BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032J21

Length=628
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629169.1|  PREDICTED: protein ABIL2-like isoform X1         60.1    2e-07   Nicotiana tomentosiformis
ref|XP_009629171.1|  PREDICTED: protein ABIL2-like isoform X2         60.1    2e-07   
ref|XP_006343822.1|  PREDICTED: protein ABIL2-like                    56.2    4e-06   Solanum tuberosum [potatoes]
ref|XP_004245491.1|  PREDICTED: protein ABIL2-like isoform X1         55.5    7e-06   Solanum lycopersicum
ref|XP_009803885.1|  PREDICTED: protein ABIL2-like                    50.1    5e-04   Nicotiana sylvestris
ref|XP_010325349.1|  PREDICTED: protein ABIL2-like isoform X2         49.3    7e-04   Solanum lycopersicum



>ref|XP_009629169.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009629170.1| PREDICTED: protein ABIL2-like isoform X1 [Nicotiana tomentosiformis]
Length=332

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 19/135 (14%)
 Frame = -2

Query  492  FLATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRXK  313
            F A  +K H + P++R  + +++T  SPNP  F+FTR AS+KE+   GK SVSPL+F  K
Sbjct  186  FQALPSKPHSSKPKKR-HSKISWTDASPNPLNFSFTRVASTKEV---GKRSVSPLKFALK  241

Query  312  RSESYIHRSPP---FSPCDLRQFRP-----------QPQRTISLPTKPAKXTSQNMKKLQ  175
            RS S      P   F     R   P           +P+R +SL   P +  +++++   
Sbjct  242  RSGSVNRSVSPLMRFGSVISRSISPSTSNNKVRCPSEPRRAVSLSINPERIGAKDIQDY-  300

Query  174  SNKTKRTLQSLLSFQ  130
            S K+K  L + LS  
Sbjct  301  SRKSKNVLTAFLSLH  315



>ref|XP_009629171.1| PREDICTED: protein ABIL2-like isoform X2 [Nicotiana tomentosiformis]
Length=330

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 19/135 (14%)
 Frame = -2

Query  492  FLATKTKEHPTLPRRRLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRXK  313
            F A  +K H + P++R  + +++T  SPNP  F+FTR AS+KE+   GK SVSPL+F  K
Sbjct  184  FQALPSKPHSSKPKKR-HSKISWTDASPNPLNFSFTRVASTKEV---GKRSVSPLKFALK  239

Query  312  RSESYIHRSPP---FSPCDLRQFRP-----------QPQRTISLPTKPAKXTSQNMKKLQ  175
            RS S      P   F     R   P           +P+R +SL   P +  +++++   
Sbjct  240  RSGSVNRSVSPLMRFGSVISRSISPSTSNNKVRCPSEPRRAVSLSINPERIGAKDIQDY-  298

Query  174  SNKTKRTLQSLLSFQ  130
            S K+K  L + LS  
Sbjct  299  SRKSKNVLTAFLSLH  313



>ref|XP_006343822.1| PREDICTED: protein ABIL2-like [Solanum tuberosum]
Length=335

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 72/134 (54%), Gaps = 19/134 (14%)
 Frame = -2

Query  492  FLATKTKEHPTLPRR-RLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRX  316
            F A   K HP+ P+  +  + +++T  SPNP  F+FTR  S+KE+   GK S+SPLRF  
Sbjct  185  FQALPLKPHPSKPKYMKNHSKISWTDASPNPLNFSFTRGPSNKEI---GKRSISPLRFGL  241

Query  315  KRSESY-------------IHRSPPFSPCDLRQFRP-QPQRTISLPTKPAKXTSQNMKKL  178
            KRS S              + RS   S   ++Q  P +P+R +S+   P + ++++M++ 
Sbjct  242  KRSGSVNRSVSPLIRFGSAVTRSISPSTSSIKQRCPSEPRRAMSMSINPERNSAKDMQEY  301

Query  177  QSNKTKRTLQSLLS  136
             + K+K  L + L 
Sbjct  302  -ARKSKNLLTAFLG  314



>ref|XP_004245491.1| PREDICTED: protein ABIL2-like isoform X1 [Solanum lycopersicum]
Length=333

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 73/134 (54%), Gaps = 19/134 (14%)
 Frame = -2

Query  492  FLATKTKEHPTLPRR-RLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRX  316
            F A  +K HP++P+  +  +  ++T  SPNP  F+FTR  S+KE+   GK S+SPL+F  
Sbjct  182  FQALPSKPHPSIPKYMKKHSKNSWTDASPNPLNFSFTRVPSNKEV---GKRSISPLKFGV  238

Query  315  KRSESY-------------IHRSPPFSPCDLRQFRP-QPQRTISLPTKPAKXTSQNMKKL  178
            KRS S              + RS   S   ++Q  P +P+R +S+   P + ++++M++ 
Sbjct  239  KRSGSVNRSVSPLTRFGSAVTRSISPSTSSIKQRCPSEPRRAMSMSINPERNSAKDMQEY  298

Query  177  QSNKTKRTLQSLLS  136
             + K+K  L + L 
Sbjct  299  -ARKSKNLLTAFLG  311



>ref|XP_009803885.1| PREDICTED: protein ABIL2-like [Nicotiana sylvestris]
 ref|XP_009803886.1| PREDICTED: protein ABIL2-like [Nicotiana sylvestris]
Length=334

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 73/141 (52%), Gaps = 29/141 (21%)
 Frame = -2

Query  492  FLATKTKEHPTLPRR-RLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRX  316
            F A  +K HP+ P+  +  + +++T  SPN   F+FTR AS+KE+   GK  VSPL+F  
Sbjct  186  FQALPSKPHPSKPQYMKRHSKISWTDASPNSLNFSFTRVASTKEV---GKRPVSPLKFAL  242

Query  315  KRSESYIHRSPPFSPCDLRQFR-------------------PQPQRTISLPTKPAKXTSQ  193
            KRS S ++RS   SP  L +F                     +P+R +SL   P +  ++
Sbjct  243  KRSGS-VNRS--VSP--LMRFGSVISRSISPSTSSNKVRCPSEPRRAVSLSINPERNGAK  297

Query  192  NMKKLQSNKTKRTLQSLLSFQ  130
            +++   S K+K+ L + LS  
Sbjct  298  DVQDY-SRKSKKLLTAFLSLH  317



>ref|XP_010325349.1| PREDICTED: protein ABIL2-like isoform X2 [Solanum lycopersicum]
Length=282

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 9/97 (9%)
 Frame = -2

Query  492  FLATKTKEHPTLPRR-RLQNNLTFTQTSPNPPAFTFTRAASSKELDSRGKLSVSPLRFRX  316
            F A  +K HP++P+  +  +  ++T  SPNP  F+FTR  S+KE+   GK S+SPL+F  
Sbjct  182  FQALPSKPHPSIPKYMKKHSKNSWTDASPNPLNFSFTRVPSNKEV---GKRSISPLKFGV  238

Query  315  KRSESYIHRSPPFSPCDLRQFRPQPQRTISLPTKPAK  205
            KRS S ++RS   SP  L +F     R+IS  T   K
Sbjct  239  KRSGS-VNRS--VSP--LTRFGSAVTRSISPSTSSIK  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250