001065897.1|  Os11g0181100                                       157   3e-41   
ref|XP_004978867.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-41   Setaria italica
dbj|BAJ86318.1|  predicted protein                                      157   3e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ96423.1|  predicted protein                                      157   4e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS58779.1|  Transmembrane 9 superfamily member 3                    157   4e-41   Triticum urartu
ref|XP_004250432.1|  PREDICTED: transmembrane 9 superfamily member 3    157   4e-41   Solanum lycopersicum
gb|AFX67030.1|  endomembrane protein emp70                              153   4e-41   Solanum tuberosum [potatoes]
ref|XP_003577775.1|  PREDICTED: transmembrane 9 superfamily member 3    157   4e-41   Brachypodium distachyon [annual false brome]
ref|XP_006392091.1|  hypothetical protein EUTSA_v10023368mg             155   5e-41   
ref|XP_010238659.1|  PREDICTED: transmembrane 9 superfamily membe...    156   5e-41   Brachypodium distachyon [annual false brome]
ref|XP_008781558.1|  PREDICTED: transmembrane 9 superfamily membe...    156   5e-41   Phoenix dactylifera
emb|CDY54577.1|  BnaCnng27330D                                          156   5e-41   Brassica napus [oilseed rape]
ref|XP_002269498.1|  PREDICTED: transmembrane 9 superfamily member 1    156   6e-41   Vitis vinifera
emb|CDY33319.1|  BnaAnng04300D                                          156   6e-41   Brassica napus [oilseed rape]
ref|XP_010930775.1|  PREDICTED: transmembrane 9 superfamily member 1    156   7e-41   Elaeis guineensis
emb|CDY46193.1|  BnaA01g23150D                                          156   7e-41   Brassica napus [oilseed rape]
ref|XP_006392092.1|  hypothetical protein EUTSA_v10023368mg             156   7e-41   Eutrema salsugineum [saltwater cress]
ref|XP_003531298.1|  PREDICTED: transmembrane 9 superfamily membe...    156   7e-41   Glycine max [soybeans]
ref|XP_008781557.1|  PREDICTED: transmembrane 9 superfamily membe...    156   8e-41   
ref|XP_006585219.1|  PREDICTED: transmembrane 9 superfamily membe...    156   8e-41   Glycine max [soybeans]
emb|CDY03772.1|  BnaC01g28890D                                          156   8e-41   
emb|CDY44834.1|  BnaCnng11900D                                          155   8e-41   Brassica napus [oilseed rape]
dbj|BAJ87519.1|  predicted protein                                      156   8e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003524235.1|  PREDICTED: transmembrane 9 superfamily membe...    156   8e-41   Glycine max [soybeans]
ref|XP_010246919.1|  PREDICTED: transmembrane 9 superfamily member 3    156   8e-41   Nelumbo nucifera [Indian lotus]
ref|XP_009390763.1|  PREDICTED: transmembrane 9 superfamily membe...    156   8e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006580221.1|  PREDICTED: transmembrane 9 superfamily membe...    156   9e-41   Glycine max [soybeans]
ref|XP_009104187.1|  PREDICTED: transmembrane 9 superfamily membe...    156   9e-41   Brassica rapa
emb|CDY12876.1|  BnaA09g13980D                                          155   9e-41   Brassica napus [oilseed rape]
gb|KFK40744.1|  hypothetical protein AALP_AA2G035500                    155   9e-41   Arabis alpina [alpine rockcress]
ref|XP_007159578.1|  hypothetical protein PHAVU_002G249200g             155   1e-40   Phaseolus vulgaris [French bean]
ref|XP_009124655.1|  PREDICTED: transmembrane 9 superfamily membe...    156   1e-40   
ref|XP_010682854.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004504187.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-40   Cicer arietinum [garbanzo]
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         155   1e-40   Medicago truncatula
gb|EMT08384.1|  Transmembrane 9 superfamily member 3                    155   1e-40   
ref|XP_009113237.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    155   1e-40   
ref|XP_008807671.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-40   Phoenix dactylifera
emb|CDY54580.1|  BnaCnng27350D                                          155   1e-40   Brassica napus [oilseed rape]
ref|XP_006664390.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-40   Oryza brachyantha
ref|XP_004977232.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-40   Setaria italica
ref|NP_001066292.1|  Os12g0175700                                       155   2e-40   
ref|XP_006859169.1|  hypothetical protein AMTR_s00070p00145350          155   2e-40   Amborella trichopoda
ref|XP_008681382.1|  PREDICTED: uncharacterized protein LOC100272...    155   2e-40   Zea mays [maize]
ref|XP_009379854.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008681381.1|  PREDICTED: uncharacterized protein LOC100272...    155   2e-40   Zea mays [maize]
ref|NP_001047104.1|  Os02g0552000                                       154   2e-40   
ref|XP_010547447.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-40   Tarenaya hassleriana [spider flower]
ref|XP_006648727.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-40   
ref|XP_004952828.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-40   Setaria italica
ref|XP_002452255.1|  hypothetical protein SORBIDRAFT_04g022500          154   3e-40   Sorghum bicolor [broomcorn]
ref|XP_006349354.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-40   Solanum tuberosum [potatoes]
ref|XP_009404976.1|  PREDICTED: transmembrane 9 superfamily membe...    154   4e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008662281.1|  PREDICTED: uncharacterized protein LOC100501...    154   5e-40   
tpg|DAA55531.1|  TPA: hypothetical protein ZEAMMB73_446969              154   5e-40   
ref|XP_009404975.1|  PREDICTED: transmembrane 9 superfamily membe...    154   5e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004230474.1|  PREDICTED: transmembrane 9 superfamily membe...    154   6e-40   Solanum lycopersicum
ref|XP_002442907.1|  hypothetical protein SORBIDRAFT_08g004730          153   7e-40   Sorghum bicolor [broomcorn]
ref|XP_011092339.1|  PREDICTED: transmembrane 9 superfamily membe...    152   7e-40   
ref|NP_001146830.1|  uncharacterized protein LOC100280437               142   1e-39   
ref|XP_001785045.1|  predicted protein                                  152   1e-39   
ref|XP_011092338.1|  PREDICTED: transmembrane 9 superfamily membe...    152   2e-39   Sesamum indicum [beniseed]
gb|EPS65883.1|  hypothetical protein M569_08888                         152   2e-39   Genlisea aurea
ref|XP_002984084.1|  hypothetical protein SELMODRAFT_156331             150   9e-39   
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    150   1e-38   Cicer arietinum [garbanzo]
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    149   1e-38   Cicer arietinum [garbanzo]
ref|XP_003592977.1|  Transmembrane 9 superfamily protein member         148   2e-38   
ref|XP_010235535.1|  PREDICTED: transmembrane 9 superfamily membe...    149   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_003592976.1|  Transmembrane 9 superfamily protein member         149   3e-38   Medicago truncatula
ref|XP_002960054.1|  hypothetical protein SELMODRAFT_163520             145   8e-37   Selaginella moellendorffii
ref|XP_011074960.1|  PREDICTED: transmembrane 9 superfamily membe...    144   1e-36   Sesamum indicum [beniseed]
ref|XP_006356503.1|  PREDICTED: transmembrane 9 superfamily membe...    143   3e-36   Solanum tuberosum [potatoes]
ref|XP_010533958.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    143   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_004241844.1|  PREDICTED: transmembrane 9 superfamily membe...    142   4e-36   Solanum lycopersicum
ref|XP_009788011.1|  PREDICTED: transmembrane 9 superfamily membe...    139   5e-35   Nicotiana sylvestris
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              139   7e-35   Coccomyxa subellipsoidea C-169
ref|XP_007509634.1|  predicted protein                                  139   2e-34   Bathycoccus prasinos
ref|XP_009631163.1|  PREDICTED: transmembrane 9 superfamily membe...    136   6e-34   
ref|XP_009631162.1|  PREDICTED: transmembrane 9 superfamily membe...    135   1e-33   Nicotiana tomentosiformis
ref|XP_011395771.1|  Transmembrane 9 superfamily member 3               129   2e-31   Auxenochlorella protothecoides
ref|XP_005845268.1|  hypothetical protein CHLNCDRAFT_36511              127   1e-30   Chlorella variabilis
gb|KFO35950.1|  Phosphoinositide 3-kinase adapter protein 1             127   1e-29   Fukomys damarensis [Damara mole rat]
gb|KDD76545.1|  endomembrane protein 70                                 124   1e-29   Helicosporidium sp. ATCC 50920
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    122   7e-29   Acanthamoeba castellanii str. Neff
ref|XP_002945998.1|  hypothetical protein VOLCADRAFT_72231              122   1e-28   Volvox carteri f. nagariensis
gb|ETN57960.1|  hypothetical protein AND_010453                         124   2e-28   Anopheles darlingi [American malaria mosquito]
ref|XP_009511961.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-28   Phalacrocorax carbo [common cormorant]
gb|AAX96186.1|  Endomembrane protein 70                                 119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009976834.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-27   Tauraco erythrolophus
dbj|BAG60075.1|  unnamed protein product                                115   2e-27   Homo sapiens [man]
emb|CBN79799.1|  conserved unknown protein                              114   2e-27   Ectocarpus siliculosus
dbj|BAB55110.1|  unnamed protein product                                116   3e-27   Homo sapiens [man]
ref|XP_008057299.1|  PREDICTED: transmembrane 9 superfamily member 3    116   3e-27   Carlito syrichta
ref|XP_003061693.1|  predicted protein                                  118   3e-27   Micromonas pusilla CCMP1545
dbj|BAC11232.1|  unnamed protein product                                116   5e-27   Homo sapiens [man]
ref|XP_009951614.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-27   Leptosomus discolor
ref|XP_002509072.1|  predicted protein                                  117   5e-27   Micromonas commoda
ref|XP_009478867.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-27   Pelecanus crispus
ref|XP_006756739.1|  PREDICTED: transmembrane 9 superfamily member 3    115   6e-27   
ref|XP_008942019.1|  PREDICTED: transmembrane 9 superfamily member 3    116   6e-27   Merops nubicus
gb|KFU99061.1|  Transmembrane 9 superfamily member 3                    116   6e-27   Pterocles gutturalis
ref|XP_006263564.1|  PREDICTED: transmembrane 9 superfamily membe...    116   8e-27   
ref|XP_007615223.1|  PREDICTED: transmembrane 9 superfamily membe...    115   8e-27   
dbj|BAE91187.1|  unnamed protein product                                115   8e-27   Macaca fascicularis [crab eating macaque]
ref|XP_010101151.1|  Transmembrane 9 superfamily member 3               117   9e-27   
gb|AAQ89178.1|  PATY245                                                 115   9e-27   Homo sapiens [man]
gb|ELW49306.1|  Transmembrane 9 superfamily member 3                    116   9e-27   Tupaia chinensis
ref|XP_007441347.1|  PREDICTED: transmembrane 9 superfamily membe...    115   9e-27   
gb|EDL41854.1|  mCG2375, isoform CRA_a                                  115   1e-26   Mus musculus [mouse]
gb|AAH20959.2|  TM9SF3 protein                                          116   1e-26   Homo sapiens [man]
ref|XP_009916579.1|  PREDICTED: transmembrane 9 superfamily membe...    115   1e-26   Haliaeetus albicilla
ref|XP_008428274.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Poecilia reticulata
gb|AAH04799.2|  Tm9sf3 protein                                          115   1e-26   Mus musculus [mouse]
ref|XP_010018436.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   Nestor notabilis
ref|XP_007566966.1|  PREDICTED: transmembrane 9 superfamily member 3    116   1e-26   Poecilia formosa
ref|XP_006630785.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Lepisosteus oculatus
ref|XP_005795250.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Xiphophorus maculatus
ref|XP_007258750.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Astyanax mexicanus [blind cave fish]
ref|XP_010732838.1|  PREDICTED: transmembrane 9 superfamily member 3    116   1e-26   
ref|XP_008428273.1|  PREDICTED: transmembrane 9 superfamily membe...    116   1e-26   Poecilia reticulata
ref|XP_003441118.1|  PREDICTED: transmembrane 9 superfamily member 3    116   1e-26   Oreochromis niloticus
gb|ELK35693.1|  Transmembrane 9 superfamily member 3                    115   1e-26   Myotis davidii
ref|NP_998554.1|  transmembrane 9 superfamily member 3 precursor        116   1e-26   Danio rerio [leopard danio]
ref|XP_008948979.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    115   1e-26   Pan paniscus [bonobo]
ref|XP_004616433.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   Sorex araneus [Eurasian shrew]
ref|XP_008282853.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    116   1e-26   Stegastes partitus
ref|XP_003787418.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   
ref|XP_004680642.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   Condylura cristata
ref|XP_003255319.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   
ref|XP_005637634.1|  PREDICTED: transmembrane 9 superfamily membe...    115   1e-26   
ref|XP_006116276.1|  PREDICTED: transmembrane 9 superfamily member 3    115   1e-26   
ref|XP_005997314.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Latimeria chalumnae
ref|XP_004427950.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_006799085.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   Neolamprologus brichardi [lyretail cichlid]
ref|XP_003963762.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   Takifugu rubripes [tiger puffer]
ref|XP_011285801.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   
ref|XP_005735123.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   Pundamilia nyererei
ref|XP_008641953.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_005520596.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_009470788.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Nipponia nippon
gb|KFP32607.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Colius striatus
ref|XP_007187499.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Balaenoptera acutorostrata scammoni
ref|XP_004701094.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_006157459.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   
ref|XP_009669621.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Struthio camelus australis
ref|XP_005153929.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Melopsittacus undulatus
ref|XP_005025241.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
ref|XP_009705892.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Cariama cristata
ref|XP_009574595.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Fulmarus glacialis
ref|XP_008932762.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_007053441.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_005407641.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   
ref|XP_008142341.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_010779545.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010712722.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Meleagris gallopavo [common turkey]
gb|EMC79922.1|  Transmembrane 9 superfamily member 3                    115   2e-26   
ref|XP_004020122.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_007902753.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Callorhinchus milii [Australian ghost shark]
gb|KFP68674.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Cariama cristata
ref|XP_004559661.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   Maylandia zebra
ref|XP_009470713.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Nipponia nippon
ref|XP_010712721.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Meleagris gallopavo [common turkey]
ref|XP_005416571.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Geospiza fortis
ref|XP_008320400.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005984512.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004409540.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Odobenus rosmarus divergens
gb|ELR54176.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Bos mutus
ref|XP_010409948.1|  PREDICTED: transmembrane 9 superfamily membe...    116   2e-26   
ref|XP_009966566.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Tyto alba [Schleiereule]
ref|XP_004580070.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Ochotona princeps [southern American pika]
gb|EDL41855.1|  mCG2375, isoform CRA_b                                  115   2e-26   Mus musculus [mouse]
gb|ETE67718.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Ophiophagus hannah
gb|EPQ19715.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Myotis brandtii
ref|XP_004892237.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
gb|EHB07803.1|  Transmembrane 9 superfamily member 3                    115   2e-26   Heterocephalus glaber [naked mole rat]
ref|XP_421629.4|  PREDICTED: transmembrane 9 superfamily member 3       115   2e-26   
ref|XP_005481354.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_008684538.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Ursus maritimus [white bear]
ref|XP_002821075.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    116   2e-26   Pongo abelii [orang utan]
gb|EHH19260.1|  hypothetical protein EGK_19936                          115   2e-26   Macaca mulatta [rhesus macaque]
ref|XP_008830212.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Nannospalax galili
gb|AAF21983.1|  SM-11044 binding protein                                115   2e-26   Homo sapiens [man]
ref|XP_006014905.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Alligator sinensis
ref|XP_005312131.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Chrysemys picta bellii
ref|XP_010387883.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Rhinopithecus roxellana
ref|XP_004370030.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Trichechus manatus latirostris
ref|XP_007456252.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   Lipotes vexillifer [baiji]
ref|XP_007637675.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
ref|XP_006831254.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Chrysochloris asiatica
ref|XP_849773.1|  PREDICTED: transmembrane 9 superfamily member 3...    115   2e-26   Canis lupus familiaris [dogs]
ref|XP_007654581.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_004838634.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   Heterocephalus glaber [naked mole rat]
ref|XP_001101439.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   Macaca mulatta [rhesus macaque]
ref|NP_001135200.1|  Transmembrane 9 superfamily member 3 precursor     115   2e-26   Salmo salar
ref|XP_004457032.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_002936010.2|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_003399780.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
gb|KJB47460.1|  hypothetical protein B456_008G027700                    115   2e-26   
ref|XP_010969423.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
gb|AAF98159.1|AF269150_1  transmembrane protein TM9SF3                  115   2e-26   
ref|NP_064508.3|  transmembrane 9 superfamily member 3 precursor        115   2e-26   
ref|XP_007532693.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_010896390.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
emb|CDQ61092.1|  unnamed protein product                                116   2e-26   
ref|NP_579930.1|  transmembrane 9 superfamily member 3 precursor        115   2e-26   
ref|XP_004268440.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|NP_001180146.1|  transmembrane 9 superfamily member 3 precursor     115   2e-26   
ref|XP_008773120.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
ref|XP_004625742.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_005407639.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
ref|XP_007080322.1|  PREDICTED: transmembrane 9 superfamily member 3    116   2e-26   
ref|XP_005407638.1|  PREDICTED: transmembrane 9 superfamily membe...    115   2e-26   
ref|XP_003479606.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
ref|XP_005352330.1|  PREDICTED: transmembrane 9 superfamily member 3    115   2e-26   
gb|ERE79680.1|  transmembrane 9 superfamily member 3                    115   3e-26   
ref|XP_006090050.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
ref|XP_003223180.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
ref|XP_005407637.1|  PREDICTED: transmembrane 9 superfamily membe...    115   3e-26   
ref|XP_001662153.1|  AAEL012016-PA                                      115   3e-26   
ref|XP_003704134.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
ref|XP_005885527.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
ref|XP_005025240.1|  PREDICTED: transmembrane 9 superfamily membe...    115   3e-26   
ref|XP_005048681.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
ref|XP_004077569.1|  PREDICTED: transmembrane 9 superfamily member 3    115   3e-26   
gb|KJB47461.1|  hypothetical protein B456_008G027700                    115   3e-26   
gb|AAF67014.1|AF160213_1  endomembrane protein emp70 precursor is...    115   3e-26   
gb|AIC62213.1|  TM9SF3                                                  114   3e-26   
emb|CDQ58548.1|  unnamed protein product                                115   3e-26   
ref|XP_001656277.1|  AAEL012833-PA                                      115   3e-26   
dbj|BAD90204.1|  mKIAA4036 protein                                      115   4e-26   
ref|XP_006992484.1|  PREDICTED: transmembrane 9 superfamily member 3    115   4e-26   
ref|XP_011155183.1|  PREDICTED: transmembrane 9 superfamily member 3    115   4e-26   
ref|XP_003755285.1|  PREDICTED: transmembrane 9 superfamily member 3    115   4e-26   
ref|XP_001917123.3|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    115   4e-26   
ref|XP_011352435.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-26   
ref|XP_007478767.1|  PREDICTED: transmembrane 9 superfamily membe...    115   5e-26   
ref|XP_011056752.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-26   
ref|XP_007478768.1|  PREDICTED: transmembrane 9 superfamily membe...    115   5e-26   
ref|XP_011303436.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-26   
ref|XP_006610901.1|  PREDICTED: transmembrane 9 superfamily membe...    115   5e-26   
ref|XP_011259429.1|  PREDICTED: transmembrane 9 superfamily member 3    115   5e-26   
ref|XP_003698368.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    114   5e-26   
ref|XP_006572161.1|  PREDICTED: transmembrane 9 superfamily member 3    114   6e-26   
ref|XP_002193887.2|  PREDICTED: transmembrane 9 superfamily member 3    115   6e-26   
ref|XP_011163701.1|  PREDICTED: transmembrane 9 superfamily member 3    114   7e-26   
gb|KHG20579.1|  Tm9sf3                                                  114   7e-26   
gb|KFP89360.1|  Transmembrane 9 superfamily member 3                    113   7e-26   
ref|XP_009868517.1|  PREDICTED: transmembrane 9 superfamily member 3    113   8e-26   
dbj|BAA91362.1|  unnamed protein product                                113   8e-26   
gb|KHG20578.1|  Tm9sf3                                                  114   8e-26   
ref|XP_008520069.1|  PREDICTED: transmembrane 9 superfamily member 3    115   8e-26   
ref|XP_011203691.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-25   
ref|XP_008205311.1|  PREDICTED: transmembrane 9 superfamily membe...    113   1e-25   
ref|XP_008471864.1|  PREDICTED: transmembrane 9 superfamily membe...    112   1e-25   
ref|XP_011182989.1|  PREDICTED: transmembrane 9 superfamily member 3    114   1e-25   
ref|XP_001604363.1|  PREDICTED: transmembrane 9 superfamily membe...    113   1e-25   
ref|XP_011499824.1|  PREDICTED: transmembrane 9 superfamily member 3    113   2e-25   
ref|XP_008555159.1|  PREDICTED: transmembrane 9 superfamily member 3    113   2e-25   
dbj|BAD12191.1|  SM-11044 binding protein                               111   2e-25   
ref|XP_004347030.2|  transmembrane protein TM9SF3                       113   2e-25   
ref|XP_004932208.1|  PREDICTED: transmembrane 9 superfamily membe...    112   3e-25   
ref|XP_008502202.1|  PREDICTED: transmembrane 9 superfamily member 3    112   3e-25   
ref|XP_009895972.1|  PREDICTED: transmembrane 9 superfamily member 3    112   3e-25   
ref|XP_001353740.2|  GA10420                                            112   4e-25   
ref|XP_002025369.1|  GL11985                                            112   4e-25   
ref|XP_001630700.1|  predicted protein                                  112   5e-25   
gb|EPS62158.1|  hypothetical protein M569_12635                         111   6e-25   
ref|XP_004526831.1|  PREDICTED: transmembrane 9 superfamily membe...    111   7e-25   
ref|XP_008868877.1|  hypothetical protein H310_05822                    112   7e-25   
ref|XP_001698971.1|  EMP/nonaspanin domain family protein               111   7e-25   
ref|XP_005186343.1|  PREDICTED: transmembrane 9 superfamily member 3    111   8e-25   
gb|EFX85753.1|  hypothetical protein DAPPUDRAFT_313523                  111   8e-25   
gb|KJB77693.1|  hypothetical protein B456_012G151500                    111   1e-24   
gb|EHJ69950.1|  putative endomembrane protein emp70                     110   1e-24   
ref|XP_004622652.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-24   
ref|XP_011431162.1|  PREDICTED: transmembrane 9 superfamily membe...    110   2e-24   
ref|XP_002047393.1|  GJ11952                                            110   2e-24   
ref|XP_002035457.1|  GM13907                                            110   2e-24   
ref|XP_002093812.1|  GE20545                                            110   2e-24   
ref|NP_647979.1|  CG10590                                               110   2e-24   
gb|ETK76717.1|  hypothetical protein, variant 2                         110   2e-24   
gb|KFM73388.1|  Transmembrane 9 superfamily member 3                    110   2e-24   
ref|XP_008895868.1|  hypothetical protein, variant 2                    110   2e-24   
ref|XP_009064505.1|  hypothetical protein LOTGIDRAFT_196341             110   2e-24   
ref|XP_008895867.1|  hypothetical protein PPTG_03848                    110   2e-24   
gb|ETK76715.1|  hypothetical protein L915_16929                         110   2e-24   
ref|XP_002903970.1|  endomembrane protein 70-like protein, putative     110   3e-24   
ref|XP_002062013.1|  GK16877                                            110   3e-24   
gb|ETI36485.1|  hypothetical protein, variant 1                         110   3e-24   
ref|XP_001957525.1|  GF10453                                            110   3e-24   
ref|XP_001984443.1|  GH15015                                            110   3e-24   
ref|XP_009524748.1|  hypothetical protein PHYSODRAFT_299515             110   3e-24   
gb|ETI36484.1|  hypothetical protein F443_17408                         110   3e-24   
ref|XP_003737486.1|  PREDICTED: uncharacterized protein LOC100897570    110   4e-24   
ref|XP_005092501.1|  PREDICTED: transmembrane 9 superfamily membe...    109   5e-24   
gb|EKC24508.1|  Transmembrane 9 superfamily member 3                    110   5e-24   
ref|XP_002115408.1|  hypothetical protein TRIADDRAFT_29152              108   7e-24   
ref|XP_002596465.1|  hypothetical protein BRAFLDRAFT_286243             108   7e-24   
ref|XP_001972005.1|  GG14121                                            108   9e-24   
ref|XP_002426886.1|  conserved hypothetical protein                     108   1e-23   
ref|XP_004225719.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    108   1e-23   
gb|EEZ99577.1|  hypothetical protein TcasGA2_TC001563                   108   1e-23   
ref|XP_967117.1|  PREDICTED: transmembrane 9 superfamily member 3       108   1e-23   
gb|ELU00390.1|  hypothetical protein CAPTEDRAFT_170344                  108   1e-23   
ref|XP_002007870.1|  GI13177                                            108   1e-23   
ref|XP_009009848.1|  hypothetical protein HELRODRAFT_184872             107   2e-23   
ref|XP_008614772.1|  hypothetical protein SDRG_10554                    107   2e-23   
ref|XP_009827098.1|  hypothetical protein, variant                      107   2e-23   
ref|XP_005836386.1|  hypothetical protein GUITHDRAFT_67884              107   2e-23   
gb|KDO15767.1|  hypothetical protein SPRG_18692                         105   6e-23   
gb|ENN73181.1|  hypothetical protein YQE_10235                          106   7e-23   
gb|AEE63341.1|  unknown                                                 105   7e-23   
gb|EWM22128.1|  transmembrane 9 superfamily member 3                    105   9e-23   
emb|CDY14555.1|  BnaC03g49040D                                          104   9e-23   
ref|XP_002156433.1|  PREDICTED: transmembrane 9 superfamily membe...    105   1e-22   
ref|XP_785201.2|  PREDICTED: transmembrane 9 superfamily member 3       105   1e-22   
ref|XP_002412937.1|  endosomal membrane protein EMP70, putative         105   1e-22   
gb|KDR11018.1|  hypothetical protein L798_14383                         105   1e-22   
emb|CDW55076.1|  Transmembrane 9 superfamily                            105   2e-22   
ref|XP_006819376.1|  PREDICTED: transmembrane 9 superfamily membe...    103   3e-22   
gb|KDO27371.1|  hypothetical protein SPRG_06957                         103   4e-22   
ref|XP_004990450.1|  endomembrane protein emp70                         103   5e-22   
gb|EUB64714.1|  Transmembrane 9 superfamily member                      103   1e-21   
emb|CCI39563.1|  unnamed protein product                                102   1e-21   
dbj|GAA29282.2|  transmembrane 9 superfamily member 3                   102   2e-21   
emb|CCA19624.1|  endomembrane protein 70like protein putative           102   2e-21   
emb|CCI39562.1|  unnamed protein product                                102   2e-21   
ref|XP_005768973.1|  hypothetical protein EMIHUDRAFT_60571            95.9    3e-21   
ref|XP_009173090.1|  hypothetical protein T265_08898                    101   4e-21   
emb|CDS34226.1|  Transmembrane 9 superfamily                            100   6e-21   
ref|XP_001746206.1|  hypothetical protein                               100   1e-20   
emb|CEJ05344.1|  hypothetical protein RMCBS344292_19287               97.4    1e-20   
gb|ADE75730.1|  unknown                                               91.3    2e-20   
emb|CEJ03838.1|  hypothetical protein RMCBS344292_17813               96.3    3e-20   
emb|CEG68095.1|  hypothetical protein RMATCC62417_04417               96.3    3e-20   
gb|EYB86903.1|  hypothetical protein Y032_0271g885                    95.9    4e-20   
gb|KHN75714.1|  Transmembrane 9 superfamily member 3                  98.2    4e-20   
gb|EYB86904.1|  hypothetical protein Y032_0271g885                    95.9    5e-20   
gb|EYB86905.1|  hypothetical protein Y032_0271g885                    95.9    5e-20   
gb|ERG85277.1|  transmembrane 9 superfamily member 3                  97.8    5e-20   
emb|CDS07558.1|  hypothetical protein LRAMOSA01507                    97.4    6e-20   
ref|XP_002083749.1|  GD13184                                          97.1    1e-19   
emb|CEG80626.1|  hypothetical protein RMATCC62417_14930               96.3    2e-19   
emb|CDH93341.1|  Y41D4A.4, isoform c                                  95.9    2e-19   
emb|CDH93340.1|  Y41D4A.4, isoform b                                  95.5    3e-19   
ref|NP_500130.1|  Protein Y41D4A.4                                    95.5    3e-19   
gb|EGT53827.1|  hypothetical protein CAEBREN_03110                    95.5    4e-19   
gb|EJW85205.1|  endomembrane protein emp70                            95.1    5e-19   
emb|CDQ00788.1|  Protein Bm6514, isoform c                            95.1    5e-19   
ref|XP_002634585.1|  Hypothetical protein CBG08396                    94.4    9e-19   
ref|XP_003094144.1|  hypothetical protein CRE_13729                   94.4    1e-18   
ref|XP_002679262.1|  predicted protein                                92.4    1e-18   
gb|EPB84661.1|  hypothetical protein HMPREF1544_08604                 93.2    2e-18   
gb|KFU99734.1|  Transmembrane 9 superfamily member 3                  87.8    2e-18   
emb|CEP16327.1|  hypothetical protein                                 92.4    4e-18   
ref|XP_003143038.1|  endomembrane protein emp70                       92.0    5e-18   
emb|CDS23908.1|  Transmembrane 9 superfamily                          91.7    6e-18   
emb|CDI96724.1|  Transmembrane 9 superfamily                          91.7    6e-18   
gb|EEE57172.1|  hypothetical protein OsJ_07106                        87.8    8e-18   
ref|XP_002290902.1|  endomembrane protein EMP70 precusor              91.7    9e-18   
gb|EIE90684.1|  hypothetical protein RO3G_15395                       90.5    2e-17   
gb|KFP99383.1|  Transmembrane 9 superfamily member 3                  88.6    2e-17   
ref|XP_002178644.1|  predicted protein                                90.1    3e-17   
gb|KFQ32916.1|  Transmembrane 9 superfamily member 3                  88.2    4e-17   
gb|KFV52836.1|  Transmembrane 9 superfamily member 3                  88.6    6e-17   
ref|XP_007122871.1|  PREDICTED: transmembrane 9 superfamily membe...  87.0    6e-17   
ref|XP_001950058.1|  PREDICTED: transmembrane 9 superfamily member 3  89.0    6e-17   
gb|ERE79681.1|  transmembrane 9 superfamily member 3                  88.6    6e-17   
dbj|BAE27875.1|  unnamed protein product                              88.6    6e-17   
gb|KFQ54713.1|  Transmembrane 9 superfamily member 3                  88.2    6e-17   
gb|KFZ51498.1|  Transmembrane 9 superfamily member 3                  88.2    6e-17   
gb|KFO54227.1|  Transmembrane 9 superfamily member 3                  88.2    6e-17   
gb|EFB24098.1|  hypothetical protein PANDA_005202                     88.2    7e-17   
gb|KFP38896.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFV91617.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFV79427.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFO94520.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFM06419.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|EMP41799.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFQ90694.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|KFW76816.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
gb|EOA97287.1|  Transmembrane 9 superfamily member 3                  88.2    7e-17   
ref|XP_314301.3|  AGAP004882-PA                                       87.8    9e-17   
ref|XP_006749965.1|  PREDICTED: transmembrane 9 superfamily member 3  86.3    2e-16   
gb|KFH64844.1|  hypothetical protein MVEG_09573                       87.4    2e-16   
ref|XP_004320666.1|  PREDICTED: transmembrane 9 superfamily member 3  86.3    3e-16   
emb|CBK19843.2|  unnamed protein product                              86.3    5e-16   
gb|KFV65167.1|  Transmembrane 9 superfamily member 3                  84.3    1e-15   
ref|XP_006679870.1|  hypothetical protein BATDEDRAFT_25752            84.3    1e-15   
gb|KHJ41501.1|  endomembrane protein 70                               84.7    2e-15   
ref|XP_001963658.1|  GF20175                                          79.7    3e-15   
dbj|GAD95703.1|  multispanning membrane protein                       84.7    3e-15   
emb|CBY17963.1|  unnamed protein product                              83.6    4e-15   
gb|KFD51698.1|  hypothetical protein M513_07394                       82.4    1e-14   
ref|XP_002784348.1|  conserved hypothetical protein                   82.0    1e-14   
gb|ACF74283.1|  putative endosomal protein                            75.1    5e-14   
ref|XP_011399711.1|  Putative phagocytic receptor 1b                  80.1    6e-14   
dbj|BAD94118.1|  putative endosomal protein                           75.5    8e-14   
gb|KFP08579.1|  Transmembrane 9 superfamily member 3                  77.4    1e-13   
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...  78.6    2e-13   
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...  78.6    2e-13   
emb|CEF59928.1|  Nonaspanin (TM9SF) family-containing protein         76.6    2e-13   
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...  78.6    2e-13   
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...  78.6    2e-13   
gb|KJB15314.1|  hypothetical protein B456_002G170500                  75.5    3e-13   
gb|KJB15315.1|  hypothetical protein B456_002G170500                  75.5    4e-13   
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like  77.8    4e-13   
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like  77.4    4e-13   
emb|CBK24710.2|  unnamed protein product                              76.6    4e-13   
gb|KHN28892.1|  Putative phagocytic receptor 1b                       77.4    4e-13   
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g           77.4    5e-13   
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like  77.4    5e-13   
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg           77.4    5e-13   
dbj|BAH20237.1|  AT2G01970                                            75.5    5e-13   
gb|AAF79217.1|AC006917_2  F10B6.3                                     75.9    5e-13   



>ref|XP_006385204.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
 gb|ERP63001.1| hypothetical protein POPTR_0003s011002g, partial [Populus trichocarpa]
Length=113

 Score =   158 bits (399),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  1    VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  60

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +YVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  61   FYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  113



>dbj|BAF01745.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=136

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  24   VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  83

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  84   YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  136



>ref|NP_001140443.1| uncharacterized protein LOC100272502 [Zea mays]
 gb|ACF83850.1| unknown [Zea mays]
Length=125

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  13   VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  72

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  73   YHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  125



>ref|NP_001182857.1| uncharacterized protein LOC100501115 precursor [Zea mays]
 gb|ACR34922.1| unknown [Zea mays]
Length=195

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  83   VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYY  142

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  143  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  195



>ref|XP_009600607.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>gb|KJB79239.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=461

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  349  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  408

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  409  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461



>ref|XP_009796637.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_008218557.1| PREDICTED: transmembrane 9 superfamily member 3 [Prunus mume]
Length=589

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YHAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>gb|KJB12212.1| hypothetical protein B456_002G006200 [Gossypium raimondii]
Length=592

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+YY
Sbjct  480  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVYY  539

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+GFLGSNLFVRRIYRNIKCD
Sbjct  540  YSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGFLGSNLFVRRIYRNIKCD  592



>ref|XP_007221993.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
 gb|EMJ23192.1| hypothetical protein PRUPE_ppa003254mg [Prunus persica]
Length=589

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>gb|EYU28222.1| hypothetical protein MIMGU_mgv1a003468mg [Erythranthe guttata]
Length=583

 Score =   159 bits (403),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  471  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>gb|KJB47459.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=400

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+YY
Sbjct  288  VYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVYY  347

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  348  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  400



>ref|XP_008339497.1| PREDICTED: transmembrane 9 superfamily member 3-like [Malus domestica]
Length=589

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_009355251.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_009348753.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pyrus x 
bretschneideri]
Length=589

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>emb|CDO97576.1| unnamed protein product [Coffea canephora]
Length=587

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_007148532.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
 gb|ESW20526.1| hypothetical protein PHAVU_006G216500g [Phaseolus vulgaris]
Length=630

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  518  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  577

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  578  YFVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  630



>ref|XP_006431823.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
 gb|ESR45063.1| hypothetical protein CICLE_v10000670mg [Citrus clementina]
Length=587

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_008378878.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Malus domestica]
Length=589

 Score =   159 bits (402),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>gb|KDP38816.1| hypothetical protein JCGZ_04973 [Jatropha curcas]
Length=596

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  484  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  543

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  544  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  596



>ref|XP_006471014.1| PREDICTED: transmembrane 9 superfamily member 3-like [Citrus 
sinensis]
Length=587

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_002530674.1| endomembrane protein emp70, putative [Ricinus communis]
 gb|EEF31705.1| endomembrane protein emp70, putative [Ricinus communis]
Length=602

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 111/113 (98%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  490  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  549

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  550  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  602



>ref|XP_010030126.1| PREDICTED: transmembrane 9 superfamily member 3 [Eucalyptus grandis]
 gb|KCW57092.1| hypothetical protein EUGRSUZ_I02743 [Eucalyptus grandis]
Length=585

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  533  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585



>ref|XP_011096274.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=583

 Score =   159 bits (402),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  471  VYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_008456054.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis melo]
Length=632

 Score =   159 bits (403),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIYY
Sbjct  520  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIYY  579

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  580  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  632



>emb|CDY20974.1| BnaA08g25510D [Brassica napus]
Length=585

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>emb|CDX94774.1| BnaC07g17830D [Brassica napus]
Length=585

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_004146261.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
 ref|XP_004159874.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cucumis 
sativus]
Length=593

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIYY
Sbjct  481  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIYY  540

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  541  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593



>gb|KGN57596.1| hypothetical protein Csa_3G222780 [Cucumis sativus]
Length=664

 Score =   159 bits (403),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY YSIYY
Sbjct  552  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYFYSIYY  611

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  612  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  664



>gb|KJB79238.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=593

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  481  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  540

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  541  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  593



>ref|XP_011464826.1| PREDICTED: transmembrane 9 superfamily member 1 [Fragaria vesca 
subsp. vesca]
Length=598

 Score =   159 bits (402),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  486  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  545

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  546  YYAKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  598



>gb|KFK43390.1| hypothetical protein AALP_AA1G119800 [Arabis alpina]
Length=587

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDY19333.1| BnaC05g08420D [Brassica napus]
Length=587

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>gb|AGE46034.1| putative transmembrane 9 superfamily member 3 protein [Elaeis 
guineensis]
Length=586

 Score =   159 bits (401),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  474  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  586



>ref|XP_009763454.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=582

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYY
Sbjct  470  VYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYY  529

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>gb|KHG21692.1| Transmembrane 9 superfamily member 3 [Gossypium arboreum]
Length=587

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  475  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>gb|KJB77692.1| hypothetical protein B456_012G151500 [Gossypium raimondii]
Length=592

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYS+YY
Sbjct  480  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSVYY  539

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  540  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  592



>ref|XP_009148436.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=590

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>emb|CDY34861.1| BnaA09g47870D [Brassica napus]
Length=586

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  474  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586



>emb|CDY20592.1| BnaC08g14660D [Brassica napus]
Length=585

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>emb|CDX97924.1| BnaA06g06750D [Brassica napus]
Length=590

 Score =   159 bits (401),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_006417401.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
 gb|ESQ35754.1| hypothetical protein EUTSA_v10007167mg [Eutrema salsugineum]
Length=586

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  474  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  534  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  586



>ref|XP_007042269.1| Transmembrane nine 1 [Theobroma cacao]
 gb|EOX98100.1| Transmembrane nine 1 [Theobroma cacao]
Length=640

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  528  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  587

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  588  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  640



>emb|CDY34667.1| BnaC08g42260D [Brassica napus]
Length=665

 Score =   159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  553  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  612

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  613  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  665



>gb|KHN45466.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=584

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  472  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  531

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584



>gb|KHN11244.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=583

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  471  VYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_009144405.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=585

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  533  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  585



>ref|XP_003532994.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=585

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  473  VYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  533  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  585



>ref|XP_003540158.1| PREDICTED: transmembrane 9 superfamily member 3-like [Glycine 
max]
Length=584

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  472  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  531

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  532  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  584



>gb|AAL07091.2| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
Length=461

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  349  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  408

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  409  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  461



>gb|KJB79240.1| hypothetical protein B456_013G038900 [Gossypium raimondii]
Length=591

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  479  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  539  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  591



>emb|CAN77106.1| hypothetical protein VITISV_037096 [Vitis vinifera]
Length=600

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVY YSIYY
Sbjct  488  VYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAFYVYFYSIYY  547

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  548  YYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  600



>ref|XP_011028284.1| PREDICTED: transmembrane 9 superfamily member 1 [Populus euphratica]
Length=590

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  538  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  590



>ref|XP_008783371.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=586

 Score =   158 bits (400),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  474  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  534  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586



>ref|XP_010910845.1| PREDICTED: transmembrane 9 superfamily member 1-like [Elaeis 
guineensis]
Length=586

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  474  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  586



>ref|XP_010682931.1| PREDICTED: transmembrane 9 superfamily member 1 [Beta vulgaris 
subsp. vulgaris]
Length=590

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 113/113 (100%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  478  VYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKM+GFFQ+SFYFGYT+MFCLGLGILCGAVGFLGSNLFVRRIY+NIKCD
Sbjct  538  YHVKTKMTGFFQISFYFGYTMMFCLGLGILCGAVGFLGSNLFVRRIYKNIKCD  590



>ref|XP_009615816.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=106

 Score =   147 bits (372),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = -3

Query  497  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  318
            GTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYYY+VKTKMSGFFQ SFYFGYT+MFCL
Sbjct  19   GTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYYYHVKTKMSGFFQTSFYFGYTMMFCL  78

Query  317  GLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  79   GLGILCGAVGYLGSNLFVRRIYRNIKCD  106



>ref|XP_010665394.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI39323.3| unnamed protein product [Vitis vinifera]
Length=749

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVY YSIYY
Sbjct  637  VYYVYGFMLLVFMILMIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAFYVYFYSIYY  696

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY+KTKMSGFFQ SFYFGYTLM CLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  697  YYMKTKMSGFFQTSFYFGYTLMLCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  749



>gb|KJB47458.1| hypothetical protein B456_008G027700 [Gossypium raimondii]
Length=590

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YS+YY
Sbjct  478  VYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYMYSVYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  538  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  590



>gb|KHG27380.1| Tm9sf3 [Gossypium arboreum]
Length=614

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  502  VYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  561

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  562  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  614



>ref|XP_006384984.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP62781.1| endomembrane protein 70 [Populus trichocarpa]
Length=586

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  474  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  534  YSVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  586



>ref|XP_009602812.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
tomentosiformis]
Length=588

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_008667101.1| PREDICTED: uncharacterized protein LOC100192672 isoform X1 [Zea 
mays]
 tpg|DAA38952.1| TPA: transmembrane 9 family protein member 3 [Zea mays]
Length=586

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  474  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>ref|NP_563881.1| transmembrane nine 1 [Arabidopsis thaliana]
 sp|Q940G0.1|TMN1_ARATH RecName: Full=Transmembrane 9 superfamily member 1; AltName: 
Full=Endomembrane protein 12; AltName: Full=Transmembrane nine 
protein 1; Short=AtTMN1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL48237.1|AF446365_1 At1g10950/T19D16_13 [Arabidopsis thaliana]
 gb|AAK96857.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAL36263.1| putative endomembrane protein EMP70 precusor isolog [Arabidopsis 
thaliana]
 gb|AAM10098.1| endomembrane protein EMP70 precusor isolog [Arabidopsis thaliana]
 gb|AAP40425.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 gb|AEE28668.1| transmembrane nine 1 [Arabidopsis thaliana]
Length=589

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_006304923.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
 gb|EOA37821.1| hypothetical protein CARUB_v10011995mg [Capsella rubella]
Length=589

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_004248848.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFSSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_010458475.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=589

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_010492178.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Camelina sativa]
Length=589

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>gb|ACG29787.1| transmembrane 9 superfamily protein member 3 precursor [Zea mays]
Length=586

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  474  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>ref|XP_009390071.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=588

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  476  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  536  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_002889842.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66101.1| hypothetical protein ARALYDRAFT_471233 [Arabidopsis lyrata subsp. 
lyrata]
Length=588

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  476  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  588



>gb|AAB65482.1| endomembrane protein EMP70 precusor isolog; 68664-64364 [Arabidopsis 
thaliana]
Length=589

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  589



>ref|XP_010912523.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Elaeis 
guineensis]
Length=581

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  469  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  528

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  529  YNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  581



>ref|XP_010272575.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nelumbo 
nucifera]
Length=466

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  354  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIYY  413

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  414  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  466



>ref|XP_010475983.1| PREDICTED: transmembrane 9 superfamily member 3-like [Camelina 
sativa]
Length=587

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  587



>ref|XP_010912522.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  YNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587



>gb|EYU22789.1| hypothetical protein MIMGU_mgv1a003460mg [Erythranthe guttata]
Length=583

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST++YVYLYSIYY
Sbjct  471  VYYVYGFMLLVFVILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSLYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFC+GLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  531  YYVKTKMSGFFQTSFYFGYTLMFCMGLGILCGAVGYLGSNLFVRRIYRNIKCD  583



>ref|XP_002449107.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
 gb|EES08095.1| hypothetical protein SORBIDRAFT_05g005240 [Sorghum bicolor]
Length=590

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  478  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_009776073.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=588

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_010553598.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=592

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  480  VYYVYGFMLLVFLILVIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  539

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  540  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  592



>ref|XP_006339920.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFSSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  588



>ref|XP_006662781.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Oryza brachyantha]
Length=583

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  471  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  531  YHMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  583



>ref|XP_001785033.1| predicted protein [Physcomitrella patens]
 gb|EDQ50148.1| predicted protein, partial [Physcomitrella patens]
Length=325

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENYHWQWTSF SAASTA YVYLYS+YY
Sbjct  213  VYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENYHWQWTSFLSAASTAGYVYLYSVYY  272

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  273  FYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  325



>ref|XP_011009384.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
 ref|XP_011009385.1| PREDICTED: transmembrane 9 superfamily member 1-like [Populus 
euphratica]
Length=593

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  481  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  540

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIY+NIKCD
Sbjct  541  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYKNIKCD  593



>ref|XP_006367366.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=582

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHW+WTSFFSAASTA+YVYLY+IYY
Sbjct  470  VYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWRWTSFFSAASTALYVYLYAIYY  529

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>ref|NP_001065897.1| Os11g0181100 [Oryza sativa Japonica Group]
 gb|ABA91795.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91796.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27742.1| Os11g0181100 [Oryza sativa Japonica Group]
 dbj|BAG94676.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67792.1| hypothetical protein OsI_35351 [Oryza sativa Indica Group]
 gb|EEE51756.1| hypothetical protein OsJ_33190 [Oryza sativa Japonica Group]
Length=593

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  481  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  540

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  541  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  593



>ref|XP_004978867.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=586

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  474  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  586



>dbj|BAJ86318.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   157 bits (397),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYY
Sbjct  473  VYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  533  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>dbj|BAJ96423.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=585

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYY
Sbjct  473  VYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  533  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>gb|EMS58779.1| Transmembrane 9 superfamily member 3 [Triticum urartu]
Length=571

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYY
Sbjct  459  VYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYY  518

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  519  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  571



>ref|XP_004250432.1| PREDICTED: transmembrane 9 superfamily member 3 [Solanum lycopersicum]
Length=582

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVTVCVTIVGTYFLLNAENYHW+WTSFFSAASTA+YVYLY+IYY
Sbjct  470  VYYVYGFMLLVFIILIIVTVCVTIVGTYFLLNAENYHWRWTSFFSAASTALYVYLYAIYY  529

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  530  YHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  582



>gb|AFX67030.1| endomembrane protein emp70, partial [Solanum tuberosum]
Length=346

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+YY
Sbjct  234  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVYY  293

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  294  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  346



>ref|XP_003577775.1| PREDICTED: transmembrane 9 superfamily member 3 [Brachypodium 
distachyon]
Length=585

 Score =   157 bits (396),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLY+IYY
Sbjct  473  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYAIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  533  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  585



>ref|XP_006392091.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29377.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=471

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  359  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  418

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  419  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  471



>ref|XP_010238659.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=594

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  482  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  541

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  542  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_008781558.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Phoenix 
dactylifera]
Length=558

 Score =   156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  446  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  505

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  506  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  558



>emb|CDY54577.1| BnaCnng27330D [Brassica napus]
Length=513

 Score =   156 bits (394),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  401  VYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  460

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  461  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  513



>ref|XP_002269498.1| PREDICTED: transmembrane 9 superfamily member 1 [Vitis vinifera]
 emb|CBI29766.3| unnamed protein product [Vitis vinifera]
Length=592

 Score =   156 bits (395),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  480  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  539

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  540  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  592



>emb|CDY33319.1| BnaAnng04300D [Brassica napus]
Length=544

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  432  VYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  491

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  492  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  544



>ref|XP_010930775.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
 ref|XP_010930776.1| PREDICTED: transmembrane 9 superfamily member 1 [Elaeis guineensis]
Length=586

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  474  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  534  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  586



>emb|CDY46193.1| BnaA01g23150D [Brassica napus]
Length=575

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  463  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  522

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  523  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  575



>ref|XP_006392092.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
 gb|ESQ29378.1| hypothetical protein EUTSA_v10023368mg [Eutrema salsugineum]
Length=591

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  479  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591



>ref|XP_003531298.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN48095.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   156 bits (394),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  FYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_008781557.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Phoenix 
dactylifera]
Length=616

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  504  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  563

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  564  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  616



>ref|XP_006585219.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  FYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>emb|CDY03772.1| BnaC01g28890D [Brassica napus]
Length=594

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  482  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIYY  541

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  542  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594



>emb|CDY44834.1| BnaCnng11900D [Brassica napus]
Length=547

 Score =   155 bits (393),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  435  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  494

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  495  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  547



>dbj|BAJ87519.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  483  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  542

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  543  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  595



>ref|XP_003524235.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Glycine max]
 gb|KHN06492.1| Transmembrane 9 superfamily member 3 [Glycine soja]
Length=590

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  538  FYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  590



>ref|XP_010246919.1| PREDICTED: transmembrane 9 superfamily member 3 [Nelumbo nucifera]
Length=591

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  479  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  539  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591



>ref|XP_009390763.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=587

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYV+LYSIYY
Sbjct  475  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVFLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  535  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  587



>ref|XP_006580221.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Glycine max]
Length=587

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 110/113 (97%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  475  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +YVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  535  FYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  587



>ref|XP_009104187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=594

 Score =   156 bits (394),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  482  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  541

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  542  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  594



>emb|CDY12876.1| BnaA09g13980D [Brassica napus]
Length=564

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  452  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  511

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  512  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  564



>gb|KFK40744.1| hypothetical protein AALP_AA2G035500 [Arabis alpina]
Length=595

 Score =   155 bits (393),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVY+YSIYY
Sbjct  483  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYIYSIYY  542

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  543  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  595



>ref|XP_007159578.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
 gb|ESW31572.1| hypothetical protein PHAVU_002G249200g [Phaseolus vulgaris]
Length=589

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY+KTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YYMKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_009124655.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brassica 
rapa]
Length=627

 Score =   156 bits (394),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  515  VYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  574

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  575  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  627



>ref|XP_010682854.1| PREDICTED: transmembrane 9 superfamily member 1-like [Beta vulgaris 
subsp. vulgaris]
Length=595

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  483  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAIYVYLYSIYY  542

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  543  YHVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGYLGSKLFVRRIYRNIKCD  595



>ref|XP_004504187.1| PREDICTED: transmembrane 9 superfamily member 3-like [Cicer arietinum]
Length=591

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIYY
Sbjct  479  VYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  539  YYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  591



>ref|XP_003629959.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AET04435.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=589

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL IVTVCVTIVGTYFLLNAENYHWQWTSFFSAAST+VYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILTIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTSVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMF LGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMSGFFQTSFYFGYTLMFSLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>gb|EMT08384.1| Transmembrane 9 superfamily member 3 [Aegilops tauschii]
Length=552

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  440  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  499

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  500  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  552



>ref|XP_009113237.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3-like [Brassica rapa]
Length=570

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  458  VYYVYGFMLLVFLILVVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  517

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  518  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  570



>ref|XP_008807671.1| PREDICTED: transmembrane 9 superfamily member 3-like [Phoenix 
dactylifera]
Length=591

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  479  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS  FVRRIYRNIKCD
Sbjct  539  YNVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTFFVRRIYRNIKCD  591



>emb|CDY54580.1| BnaCnng27350D [Brassica napus]
Length=589

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL++VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  477  VYYVYGFMLLVFLILLVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD
Sbjct  537  YYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  589



>ref|XP_006664390.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=580

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  468  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTALYVYLYSIYY  527

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  528  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  580



>ref|XP_004977232.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=597

 Score =   155 bits (392),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  485  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  544

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G++GS LFVRRIYRNIKCD
Sbjct  545  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYVGSTLFVRRIYRNIKCD  597



>ref|NP_001066292.1| Os12g0175700 [Oryza sativa Japonica Group]
 gb|ABA96600.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29311.1| Os12g0175700 [Oryza sativa Japonica Group]
 dbj|BAG91282.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC68944.1| hypothetical protein OsI_37659 [Oryza sativa Indica Group]
 gb|EEE52854.1| hypothetical protein OsJ_35401 [Oryza sativa Japonica Group]
Length=598

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  486  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTALYVYLYSIYY  545

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  546  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  598



>ref|XP_006859169.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
 gb|ERN20636.1| hypothetical protein AMTR_s00070p00145350 [Amborella trichopoda]
Length=590

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/113 (96%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  478  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ  FYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  YYVKTKMSGFFQTGFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_008681382.1| PREDICTED: uncharacterized protein LOC100272502 isoform X2 [Zea 
mays]
Length=585

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_009379854.1| PREDICTED: transmembrane 9 superfamily member 3-like [Musa acuminata 
subsp. malaccensis]
Length=591

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSF SAASTAVYVYLYS+YY
Sbjct  479  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFLSAASTAVYVYLYSVYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS LFVRRIYRNIKCD
Sbjct  539  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTLFVRRIYRNIKCD  591



>ref|XP_008681381.1| PREDICTED: uncharacterized protein LOC100272502 isoform X1 [Zea 
mays]
Length=588

 Score =   155 bits (391),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  476  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  536  YHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588



>ref|NP_001047104.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAD15485.1| putative transmembrane protein TM9SF3 (66.6 kD) [Oryza sativa 
Japonica Group]
 dbj|BAF09018.1| Os02g0552000 [Oryza sativa Japonica Group]
 dbj|BAG90570.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93963.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC73381.1| hypothetical protein OsI_07622 [Oryza sativa Indica Group]
Length=590

 Score =   154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  478  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  538  YHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  590



>ref|XP_010547447.1| PREDICTED: transmembrane 9 superfamily member 3-like [Tarenaya 
hassleriana]
Length=591

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 112/113 (99%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVT+CVTIVG+YFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  479  VYYVYGFMLLVFLILVIVTICVTIVGSYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS+LF+RRIYRNIKCD
Sbjct  539  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSSLFIRRIYRNIKCD  591



>ref|XP_006648727.1| PREDICTED: transmembrane 9 superfamily member 3-like [Oryza brachyantha]
Length=568

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  456  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  515

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  516  YHVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  568



>ref|XP_004952828.1| PREDICTED: transmembrane 9 superfamily member 3-like [Setaria 
italica]
Length=585

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_002452255.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
 gb|EES05231.1| hypothetical protein SORBIDRAFT_04g022500 [Sorghum bicolor]
Length=585

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  473  VYYVYGFMLLVFLILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  533  YHMKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  585



>ref|XP_006349354.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=588

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/113 (96%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_009404976.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=588

 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  536  YYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  588



>ref|XP_008662281.1| PREDICTED: uncharacterized protein LOC100501115 isoform X1 [Zea 
mays]
 gb|AFW56219.1| hypothetical protein ZEAMMB73_922033 [Zea mays]
Length=596

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  484  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYY  543

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  544  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  596



>tpg|DAA55531.1| TPA: hypothetical protein ZEAMMB73_446969 [Zea mays]
Length=592

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  480  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYY  539

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  540  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  592



>ref|XP_009404975.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=635

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVT+CVTIVG YFLLNAENYHWQWTSFFSAASTAVYVYLYS+YY
Sbjct  523  VYYVYGFMLLVFLILIIVTMCVTIVGAYFLLNAENYHWQWTSFFSAASTAVYVYLYSVYY  582

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YY+KTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS +FVRRIYRNIKCD
Sbjct  583  YYMKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSTMFVRRIYRNIKCD  635



>ref|XP_004230474.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=588

 Score =   154 bits (388),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 107/113 (95%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSA STAVYVYLYS+YY
Sbjct  476  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAFSTAVYVYLYSVYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVGFLGS+LFVRRIYRNIKCD
Sbjct  536  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGFLGSHLFVRRIYRNIKCD  588



>ref|XP_002442907.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
 gb|EES16745.1| hypothetical protein SORBIDRAFT_08g004730 [Sorghum bicolor]
Length=594

 Score =   153 bits (387),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVT+CVTIVGTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYY
Sbjct  482  VYYVYGFMLLVFVILLIVTICVTIVGTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYY  541

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  542  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAIGYLGSTLFVRRIYRNIKCD  594



>ref|XP_011092339.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X2 [Sesamum 
indicum]
Length=460

 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENYHWQWTSFFSAASTAVYVY YSIYY
Sbjct  348  VYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENYHWQWTSFFSAASTAVYVYFYSIYY  407

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  408  YYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  460



>ref|NP_001146830.1| uncharacterized protein LOC100280437 [Zea mays]
 gb|ACL54836.1| unknown [Zea mays]
Length=106

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = -3

Query  497  GTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyyyVKTKMSGFFQVSFYFGYTLMFCL  318
            GTYFLLNAENYHWQWTSF SAASTA+YVYLYSIYYY+VKTKMSGFFQ SFYFGYTLMFCL
Sbjct  19   GTYFLLNAENYHWQWTSFSSAASTALYVYLYSIYYYHVKTKMSGFFQTSFYFGYTLMFCL  78

Query  317  GLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            GLGILCGA+G+LGS LFVRRIYRNIKCD
Sbjct  79   GLGILCGAIGYLGSTLFVRRIYRNIKCD  106



>ref|XP_001785045.1| predicted protein [Physcomitrella patens]
 gb|EDQ50160.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   152 bits (385),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL IVTVCVTIVGTYFLLNAENYHWQWTSF SAASTA YVYLYS+YY
Sbjct  478  VYYVYGFMLLVFIILTIVTVCVTIVGTYFLLNAENYHWQWTSFLSAASTAGYVYLYSVYY  537

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +Y+KTKMSGFFQ+SFYFGYTLMFCLGLGI CGAVG+LGS++FVRRIYRNIKCD
Sbjct  538  FYMKTKMSGFFQISFYFGYTLMFCLGLGIFCGAVGYLGSSMFVRRIYRNIKCD  590



>ref|XP_011092338.1| PREDICTED: transmembrane 9 superfamily member 1 isoform X1 [Sesamum 
indicum]
Length=588

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIV  YFLLNAENYHWQWTSFFSAASTAVYVY YSIYY
Sbjct  476  VYYVYGFMLLVFLILIIVTVCVTIVSIYFLLNAENYHWQWTSFFSAASTAVYVYFYSIYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSG FQ SFYFGYTLMFCLGLGILCGAVG+LGSN+FVRRIYRNIKCD
Sbjct  536  YYVKTKMSGLFQTSFYFGYTLMFCLGLGILCGAVGYLGSNMFVRRIYRNIKCD  588



>gb|EPS65883.1| hypothetical protein M569_08888, partial [Genlisea aurea]
Length=558

 Score =   152 bits (383),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILI+VTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA+YV  YS+YY
Sbjct  446  VYYVYGFMLLVFVILIVVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTALYVLFYSVYY  505

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGS+LFV+RIYRNIK D
Sbjct  506  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSDLFVKRIYRNIKLD  558



>ref|XP_002984084.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
 gb|EFJ15096.1| hypothetical protein SELMODRAFT_156331 [Selaginella moellendorffii]
Length=587

 Score =   150 bits (379),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+IL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVYLYS+YY
Sbjct  475  VYYVYGFMLLVFVILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAAYVYLYSVYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  535  YFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  587



>ref|XP_004485475.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Cicer arietinum]
Length=583

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIYY
Sbjct  471  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  531  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_004485474.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Cicer arietinum]
Length=583

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIYY
Sbjct  471  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT+MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  531  YYVKTKMSGFFQTSFYFGYTMMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_003592977.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=446

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIYY
Sbjct  334  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIYY  393

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  394  YYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  446



>ref|XP_010235535.1| PREDICTED: transmembrane 9 superfamily member 3-like [Brachypodium 
distachyon]
Length=588

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  476  VYYVYGFMLLVFLILLIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  535

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y VKTKMSGFFQ SFYFGYTLMFCLGLG LCGAVG+LGS LFVRRIYRNIKCD
Sbjct  536  YNVKTKMSGFFQTSFYFGYTLMFCLGLGTLCGAVGYLGSTLFVRRIYRNIKCD  588



>ref|XP_003592976.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES63227.1| endomembrane protein 70 family protein [Medicago truncatula]
Length=583

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILI+VTVCVTIVGTYFLLNAENY+WQWTSF SAAST VYVYLYSIYY
Sbjct  471  VYYVYGFMLLVFLILIVVTVCVTIVGTYFLLNAENYNWQWTSFLSAASTGVYVYLYSIYY  530

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            YYVKTKMSGFFQ SFYFGYT MFCLGLGILCGAVG LGSNLFVRRIYRNIKCD
Sbjct  531  YYVKTKMSGFFQTSFYFGYTAMFCLGLGILCGAVGHLGSNLFVRRIYRNIKCD  583



>ref|XP_002960054.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
 gb|EFJ37593.1| hypothetical protein SELMODRAFT_163520 [Selaginella moellendorffii]
Length=586

 Score =   145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL+IVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTA YVYLYS+YY
Sbjct  474  VYYVYGFMLLVFLILLIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAAYVYLYSVYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y++KTKMSGFFQ SFYFGYTLM C+GLG LCGAVG+LGS++FVRRIYRNIKCD
Sbjct  534  YFMKTKMSGFFQTSFYFGYTLMLCVGLGSLCGAVGYLGSSVFVRRIYRNIKCD  586



>ref|XP_011074960.1| PREDICTED: transmembrane 9 superfamily member 1-like [Sesamum 
indicum]
Length=578

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 106/113 (94%), Gaps = 5/113 (4%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGT     AENYHWQWTSFFSAASTA+YVY YSIYY
Sbjct  471  VYYVYGFMLLVFVILIIVTICVTIVGT-----AENYHWQWTSFFSAASTALYVYFYSIYY  525

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCGAVG+LGSNLFVRRIYRNIKCD
Sbjct  526  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGAVGYLGSNLFVRRIYRNIKCD  578



>ref|XP_006356503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
tuberosum]
Length=584

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            YYVYGF+LLVF++LIIVTVCVTIVGTY+LLNAENYHWQWTSFFSAASTA+YVYLY+IYYY
Sbjct  473  YYVYGFLLLVFIVLIIVTVCVTIVGTYYLLNAENYHWQWTSFFSAASTALYVYLYAIYYY  532

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            + KT MSG  Q SFYFGYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HAKTSMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_010533958.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Tarenaya hassleriana]
Length=598

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 110/119 (92%), Gaps = 6/119 (5%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYF------LLNAENYHWQWTSFFSAASTAvyvy  411
            VYYVYGFMLLVFLIL++VTVCVTIVGTYF      LLNAENY+WQWTSF SAASTAVYVY
Sbjct  480  VYYVYGFMLLVFLILVVVTVCVTIVGTYFAXXXXXLLNAENYNWQWTSFLSAASTAVYVY  539

Query  410  lysiyyyyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            LYSIYYYYVKTKM GFFQ SFYFGYTLMFCLGLGILCGAVG++GSNLFVRRIYRNIKCD
Sbjct  540  LYSIYYYYVKTKMFGFFQTSFYFGYTLMFCLGLGILCGAVGYMGSNLFVRRIYRNIKCD  598



>ref|XP_004241844.1| PREDICTED: transmembrane 9 superfamily member 3-like [Solanum 
lycopersicum]
Length=584

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            YYVYGF+LLVF++LIIVT+CVTIVGTY+LLNAENY+WQWTSFFSAASTA+YVYLY+IYYY
Sbjct  473  YYVYGFLLLVFIVLIIVTICVTIVGTYYLLNAENYNWQWTSFFSAASTALYVYLYAIYYY  532

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            + KTKMSG  Q SFYFGYTLMFCLG+GILCGAVG+LGSNLF+RRI+ NIKCD
Sbjct  533  HSKTKMSGLLQTSFYFGYTLMFCLGVGILCGAVGYLGSNLFIRRIFGNIKCD  584



>ref|XP_009788011.1| PREDICTED: transmembrane 9 superfamily member 3-like [Nicotiana 
sylvestris]
Length=583

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLLNAENYHWQWTSFFSAASTA YVYLYSIYYY
Sbjct  472  YHVYGFMLLVFIILIIVTVCVTIVATYFLLNAENYHWQWTSFFSAASTAFYVYLYSIYYY  531

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  532  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_005645983.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21439.1| hypothetical protein COCSUDRAFT_53991 [Coccomyxa subellipsoidea 
C-169]
Length=610

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 92/113 (81%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLIL I+TVCVTIVGTYFLLNAENYHWQWTSF +AASTA+YV+LY+++Y
Sbjct  498  VYYVYGFMLLVFLILAIMTVCVTIVGTYFLLNAENYHWQWTSFCAAASTALYVFLYAVHY  557

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            ++VKTKM+GFFQ  FYFGYTLMFCLGL I+ GA+G+LGS +FVRRIYRNIKCD
Sbjct  558  FFVKTKMTGFFQTCFYFGYTLMFCLGLSIMTGALGYLGSAIFVRRIYRNIKCD  610



>ref|XP_007509634.1| predicted protein [Bathycoccus prasinos]
 emb|CCO19437.1| predicted protein [Bathycoccus prasinos]
Length=629

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVF+IL+IVT+CVT+VGTYFLLNAENYHW WTSF SAASTA YVY+YSIYY
Sbjct  517  VYYVYGFFLLVFMILMIVTLCVTVVGTYFLLNAENYHWHWTSFISAASTAFYVYVYSIYY  576

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +  KTKM+GFFQ  FYFGYT MFCLGLG++CGAVG+ G+N FVRRIYRNIKCD
Sbjct  577  FIFKTKMTGFFQTCFYFGYTAMFCLGLGLMCGAVGYFGANAFVRRIYRNIKCD  629



>ref|XP_009631163.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Nicotiana tomentosiformis]
Length=468

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLL+AENYHWQWTSF+SAASTA YVYLYSIYYY
Sbjct  357  YHVYGFMLLVFIILIIVTVCVTIVATYFLLSAENYHWQWTSFYSAASTACYVYLYSIYYY  416

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  417  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  468



>ref|XP_009631162.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Nicotiana tomentosiformis]
Length=583

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/112 (85%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            Y+VYGFMLLVF+ILIIVTVCVTIV TYFLL+AENYHWQWTSF+SAASTA YVYLYSIYYY
Sbjct  472  YHVYGFMLLVFIILIIVTVCVTIVATYFLLSAENYHWQWTSFYSAASTACYVYLYSIYYY  531

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y KT+M G FQ S YFGYTLMFCLGLG LCGAVG++GSNLFVRRI+ NIKCD
Sbjct  532  YAKTRMFGLFQTSVYFGYTLMFCLGLGTLCGAVGYIGSNLFVRRIFSNIKCD  583



>ref|XP_011395771.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
 gb|KFM22905.1| Transmembrane 9 superfamily member 3 [Auxenochlorella protothecoides]
Length=591

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVFLILIIVT+CVTIV +YFLLNAENYHW WTSF + AST++YV+LYS++Y
Sbjct  479  VYYVYGFFLLVFLILIIVTICVTIVASYFLLNAENYHWHWTSFGAGASTSLYVFLYSVHY  538

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            ++ KTKM+GFFQ +FYFGYTLMFC+GL ++CGAVG LG+ +FVRRIYRNIKCD
Sbjct  539  FFWKTKMTGFFQTAFYFGYTLMFCVGLSVMCGAVGHLGAGVFVRRIYRNIKCD  591



>ref|XP_005845268.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
 gb|EFN53166.1| hypothetical protein CHLNCDRAFT_36511 [Chlorella variabilis]
Length=589

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/113 (76%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVFLIL+IVTVCVTIVGTYFLLNAENYHW WT+F + AST++YV LYS++Y
Sbjct  477  VYYVYGFFLLVFLILLIVTVCVTIVGTYFLLNAENYHWHWTAFSAGASTSLYVMLYSVHY  536

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            + +KTKM+GFFQ +FYFGYTLMFCLGL I+CGA+G+LGS  FVRRI+RN+K D
Sbjct  537  FVMKTKMTGFFQTAFYFGYTLMFCLGLSIMCGAIGYLGSLAFVRRIFRNVKVD  589



>gb|KFO35950.1| Phosphoinositide 3-kinase adapter protein 1 [Fukomys damarensis]
Length=1303

 Score =   127 bits (318),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572   VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
             +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  1191  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  1250

Query  392   yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
             Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  1251  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  1303



>gb|KDD76545.1| endomembrane protein 70 [Helicosporidium sp. ATCC 50920]
Length=572

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVF+IL++VT+CVT+V TYFLLNAENYHW W SF + AST++YV+LYS++Y
Sbjct  460  VYYVYGFFLLVFIILLVVTLCVTVVATYFLLNAENYHWHWASFGAGASTSIYVWLYSVHY  519

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            ++VKTKM+GFFQ +FYFGYTLMFC+GL ++CG+VG+LG++ FVRRIY+NIKCD
Sbjct  520  FFVKTKMTGFFQTTFYFGYTLMFCIGLSVMCGSVGYLGASAFVRRIYKNIKCD  572



>ref|XP_004335868.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13855.1| endomembrane protein EMP70 precursor isolog, putative [Acanthamoeba 
castellanii str. Neff]
Length=591

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            YYVYGFMLLV++ILIIVTVCVTIV TYFLLN+E+Y WQWTSF SAASTA YV+LYS+YY+
Sbjct  480  YYVYGFMLLVYVILIIVTVCVTIVSTYFLLNSEDYRWQWTSFLSAASTAGYVFLYSVYYF  539

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+KTKMSGFFQ  FYFGY  MFCLGL  LCGA+GF+G+++FVRRIY  IK D
Sbjct  540  YMKTKMSGFFQTVFYFGYMAMFCLGLATLCGAIGFIGTSMFVRRIYTMIKGD  591



>ref|XP_002945998.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
 gb|EFJ52993.1| hypothetical protein VOLCADRAFT_72231 [Volvox carteri f. nagariensis]
Length=596

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYY+YGF+LLV LIL++VTVCVTIVGTYFLLNAENYHWQWT+F  +AST+ YV+LYS++Y
Sbjct  484  VYYIYGFLLLVVLILLVVTVCVTIVGTYFLLNAENYHWQWTAFGMSASTSFYVFLYSVHY  543

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +  KTKM+G FQ  FYFGYT MFCLGL +LCGAVG++ +  FVR IYRN+KCD
Sbjct  544  FLFKTKMTGLFQTCFYFGYTSMFCLGLALLCGAVGYMAAAAFVRTIYRNVKCD  596



>gb|ETN57960.1| hypothetical protein AND_010453 [Anopheles darlingi]
Length=1505

 Score =   124 bits (310),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 82/113 (73%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  572   VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
             +YYVYGFMLLVFLILIIVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  1393  IYYVYGFMLLVFLILIIVTVCVTIVCTYFLLNAEDYRWQWTSFMSAASTAIYVYMYSFYY  1452

Query  392   yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
             ++ KTKM G FQ SFYFGY  +F   LG++CG VG+ G+N+FVR+IY N+K D
Sbjct  1453  FFFKTKMYGLFQTSFYFGYMALFSGALGMICGTVGYFGTNIFVRKIYSNVKID  1505



>ref|XP_009511961.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phalacrocorax 
carbo]
 ref|XP_009806564.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Gavia stellata]
 ref|XP_010146260.1| PREDICTED: transmembrane 9 superfamily member 3-like, partial 
[Eurypyga helias]
Length=194

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  82   IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  141

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  142  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  194



>gb|AAX96186.1| Endomembrane protein 70 [Oryza sativa Japonica Group]
Length=570

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVF+ILIIVT+CVTIVGTYFLLNAENYHWQWTSFFSAASTA+YVYLYSIYY
Sbjct  475  VYYVYGFMLLVFVILIIVTICVTIVGTYFLLNAENYHWQWTSFFSAASTALYVYLYSIYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAV  291
            Y+VKTKMSGFFQ SFYFGYTLMFCLGLGILCG V
Sbjct  535  YHVKTKMSGFFQTSFYFGYTLMFCLGLGILCGTV  568



>ref|XP_009976834.1| PREDICTED: transmembrane 9 superfamily member 3 [Tauraco erythrolophus]
Length=266

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  154  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  213

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  214  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  266



>dbj|BAG60075.1| unnamed protein product [Homo sapiens]
Length=254

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  142  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  201

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  202  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  254



>emb|CBN79799.1| conserved unknown protein [Ectocarpus siliculosus]
Length=231

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  569  YYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyyy  390
            YYVYGF+LLVF IL++V VC TIV  YF+LN ENYHWQW SF SAASTA YV+LYS YY 
Sbjct  120  YYVYGFVLLVFAILVVVLVCTTIVAVYFVLNGENYHWQWVSFLSAASTAGYVFLYSGYYL  179

Query  389  yVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            + KT  SGF Q+SFYFGY  +FC  LG++CG++G +GS +FV++IYRNIK D
Sbjct  180  WFKTHQSGFMQISFYFGYMGLFCAALGVMCGSIGVMGSTVFVKQIYRNIKVD  231



>dbj|BAB55110.1| unnamed protein product [Homo sapiens]
 dbj|BAC11397.1| unnamed protein product [Homo sapiens]
Length=329

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  217  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  276

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  277  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  329



>ref|XP_008057299.1| PREDICTED: transmembrane 9 superfamily member 3 [Tarsius syrichta]
Length=359

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  247  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  306

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  307  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  359



>ref|XP_003061693.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54323.1| predicted protein [Micromonas pusilla CCMP1545]
Length=623

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVF IL+IVT CVT+V TYFLLNAEN+ W WT+F +AAS ++YVY YS+YY
Sbjct  511  VYYVYGFFLLVFAILLIVTACVTVVATYFLLNAENWRWHWTAFNAAASVSLYVYAYSVYY  570

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +  KTKM+GFFQ  FYFGYT MFCL L ++CGA G++ +N FVRRIYRNIKCD
Sbjct  571  FVFKTKMTGFFQTCFYFGYTAMFCLVLALVCGATGYVAANAFVRRIYRNIKCD  623



>dbj|BAC11232.1| unnamed protein product [Homo sapiens]
Length=399

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  287  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  346

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  347  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  399



>ref|XP_009951614.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Leptosomus 
discolor]
 ref|XP_010281856.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Phaethon 
lepturus]
Length=395

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  283  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  342

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  343  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  395



>ref|XP_002509072.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70330.1| predicted protein [Micromonas sp. RCC299]
Length=613

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 96/113 (85%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGF LLVF IL+IVT+C+TIVGTYFLLNAEN+ WQWT+F SAAS A YVYLYSIYY
Sbjct  501  VYYVYGFFLLVFCILVIVTLCITIVGTYFLLNAENHKWQWTAFNSAASVAGYVYLYSIYY  560

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            +  KTKM+GFFQ  FYFGYT MFCL LGI  GA+G+ G++ FVR+IYRNIK D
Sbjct  561  FAFKTKMTGFFQTCFYFGYTAMFCLALGITTGAIGYCGASAFVRKIYRNIKVD  613



>ref|XP_009478867.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pelecanus 
crispus]
Length=383

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  271  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  330

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  331  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  383



>ref|XP_006756739.1| PREDICTED: transmembrane 9 superfamily member 3 [Myotis davidii]
Length=401

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  289  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  348

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  349  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  401



>ref|XP_008942019.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Merops 
nubicus]
 ref|XP_010161341.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Caprimulgus 
carolinensis]
 ref|XP_010075805.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Pterocles 
gutturalis]
Length=448

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  336  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  395

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  396  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  448



>gb|KFU99061.1| Transmembrane 9 superfamily member 3, partial [Pterocles gutturalis]
Length=449

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  337  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  396

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  397  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  449



>ref|XP_006263564.1| PREDICTED: transmembrane 9 superfamily member 3-like [Alligator 
mississippiensis]
Length=511

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  399  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  458

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  459  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  511



>ref|XP_007615223.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Cricetulus 
griseus]
Length=487

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  375  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  434

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  435  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487



>dbj|BAE91187.1| unnamed protein product [Macaca fascicularis]
Length=487

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  375  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  434

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  435  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487



>ref|XP_010101151.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
 gb|EXB87369.1| Transmembrane 9 superfamily member 3 [Morus notabilis]
Length=609

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 91/92 (99%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY
Sbjct  470  VYYVYGFMLLVFLILIIVTVCVTIVGTYFLLNAENYHWQWTSFFSAASTAVYVYLYSIYY  529

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCG  297
            YYVKTKMSGFFQ SFYFGYTLMFCLGLGILCG
Sbjct  530  YYVKTKMSGFFQTSFYFGYTLMFCLGLGILCG  561



>gb|AAQ89178.1| PATY245 [Homo sapiens]
Length=487

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  375  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  434

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  435  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487



>gb|ELW49306.1| Transmembrane 9 superfamily member 3 [Tupaia chinensis]
Length=530

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  418  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  477

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  478  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  530



>ref|XP_007441347.1| PREDICTED: transmembrane 9 superfamily member 3-like [Python 
bivittatus]
Length=487

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  375  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  434

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  435  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  487



>gb|EDL41854.1| mCG2375, isoform CRA_a [Mus musculus]
 gb|EDL94199.1| similar to transmembrane protein TM9SF3 (predicted) [Rattus norvegicus]
Length=496

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  384  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  443

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  444  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  496



>gb|AAH20959.2| TM9SF3 protein, partial [Homo sapiens]
Length=521

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  409  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  468

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  469  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  521



>ref|XP_009916579.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
albicilla]
 ref|XP_010566033.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Haliaeetus 
leucocephalus]
Length=519

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  407  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  466

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  467  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  519



>ref|XP_008428274.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Poecilia 
reticulata]
Length=545

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  545



>gb|AAH04799.2| Tm9sf3 protein, partial [Mus musculus]
Length=513

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  401  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  460

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  461  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  513



>ref|XP_010018436.1| PREDICTED: transmembrane 9 superfamily member 3 [Nestor notabilis]
Length=520

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  408  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  467

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  468  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  520



>ref|XP_007566966.1| PREDICTED: transmembrane 9 superfamily member 3 [Poecilia formosa]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_006630785.1| PREDICTED: transmembrane 9 superfamily member 3-like [Lepisosteus 
oculatus]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_005795250.1| PREDICTED: transmembrane 9 superfamily member 3-like [Xiphophorus 
maculatus]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_007258750.1| PREDICTED: transmembrane 9 superfamily member 3-like [Astyanax 
mexicanus]
Length=587

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  475  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  535  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  587



>ref|XP_010732838.1| PREDICTED: transmembrane 9 superfamily member 3 [Larimichthys 
crocea]
Length=581

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  469  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  528

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  529  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  581



>ref|XP_008428273.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Poecilia 
reticulata]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_003441118.1| PREDICTED: transmembrane 9 superfamily member 3 [Oreochromis 
niloticus]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>gb|ELK35693.1| Transmembrane 9 superfamily member 3 [Myotis davidii]
Length=513

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  401  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  460

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  461  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  513



>ref|NP_998554.1| transmembrane 9 superfamily member 3 precursor [Danio rerio]
 gb|AAH46021.1| Transmembrane 9 superfamily member 3 [Danio rerio]
Length=586

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_008948979.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Pan paniscus]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_004616433.1| PREDICTED: transmembrane 9 superfamily member 3 [Sorex araneus]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_008282853.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane 9 superfamily member 
3 [Stegastes partitus]
Length=624

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  512  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  571

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  572  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_003787418.1| PREDICTED: transmembrane 9 superfamily member 3 [Otolemur garnettii]
Length=541

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  429  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  488

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  489  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  541



>ref|XP_004680642.1| PREDICTED: transmembrane 9 superfamily member 3 [Condylura cristata]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_003255319.1| PREDICTED: transmembrane 9 superfamily member 3 [Nomascus leucogenys]
 ref|XP_003904109.1| PREDICTED: transmembrane 9 superfamily member 3 [Papio anubis]
 ref|XP_003922396.1| PREDICTED: transmembrane 9 superfamily member 3 [Saimiri boliviensis 
boliviensis]
 ref|XP_004049917.1| PREDICTED: transmembrane 9 superfamily member 3 [Gorilla gorilla 
gorilla]
 ref|XP_004669974.1| PREDICTED: transmembrane 9 superfamily member 3 [Jaculus jaculus]
 ref|XP_004749641.1| PREDICTED: transmembrane 9 superfamily member 3 [Mustela putorius 
furo]
 ref|XP_004794746.1| PREDICTED: transmembrane 9 superfamily member 3 [Mustela putorius 
furo]
 ref|XP_005335337.1| PREDICTED: transmembrane 9 superfamily member 3 [Ictidomys tridecemlineatus]
 ref|XP_006174470.1| PREDICTED: transmembrane 9 superfamily member 3 [Camelus ferus]
 ref|XP_006210638.1| PREDICTED: transmembrane 9 superfamily member 3 [Vicugna pacos]
 ref|XP_006880138.1| PREDICTED: transmembrane 9 superfamily member 3 [Elephantulus 
edwardii]
 ref|XP_006925981.1| PREDICTED: transmembrane 9 superfamily member 3 [Pteropus alecto]
 ref|XP_008573585.1| PREDICTED: transmembrane 9 superfamily member 3 [Galeopterus 
variegatus]
 ref|XP_010616424.1| PREDICTED: transmembrane 9 superfamily member 3 [Fukomys damarensis]
 ref|XP_010616425.1| PREDICTED: transmembrane 9 superfamily member 3 [Fukomys damarensis]
 ref|XP_010587390.1| PREDICTED: transmembrane 9 superfamily member 3 [Loxodonta africana]
 ref|XP_011372281.1| PREDICTED: transmembrane 9 superfamily member 3 [Pteropus vampyrus]
 dbj|BAB55369.1| unnamed protein product [Homo sapiens]
 gb|EAW49973.1| SM-11044 binding protein, isoform CRA_b [Homo sapiens]
 gb|ELK00879.1| Transmembrane 9 superfamily member 3 [Pteropus alecto]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005637634.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Canis 
lupus familiaris]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_006116276.1| PREDICTED: transmembrane 9 superfamily member 3 [Pelodiscus sinensis]
Length=545

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005997314.1| PREDICTED: transmembrane 9 superfamily member 3 [Latimeria chalumnae]
Length=587

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  475  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  534

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  535  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  587



>ref|XP_004427950.1| PREDICTED: transmembrane 9 superfamily member 3 [Ceratotherium 
simum simum]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_006799085.1| PREDICTED: transmembrane 9 superfamily member 3-like [Neolamprologus 
brichardi]
Length=624

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  512  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  571

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  572  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_003963762.1| PREDICTED: transmembrane 9 superfamily member 3-like [Takifugu 
rubripes]
Length=586

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_011285801.1| PREDICTED: transmembrane 9 superfamily member 3 [Felis catus]
Length=561

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  449  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  508

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  509  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  561



>ref|XP_005735123.1| PREDICTED: transmembrane 9 superfamily member 3-like [Pundamilia 
nyererei]
 ref|XP_005927107.1| PREDICTED: transmembrane 9 superfamily member 3-like [Haplochromis 
burtoni]
Length=586

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_008641953.1| PREDICTED: transmembrane 9 superfamily member 3 [Corvus brachyrhynchos]
 ref|XP_010409955.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Corvus 
cornix cornix]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005520596.1| PREDICTED: transmembrane 9 superfamily member 3 [Pseudopodoces 
humilis]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_009470788.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Nipponia 
nippon]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>gb|KFP32607.1| Transmembrane 9 superfamily member 3, partial [Colius striatus]
Length=555

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  443  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  502

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  503  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  555



>ref|XP_007187499.1| PREDICTED: transmembrane 9 superfamily member 3 [Balaenoptera 
acutorostrata scammoni]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_004701094.1| PREDICTED: transmembrane 9 superfamily member 3 [Echinops telfairi]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_006157459.1| PREDICTED: transmembrane 9 superfamily member 3, partial [Tupaia 
chinensis]
Length=577

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  465  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  524

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  525  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  577



>ref|XP_009669621.1| PREDICTED: transmembrane 9 superfamily member 3 [Struthio camelus 
australis]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYTYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005153929.1| PREDICTED: transmembrane 9 superfamily member 3 [Melopsittacus 
undulatus]
 ref|XP_009887052.1| PREDICTED: transmembrane 9 superfamily member 3 [Charadrius vociferus]
 ref|XP_010142086.1| PREDICTED: transmembrane 9 superfamily member 3 [Buceros rhinoceros 
silvestris]
 ref|XP_010189169.1| PREDICTED: transmembrane 9 superfamily member 3 [Mesitornis unicolor]
 ref|XP_010202388.1| PREDICTED: transmembrane 9 superfamily member 3 [Colius striatus]
 ref|XP_010218523.1| PREDICTED: transmembrane 9 superfamily member 3 [Tinamus guttatus]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005025241.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Anas 
platyrhynchos]
 ref|XP_005234638.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco peregrinus]
 ref|XP_005441661.1| PREDICTED: transmembrane 9 superfamily member 3 [Falco cherrug]
 ref|XP_005500101.1| PREDICTED: transmembrane 9 superfamily member 3 [Columba livia]
 ref|XP_009075359.1| PREDICTED: transmembrane 9 superfamily member 3 [Acanthisitta 
chloris]
 ref|XP_009275969.1| PREDICTED: transmembrane 9 superfamily member 3 [Aptenodytes 
forsteri]
 ref|XP_009320681.1| PREDICTED: transmembrane 9 superfamily member 3 [Pygoscelis adeliae]
 ref|XP_009569010.1| PREDICTED: transmembrane 9 superfamily member 3 [Cuculus canorus]
 ref|XP_009640318.1| PREDICTED: transmembrane 9 superfamily member 3 [Egretta garzetta]
 ref|XP_009916578.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
albicilla]
 ref|XP_009937749.1| PREDICTED: transmembrane 9 superfamily member 3 [Opisthocomus 
hoazin]
 ref|XP_009966565.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Tyto 
alba]
 ref|XP_009999091.1| PREDICTED: transmembrane 9 superfamily member 3 [Chaetura pelagica]
 ref|XP_010311939.1| PREDICTED: transmembrane 9 superfamily member 3 [Balearica regulorum 
gibbericeps]
 ref|XP_010566032.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Haliaeetus 
leucocephalus]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_009705892.1| PREDICTED: transmembrane 9 superfamily member 3 [Cariama cristata]
 ref|XP_010127919.1| PREDICTED: transmembrane 9 superfamily member 3 [Chlamydotis 
macqueenii]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_009574595.1| PREDICTED: transmembrane 9 superfamily member 3 [Fulmarus glacialis]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_008932762.1| PREDICTED: transmembrane 9 superfamily member 3 [Manacus vitellinus]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_007053441.1| PREDICTED: transmembrane 9 superfamily member 3 [Chelonia mydas]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_005407641.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X5 [Chinchilla 
lanigera]
Length=567

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  455  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  514

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  515  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  567



>ref|XP_008142341.1| PREDICTED: transmembrane 9 superfamily member 3 [Eptesicus fuscus]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_010779545.1| PREDICTED: transmembrane 9 superfamily member 3 [Notothenia coriiceps]
Length=586

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  474  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  533

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  534  YFFKTKMYGLFQTSFYFGYMAVFSTSLGIMCGAVGYMGTSAFVRKIYTNVKID  586



>ref|XP_010712722.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X2 [Meleagris 
gallopavo]
Length=556

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  444  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  503

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  504  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  556



>gb|EMC79922.1| Transmembrane 9 superfamily member 3, partial [Columba livia]
 gb|KFP82539.1| Transmembrane 9 superfamily member 3, partial [Acanthisitta chloris]
Length=555

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  443  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  502

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  503  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  555



>ref|XP_004020122.1| PREDICTED: transmembrane 9 superfamily member 3 [Ovis aries]
 ref|XP_005698335.1| PREDICTED: transmembrane 9 superfamily member 3 [Capra hircus]
 ref|XP_005898909.1| PREDICTED: transmembrane 9 superfamily member 3 [Bos mutus]
 ref|XP_006061240.1| PREDICTED: transmembrane 9 superfamily member 3 [Bubalus bubalis]
 ref|XP_010831338.1| PREDICTED: transmembrane 9 superfamily member 3 [Bison bison 
bison]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_007902753.1| PREDICTED: transmembrane 9 superfamily member 3 [Callorhinchus 
milii]
Length=585

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  473  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  585



>gb|KFP68674.1| Transmembrane 9 superfamily member 3, partial [Cariama cristata]
Length=555

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  443  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  502

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  503  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  555



>ref|XP_004559661.1| PREDICTED: transmembrane 9 superfamily member 3-like [Maylandia 
zebra]
Length=624

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  512  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  571

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  572  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYMGTSAFVRKIYTNVKID  624



>ref|XP_009470713.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Nipponia 
nippon]
Length=533

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  421  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  480

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  481  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  533



>ref|XP_010712721.1| PREDICTED: transmembrane 9 superfamily member 3 isoform X1 [Meleagris 
gallopavo]
Length=561

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  449  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  508

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  509  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  561



>ref|XP_005416571.1| PREDICTED: transmembrane 9 superfamily member 3 [Geospiza fortis]
 ref|XP_009085625.1| PREDICTED: transmembrane 9 superfamily member 3 [Serinus canaria]
Length=545

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  433  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  492

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  493  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  545



>ref|XP_008320400.1| PREDICTED: transmembrane 9 superfamily member 3 [Cynoglossus 
semilaevis]
Length=585

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTAVYVY+YS YY
Sbjct  473  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAVYVYMYSFYY  532

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGAVG++G++ FVR+IY N+K D
Sbjct  533  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAVGYVGTSAFVRKIYTNVKID  585



>ref|XP_005984512.1| PREDICTED: transmembrane 9 superfamily member 3 [Pantholops hodgsonii]
Length=558

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  572  VYYVYGFMllvfliliivtvcvtiVGTYFLLNAENYHWQWTSFFSAASTAvyvylysiyy  393
            +YYVYGFM+LV +IL IVTVCVTIV TYFLLNAE+Y WQWTSF SAASTA+YVY+YS YY
Sbjct  446  IYYVYGFMMLVLVILCIVTVCVTIVCTYFLLNAEDYRWQWTSFLSAASTAIYVYMYSFYY  505

Query  392  yyVKTKMSGFFQVSFYFGYTLMFCLGLGILCGAVGFLGSNLFVRRIYRNIKCD  234
            Y+ KTKM G FQ SFYFGY  +F   LGI+CGA+G++G++ FVR+IY N+K D
Sbjct  506  YFFKTKMYGLFQTSFYFGYMAVFSTALGIMCGAIGYMGTSAFVRKIYTNVKID  558



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 856559115090