BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032I24

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010245461.1|  PREDICTED: topless-related protein 2-like is...    132   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_010245460.1|  PREDICTED: topless-related protein 2-like is...    132   3e-31   Nelumbo nucifera [Indian lotus]
ref|XP_006344707.1|  PREDICTED: topless-related protein 3-like is...    131   1e-30   Solanum tuberosum [potatoes]
emb|CDP17223.1|  unnamed protein product                                131   1e-30   Coffea canephora [robusta coffee]
ref|XP_006344709.1|  PREDICTED: topless-related protein 3-like is...    130   1e-30   Solanum tuberosum [potatoes]
ref|XP_006344708.1|  PREDICTED: topless-related protein 3-like is...    130   1e-30   Solanum tuberosum [potatoes]
ref|XP_004230269.1|  PREDICTED: topless-related protein 3 isoform X3    130   2e-30   Solanum lycopersicum
ref|XP_010313271.1|  PREDICTED: topless-related protein 3 isoform X2    130   2e-30   Solanum lycopersicum
ref|XP_010313267.1|  PREDICTED: topless-related protein 3 isoform X1    130   2e-30   Solanum lycopersicum
ref|XP_009785868.1|  PREDICTED: topless-related protein 3-like          129   6e-30   Nicotiana sylvestris
ref|XP_011092107.1|  PREDICTED: topless-related protein 3-like          129   6e-30   Sesamum indicum [beniseed]
gb|KDP23429.1|  hypothetical protein JCGZ_23262                         124   2e-29   Jatropha curcas
ref|XP_009766750.1|  PREDICTED: topless-related protein 3-like is...    126   4e-29   Nicotiana sylvestris
ref|XP_009766749.1|  PREDICTED: topless-related protein 3-like is...    126   4e-29   Nicotiana sylvestris
ref|XP_009616373.1|  PREDICTED: topless-related protein 3-like          126   5e-29   Nicotiana tomentosiformis
emb|CAN79774.1|  hypothetical protein VITISV_013612                     125   8e-29   Vitis vinifera
ref|XP_009611828.1|  PREDICTED: topless-related protein 3-like is...    125   9e-29   Nicotiana tomentosiformis
ref|XP_009611827.1|  PREDICTED: topless-related protein 3-like is...    125   1e-28   Nicotiana tomentosiformis
ref|XP_007204953.1|  hypothetical protein PRUPE_ppa000487mg             125   1e-28   Prunus persica
ref|XP_008795824.1|  PREDICTED: topless-related protein 2-like          124   2e-28   
ref|XP_002283157.1|  PREDICTED: topless-related protein 3               124   2e-28   Vitis vinifera
ref|XP_008790866.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    124   4e-28   
ref|XP_010259448.1|  PREDICTED: topless-related protein 2 isoform X1    123   5e-28   Nelumbo nucifera [Indian lotus]
ref|XP_010259450.1|  PREDICTED: topless-related protein 2 isoform X3    123   6e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008245640.1|  PREDICTED: topless-related protein 3               122   1e-27   Prunus mume [ume]
ref|XP_006644007.1|  PREDICTED: topless-related protein 2-like          122   1e-27   Oryza brachyantha
ref|XP_002512473.1|  WD-repeat protein, putative                        122   2e-27   Ricinus communis
ref|XP_008388509.1|  PREDICTED: topless-related protein 3-like          121   2e-27   Malus domestica [apple tree]
gb|KDO81757.1|  hypothetical protein CISIN_1g001190mg                   120   4e-27   Citrus sinensis [apfelsine]
ref|XP_006433483.1|  hypothetical protein CICLE_v10000084mg             120   4e-27   Citrus clementina [clementine]
gb|KDO81755.1|  hypothetical protein CISIN_1g001190mg                   120   4e-27   Citrus sinensis [apfelsine]
gb|KDO81756.1|  hypothetical protein CISIN_1g001190mg                   120   4e-27   Citrus sinensis [apfelsine]
ref|XP_010094719.1|  Topless-related protein 3                          120   5e-27   Morus notabilis
ref|XP_004144768.1|  PREDICTED: topless-related protein 3-like          120   6e-27   Cucumis sativus [cucumbers]
ref|XP_004158753.1|  PREDICTED: topless-related protein 3-like          120   6e-27   
ref|XP_010921589.1|  PREDICTED: topless-related protein 2-like is...    119   1e-26   Elaeis guineensis
ref|XP_010921588.1|  PREDICTED: topless-related protein 2-like is...    119   1e-26   Elaeis guineensis
ref|XP_006419483.1|  hypothetical protein CICLE_v10004197mg             119   1e-26   Citrus clementina [clementine]
gb|EAY73338.1|  hypothetical protein OsI_01216                          119   1e-26   Oryza sativa Indica Group [Indian rice]
ref|XP_004494565.1|  PREDICTED: topless-related protein 3-like          119   1e-26   
ref|XP_006489020.1|  PREDICTED: topless-related protein 2-like is...    119   1e-26   
gb|KDO71780.1|  hypothetical protein CISIN_1g001178mg                   119   1e-26   Citrus sinensis [apfelsine]
ref|XP_006472151.1|  PREDICTED: topless-related protein 3-like          119   1e-26   Citrus sinensis [apfelsine]
ref|XP_010259449.1|  PREDICTED: topless-related protein 2 isoform X2    119   1e-26   Nelumbo nucifera [Indian lotus]
ref|NP_001042616.1|  Os01g0254100                                       119   2e-26   
ref|XP_009338219.1|  PREDICTED: topless-related protein 3 isoform X2    119   2e-26   
ref|XP_009338217.1|  PREDICTED: topless-related protein 3 isoform X1    119   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_004508183.1|  PREDICTED: topless-related protein 2-like          119   2e-26   Cicer arietinum [garbanzo]
ref|XP_010938347.1|  PREDICTED: topless-related protein 2-like is...    118   2e-26   Elaeis guineensis
ref|XP_010938346.1|  PREDICTED: topless-related protein 2-like is...    118   2e-26   Elaeis guineensis
ref|XP_010024094.1|  PREDICTED: topless-related protein 3 isoform X2    118   2e-26   Eucalyptus grandis [rose gum]
ref|XP_010024093.1|  PREDICTED: topless-related protein 3 isoform X1    118   3e-26   Eucalyptus grandis [rose gum]
gb|KCW60526.1|  hypothetical protein EUGRSUZ_H03269                     118   3e-26   Eucalyptus grandis [rose gum]
ref|XP_008370406.1|  PREDICTED: topless-related protein 3-like is...    118   3e-26   Malus domestica [apple tree]
ref|XP_008370405.1|  PREDICTED: topless-related protein 3-like is...    118   4e-26   Malus domestica [apple tree]
ref|XP_008453896.1|  PREDICTED: topless-related protein 3-like          117   5e-26   Cucumis melo [Oriental melon]
ref|XP_010086586.1|  Topless-related protein 3                          117   7e-26   Morus notabilis
ref|XP_007163344.1|  hypothetical protein PHAVU_001G227000g             117   8e-26   Phaseolus vulgaris [French bean]
ref|XP_007163345.1|  hypothetical protein PHAVU_001G227000g             116   1e-25   Phaseolus vulgaris [French bean]
ref|XP_007099669.1|  TOPLESS-related 3                                  110   3e-25   
dbj|BAJ96033.1|  predicted protein                                      115   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85297.1|  predicted protein                                      115   3e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003566431.1|  PREDICTED: topless-related protein 2-like is...    115   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_010230707.1|  PREDICTED: topless-related protein 2-like is...    115   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_010230706.1|  PREDICTED: topless-related protein 2-like is...    115   3e-25   Brachypodium distachyon [annual false brome]
ref|XP_010546750.1|  PREDICTED: topless-related protein 3 isoform X1    115   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_010546752.1|  PREDICTED: topless-related protein 3 isoform X2    115   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_006606545.1|  PREDICTED: topless-related protein 3-like          115   3e-25   Glycine max [soybeans]
ref|XP_004495685.1|  PREDICTED: topless-related protein 3-like is...    115   4e-25   Cicer arietinum [garbanzo]
ref|XP_004495684.1|  PREDICTED: topless-related protein 3-like is...    115   4e-25   Cicer arietinum [garbanzo]
dbj|BAJ88304.1|  predicted protein                                      113   4e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006489019.1|  PREDICTED: topless-related protein 2-like is...    115   4e-25   Citrus sinensis [apfelsine]
ref|XP_004967836.1|  PREDICTED: topless-related protein 2-like          115   4e-25   Setaria italica
gb|KDO71781.1|  hypothetical protein CISIN_1g001178mg                   115   4e-25   Citrus sinensis [apfelsine]
ref|XP_003591186.1|  WD repeat-containing protein                       114   4e-25   
ref|XP_010043204.1|  PREDICTED: topless-related protein 3-like          114   4e-25   
gb|ABD28351.1|  Lissencephaly type-1-like homology motif; CTLH, C...    114   5e-25   Medicago truncatula
gb|AAB61051.1|  Hypothetical protein F2P16.14                           106   6e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDM82632.1|  unnamed protein product                                114   7e-25   Triticum aestivum [Canadian hard winter wheat]
gb|KHN16088.1|  Topless-related protein 3                               114   8e-25   Glycine soja [wild soybean]
ref|XP_006589130.1|  PREDICTED: topless-related protein 3-like is...    114   8e-25   
ref|XP_006589131.1|  PREDICTED: topless-related protein 3-like is...    114   9e-25   
dbj|BAJ91882.1|  predicted protein                                      113   1e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003626186.1|  hypothetical protein MTR_7g112460                  113   1e-24   Medicago truncatula
ref|XP_009421409.1|  PREDICTED: topless-related protein 2-like          113   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69182.1|  hypothetical protein M569_05580                         112   2e-24   Genlisea aurea
emb|CDY25010.1|  BnaC02g39980D                                          112   2e-24   Brassica napus [oilseed rape]
emb|CDY05552.1|  BnaA02g31390D                                          112   2e-24   
ref|XP_009129893.1|  PREDICTED: topless-related protein 3               112   3e-24   Brassica rapa
ref|XP_010528913.1|  PREDICTED: topless-related protein 3-like          112   3e-24   Tarenaya hassleriana [spider flower]
ref|XP_006604796.1|  PREDICTED: topless-related protein 3-like          112   3e-24   Glycine max [soybeans]
ref|XP_007144973.1|  hypothetical protein PHAVU_007G198900g             112   3e-24   Phaseolus vulgaris [French bean]
ref|XP_010524852.1|  PREDICTED: topless-related protein 3-like is...    111   5e-24   Tarenaya hassleriana [spider flower]
ref|XP_010524851.1|  PREDICTED: topless-related protein 3-like is...    111   5e-24   Tarenaya hassleriana [spider flower]
ref|XP_007031067.1|  Transducin family protein / WD-40 repeat fam...    112   6e-24   
ref|XP_006394928.1|  hypothetical protein EUTSA_v10003550mg             111   7e-24   
ref|XP_007031064.1|  TOPLESS-related 3 isoform 1                        110   9e-24   
emb|CDX88252.1|  BnaA06g28430D                                          110   1e-23   
gb|KJB26372.1|  hypothetical protein B456_004G238300                    110   1e-23   Gossypium raimondii
gb|KJB26373.1|  hypothetical protein B456_004G238300                    110   1e-23   Gossypium raimondii
ref|XP_009382518.1|  PREDICTED: topless-related protein 2-like is...    110   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009382517.1|  PREDICTED: topless-related protein 2-like is...    110   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB26374.1|  hypothetical protein B456_004G238300                    110   1e-23   Gossypium raimondii
gb|KHG26583.1|  Topless-related 3 -like protein                         109   2e-23   Gossypium arboreum [tree cotton]
gb|AES91919.2|  topless-like protein                                    109   3e-23   Medicago truncatula
ref|XP_009151171.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    109   4e-23   Brassica rapa
ref|XP_003609722.1|  WD repeat-containing protein                       108   5e-23   
ref|XP_002307097.2|  WD-40 repeat family protein                        108   6e-23   
ref|NP_198055.3|  Topless-related protein 3                             108   6e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX80607.1|  BnaC07g28370D                                          108   7e-23   
ref|NP_001190409.1|  Topless-related protein 3                          108   7e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011036914.1|  PREDICTED: topless-related protein 3               108   7e-23   Populus euphratica
ref|XP_006577218.1|  PREDICTED: topless-related protein 3-like          108   8e-23   Glycine max [soybeans]
gb|KHN03954.1|  Topless-related protein 3                               108   8e-23   Glycine soja [wild soybean]
ref|XP_010674104.1|  PREDICTED: topless-related protein 3-like          108   9e-23   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG04331.1|  Topless-related 2 -like protein                         107   1e-22   Gossypium arboreum [tree cotton]
gb|KJB26371.1|  hypothetical protein B456_004G238300                    107   1e-22   Gossypium raimondii
dbj|BAA95777.1|  unnamed protein product                                107   2e-22   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50502.1|  BnaC01g44400D                                          107   2e-22   Brassica napus [oilseed rape]
ref|NP_188306.2|  Topless-related 2 protein                             107   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114175.1|  PREDICTED: topless-related protein 2               107   2e-22   Brassica rapa
ref|XP_006406802.1|  hypothetical protein EUTSA_v10019939mg             106   3e-22   Eutrema salsugineum [saltwater cress]
ref|XP_004487868.1|  PREDICTED: topless-related protein 2-like          106   3e-22   
ref|XP_006299477.1|  hypothetical protein CARUB_v10015642mg             106   3e-22   Capsella rubella
ref|XP_007035678.1|  TOPLESS-related 2 isoform 4                        106   4e-22   
ref|XP_007035677.1|  TOPLESS-related 2 isoform 3                        106   4e-22   
ref|XP_007035675.1|  TOPLESS-related 2 isoform 1                        106   4e-22   
ref|XP_007035676.1|  TOPLESS-related 2 isoform 2                        106   4e-22   
ref|XP_009146056.1|  PREDICTED: topless-related protein 2-like          105   4e-22   Brassica rapa
gb|KFK39016.1|  hypothetical protein AALP_AA3G189500                    105   6e-22   Arabis alpina [alpine rockcress]
ref|XP_008673872.1|  PREDICTED: topless-related protein 2 isoform X2    105   8e-22   Zea mays [maize]
ref|XP_008673871.1|  PREDICTED: topless-related protein 2 isoform X1    105   8e-22   Zea mays [maize]
gb|KFK27551.1|  hypothetical protein AALP_AA8G398300                    105   9e-22   Arabis alpina [alpine rockcress]
ref|XP_001781989.1|  predicted protein                                  105   9e-22   
emb|CDY50500.1|  BnaC01g44380D                                          103   9e-22   Brassica napus [oilseed rape]
emb|CDX92100.1|  BnaA05g23070D                                          105   9e-22   
ref|XP_010440213.1|  PREDICTED: topless-related protein 2-like          105   1e-21   
emb|CDX95900.1|  BnaC05g36510D                                          104   1e-21   
ref|XP_011023731.1|  PREDICTED: topless-related protein 3-like          104   1e-21   Populus euphratica
ref|XP_007031068.1|  TOPLESS-related 3                                  103   2e-21   
ref|XP_010487553.1|  PREDICTED: topless-related protein 2-like          103   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002319498.2|  WD-40 repeat family protein                        103   2e-21   
ref|XP_001768092.1|  predicted protein                                  103   2e-21   
ref|XP_004495686.1|  PREDICTED: topless-related protein 3-like is...    103   4e-21   
ref|XP_009369993.1|  PREDICTED: topless-related protein 2-like          102   5e-21   Pyrus x bretschneideri [bai li]
ref|XP_008390610.1|  PREDICTED: topless-related protein 2-like          102   5e-21   
gb|KEH37175.1|  topless-like protein                                    102   6e-21   Medicago truncatula
ref|XP_010449856.1|  PREDICTED: topless-related protein 2-like          102   7e-21   
ref|XP_004506964.1|  PREDICTED: protein TOPLESS-like                    102   7e-21   Cicer arietinum [garbanzo]
ref|XP_010465706.1|  PREDICTED: topless-related protein 2-like          102   7e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007227035.1|  hypothetical protein PRUPE_ppa000503mg             102   8e-21   Prunus persica
ref|XP_002883029.1|  hypothetical protein ARALYDRAFT_479149             102   9e-21   Arabidopsis lyrata subsp. lyrata
ref|XP_006285940.1|  hypothetical protein CARUB_v10007460mg             101   1e-20   
gb|KJB72745.1|  hypothetical protein B456_011G194100                    100   2e-20   Gossypium raimondii
ref|XP_010504697.1|  PREDICTED: topless-related protein 2               100   3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008223259.1|  PREDICTED: topless-related protein 2               100   3e-20   Prunus mume [ume]
ref|XP_006341391.1|  PREDICTED: protein TOPLESS-like                    100   3e-20   
ref|XP_010318715.1|  PREDICTED: protein TOPLESS-like isoform X1         100   3e-20   Solanum lycopersicum
ref|XP_002960294.1|  hypothetical protein SELMODRAFT_163891             100   3e-20   
ref|XP_006414395.1|  hypothetical protein EUTSA_v10024263mg             100   3e-20   Eutrema salsugineum [saltwater cress]
gb|EYU21684.1|  hypothetical protein MIMGU_mgv1a000459mg                100   3e-20   Erythranthe guttata [common monkey flower]
ref|XP_009346204.1|  PREDICTED: topless-related protein 2-like is...    100   3e-20   Pyrus x bretschneideri [bai li]
ref|XP_002967419.1|  hypothetical protein SELMODRAFT_439915             100   3e-20   
ref|XP_010050139.1|  PREDICTED: topless-related protein 4-like          100   4e-20   
ref|XP_009346203.1|  PREDICTED: topless-related protein 2-like is...    100   4e-20   Pyrus x bretschneideri [bai li]
ref|XP_008655511.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...    100   4e-20   
ref|XP_009382516.1|  PREDICTED: topless-related protein 2-like is...    100   4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011073378.1|  PREDICTED: protein TOPLESS                       99.8    6e-20   Sesamum indicum [beniseed]
gb|EMS62858.1|  Topless-related protein 2                             99.8    7e-20   Triticum urartu
ref|XP_002309645.1|  WD-40 repeat family protein                      99.4    7e-20   Populus trichocarpa [western balsam poplar]
ref|XP_006855163.1|  hypothetical protein AMTR_s00051p00079490        99.4    7e-20   Amborella trichopoda
ref|XP_009405763.1|  PREDICTED: protein TOPLESS-like isoform X3       99.4    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009405760.1|  PREDICTED: protein TOPLESS-like isoform X1       99.4    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002324880.2|  WD-40 repeat family protein                      99.4    8e-20   
ref|XP_009405761.1|  PREDICTED: protein TOPLESS-like isoform X2       99.4    9e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010241551.1|  PREDICTED: topless-related protein 1-like is...  98.6    1e-19   Nelumbo nucifera [Indian lotus]
ref|XP_010241550.1|  PREDICTED: topless-related protein 4-like is...  98.6    1e-19   
gb|KJB34663.1|  hypothetical protein B456_006G077300                  98.6    1e-19   Gossypium raimondii
ref|XP_007150781.1|  hypothetical protein PHAVU_005G180100g           98.6    1e-19   Phaseolus vulgaris [French bean]
gb|KJB34661.1|  hypothetical protein B456_006G077300                  98.6    2e-19   Gossypium raimondii
ref|XP_010318718.1|  PREDICTED: protein TOPLESS-like                  95.9    2e-19   Solanum lycopersicum
ref|XP_002870186.1|  predicted protein                                98.2    2e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_008340770.1|  PREDICTED: topless-related protein 2             98.2    2e-19   
ref|XP_008353208.1|  PREDICTED: topless-related protein 2-like        98.2    2e-19   
ref|XP_004486640.1|  PREDICTED: protein TOPLESS-like isoform X1       98.2    2e-19   Cicer arietinum [garbanzo]
ref|XP_006341390.1|  PREDICTED: protein TOPLESS-like                  94.0    2e-19   
ref|XP_009361201.1|  PREDICTED: topless-related protein 1-like is...  97.8    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009361190.1|  PREDICTED: topless-related protein 1-like is...  97.8    2e-19   Pyrus x bretschneideri [bai li]
ref|XP_009611336.1|  PREDICTED: protein TOPLESS-like                  97.8    2e-19   Nicotiana tomentosiformis
ref|XP_011036611.1|  PREDICTED: topless-related protein 1-like        97.8    2e-19   Populus euphratica
ref|XP_009796750.1|  PREDICTED: protein TOPLESS-like                  97.8    2e-19   Nicotiana sylvestris
ref|XP_008337262.1|  PREDICTED: topless-related protein 4             97.4    3e-19   
ref|XP_010539522.1|  PREDICTED: protein TOPLESS-like                  97.4    3e-19   Tarenaya hassleriana [spider flower]
gb|KCW80100.1|  hypothetical protein EUGRSUZ_C014271                  92.0    4e-19   Eucalyptus grandis [rose gum]
ref|XP_004296880.1|  PREDICTED: topless-related protein 2             97.4    4e-19   Fragaria vesca subsp. vesca
ref|XP_009395915.1|  PREDICTED: topless-related protein 1-like        97.1    4e-19   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002517701.1|  WD-repeat protein, putative                      97.1    5e-19   
ref|XP_002275116.1|  PREDICTED: protein TOPLESS isoform X3            97.1    5e-19   Vitis vinifera
ref|XP_010662133.1|  PREDICTED: protein TOPLESS isoform X1            97.1    5e-19   Vitis vinifera
ref|XP_004486641.1|  PREDICTED: protein TOPLESS-like isoform X2       97.1    5e-19   Cicer arietinum [garbanzo]
ref|XP_009363995.1|  PREDICTED: topless-related protein 4-like        97.1    5e-19   Pyrus x bretschneideri [bai li]
ref|XP_002268265.1|  PREDICTED: protein TOPLESS                       97.1    5e-19   Vitis vinifera
ref|XP_008385358.1|  PREDICTED: topless-related protein 4-like        92.8    5e-19   
ref|XP_010662135.1|  PREDICTED: protein TOPLESS isoform X4            96.7    6e-19   Vitis vinifera
ref|XP_010662134.1|  PREDICTED: protein TOPLESS isoform X2            96.7    6e-19   Vitis vinifera
ref|XP_008376897.1|  PREDICTED: topless-related protein 1-like is...  96.7    6e-19   Malus domestica [apple tree]
ref|XP_008376892.1|  PREDICTED: topless-related protein 1-like is...  96.7    6e-19   
ref|XP_010906011.1|  PREDICTED: protein TOPLESS                       96.7    6e-19   Elaeis guineensis
gb|KCW80088.1|  hypothetical protein EUGRSUZ_C01415                   93.2    6e-19   Eucalyptus grandis [rose gum]
gb|KCW80012.1|  hypothetical protein EUGRSUZ_C01349                   94.0    7e-19   Eucalyptus grandis [rose gum]
ref|XP_009368882.1|  PREDICTED: topless-related protein 4-like        96.3    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_010047998.1|  PREDICTED: topless-related protein 4-like is...  93.2    8e-19   
ref|XP_002443908.1|  hypothetical protein SORBIDRAFT_07g004180        96.3    8e-19   
ref|XP_011039630.1|  PREDICTED: topless-related protein 1-like is...  96.3    9e-19   Populus euphratica
ref|XP_011039629.1|  PREDICTED: topless-related protein 1-like is...  96.3    9e-19   Populus euphratica
emb|CDP10439.1|  unnamed protein product                              96.3    9e-19   Coffea canephora [robusta coffee]
ref|XP_010048001.1|  PREDICTED: topless-related protein 4-like is...  95.5    1e-18   
gb|KCW80076.1|  hypothetical protein EUGRSUZ_C01409                   95.5    1e-18   Eucalyptus grandis [rose gum]
ref|XP_008363005.1|  PREDICTED: topless-related protein 4-like        95.5    1e-18   
ref|XP_006389801.1|  hypothetical protein EUTSA_v10018037mg           95.9    1e-18   Eutrema salsugineum [saltwater cress]
ref|XP_006389802.1|  hypothetical protein EUTSA_v10018037mg           95.9    1e-18   
ref|XP_010050137.1|  PREDICTED: topless-related protein 1-like        94.0    1e-18   
ref|XP_010048000.1|  PREDICTED: topless-related protein 4-like is...  95.5    1e-18   
ref|XP_010047999.1|  PREDICTED: topless-related protein 4-like is...  95.5    1e-18   
ref|NP_001061055.1|  Os08g0162100                                     95.5    1e-18   
gb|KCW80086.1|  hypothetical protein EUGRSUZ_C01415                   93.2    1e-18   Eucalyptus grandis [rose gum]
ref|XP_010050598.1|  PREDICTED: topless-related protein 4-like        95.9    1e-18   
ref|XP_007138952.1|  hypothetical protein PHAVU_009G252100g           95.5    1e-18   Phaseolus vulgaris [French bean]
dbj|BAC99788.1|  WD-40 repeat protein-like                            95.5    2e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KHG27106.1|  Topless-related 1 -like protein                       95.5    2e-18   Gossypium arboreum [tree cotton]
ref|XP_007013512.1|  Transducin family protein / WD-40 repeat fam...  95.5    2e-18   
ref|XP_007013513.1|  Transducin family protein / WD-40 repeat fam...  95.5    2e-18   
ref|NP_563981.1|  protein TOPLESS                                     95.5    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAF82145.1|AC034256_9  Strong similarity to an unknown protein...  95.5    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KJB64727.1|  hypothetical protein B456_010G062200                  95.1    2e-18   Gossypium raimondii
ref|XP_004972767.1|  PREDICTED: topless-related protein 1-like        95.1    2e-18   Setaria italica
gb|KJB64729.1|  hypothetical protein B456_010G062200                  95.1    2e-18   Gossypium raimondii
ref|NP_001167872.2|  ramosa 1 enhancer locus 2                        95.1    2e-18   Zea mays [maize]
ref|XP_006597113.1|  PREDICTED: protein TOPLESS-like isoform X1       95.1    2e-18   Glycine max [soybeans]
ref|XP_007013509.1|  WUS-interacting protein 2 isoform 4              95.1    2e-18   
ref|XP_007013508.1|  WUS-interacting protein 2 isoform 3              95.1    2e-18   
ref|XP_007013506.1|  WUS-interacting protein 2 isoform 1              95.1    2e-18   
ref|XP_008813124.1|  PREDICTED: protein TOPLESS-like isoform X1       95.1    2e-18   
ref|XP_007013510.1|  WUS-interacting protein 2 isoform 5              95.1    2e-18   
ref|XP_007013507.1|  WUS-interacting protein 2 isoform 2              95.1    2e-18   
gb|KHN22427.1|  Topless-related protein 1                             95.1    2e-18   Glycine soja [wild soybean]
emb|CDO98186.1|  unnamed protein product                              95.1    2e-18   Coffea canephora [robusta coffee]
tpg|DAA53973.1|  TPA: hypothetical protein ZEAMMB73_351755            95.1    2e-18   
ref|XP_007214907.1|  hypothetical protein PRUPE_ppa000478mg           95.1    2e-18   Prunus persica
ref|XP_008228737.1|  PREDICTED: protein TOPLESS                       95.1    2e-18   Prunus mume [ume]
emb|CDY33387.1|  BnaC05g11960D                                        94.7    2e-18   Brassica napus [oilseed rape]
ref|XP_010047997.1|  PREDICTED: topless-related protein 4-like is...  93.2    2e-18   
ref|XP_006416884.1|  hypothetical protein EUTSA_v10006622mg           94.7    2e-18   Eutrema salsugineum [saltwater cress]
ref|XP_010497362.1|  PREDICTED: protein TOPLESS                       94.7    3e-18   Camelina sativa [gold-of-pleasure]
emb|CDY36584.1|  BnaA06g10370D                                        94.7    3e-18   Brassica napus [oilseed rape]
ref|XP_010250290.1|  PREDICTED: protein TOPLESS-like isoform X4       94.7    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010250289.1|  PREDICTED: protein TOPLESS-like isoform X3       94.7    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_010250287.1|  PREDICTED: protein TOPLESS-like isoform X1       94.7    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_009148962.1|  PREDICTED: protein TOPLESS                       94.7    3e-18   Brassica rapa
ref|XP_010250288.1|  PREDICTED: protein TOPLESS-like isoform X2       94.7    3e-18   Nelumbo nucifera [Indian lotus]
gb|KFK25571.1|  hypothetical protein AALP_AA8G132300                  93.6    3e-18   Arabis alpina [alpine rockcress]
gb|ACN26367.1|  unknown                                               92.4    3e-18   Zea mays [maize]
emb|CDY53312.1|  BnaA09g56690D                                        94.7    3e-18   Brassica napus [oilseed rape]
ref|XP_011457926.1|  PREDICTED: topless-related protein 4-like is...  94.4    3e-18   Fragaria vesca subsp. vesca
ref|XP_010656455.1|  PREDICTED: topless-related protein 4 isoform X5  94.4    3e-18   
ref|XP_010656454.1|  PREDICTED: topless-related protein 4 isoform X4  94.4    3e-18   Vitis vinifera
ref|XP_010656453.1|  PREDICTED: topless-related protein 4 isoform X2  94.4    3e-18   Vitis vinifera
ref|XP_002285341.2|  PREDICTED: topless-related protein 4 isoform X3  94.4    3e-18   Vitis vinifera
emb|CDX81729.1|  BnaC08g38720D                                        94.4    3e-18   
ref|XP_010656452.1|  PREDICTED: topless-related protein 4 isoform X1  94.4    3e-18   Vitis vinifera
ref|XP_011470141.1|  PREDICTED: topless-related protein 1-like is...  94.4    3e-18   Fragaria vesca subsp. vesca
ref|XP_011470140.1|  PREDICTED: topless-related protein 1-like is...  94.4    3e-18   Fragaria vesca subsp. vesca
ref|XP_006659155.1|  PREDICTED: protein TOPLESS-like                  94.4    3e-18   Oryza brachyantha
ref|XP_004287287.1|  PREDICTED: topless-related protein 4-like is...  94.4    3e-18   Fragaria vesca subsp. vesca
ref|XP_007135775.1|  hypothetical protein PHAVU_010G157700g           94.4    4e-18   Phaseolus vulgaris [French bean]
gb|KCW80072.1|  hypothetical protein EUGRSUZ_C01404                   94.0    4e-18   Eucalyptus grandis [rose gum]
ref|XP_010476664.1|  PREDICTED: protein TOPLESS-like                  94.4    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008788791.1|  PREDICTED: topless-related protein 1-like is...  94.0    4e-18   Phoenix dactylifera
gb|KCW80031.1|  hypothetical protein EUGRSUZ_C013682                  93.2    4e-18   Eucalyptus grandis [rose gum]
ref|XP_008788792.1|  PREDICTED: topless-related protein 1-like is...  94.4    4e-18   
ref|XP_011011325.1|  PREDICTED: protein TOPLESS-like                  94.0    4e-18   
ref|XP_006306622.1|  hypothetical protein CARUB_v10008139mg           94.0    4e-18   
ref|XP_004303268.1|  PREDICTED: protein TOPLESS isoform X1            94.0    4e-18   
ref|XP_006649759.1|  PREDICTED: protein TOPLESS-like                  94.0    4e-18   
gb|KCW80002.1|  hypothetical protein EUGRSUZ_C01336                   92.4    5e-18   
gb|KJB35153.1|  hypothetical protein B456_006G102300                  94.0    5e-18   
ref|XP_010532341.1|  PREDICTED: protein TOPLESS                       94.0    5e-18   
gb|KJB35154.1|  hypothetical protein B456_006G102300                  94.0    5e-18   
ref|XP_010928279.1|  PREDICTED: protein TOPLESS-like                  94.0    5e-18   
ref|XP_010244894.1|  PREDICTED: topless-related protein 1-like is...  94.0    5e-18   
ref|XP_010244893.1|  PREDICTED: topless-related protein 1-like is...  94.0    5e-18   
gb|KCW70755.1|  hypothetical protein EUGRSUZ_F03923                   94.0    5e-18   
ref|XP_010063532.1|  PREDICTED: protein TOPLESS isoform X2            94.0    5e-18   
ref|XP_006584165.1|  PREDICTED: protein TOPLESS-like                  93.6    5e-18   
ref|XP_006492116.1|  PREDICTED: protein TOPLESS-like isoform X1       93.6    6e-18   
ref|XP_006427463.1|  hypothetical protein CICLE_v10024745mg           93.6    6e-18   
gb|KCW70758.1|  hypothetical protein EUGRSUZ_F03923                   93.6    6e-18   
ref|XP_006427465.1|  hypothetical protein CICLE_v10024745mg           93.6    6e-18   
ref|XP_010063530.1|  PREDICTED: protein TOPLESS isoform X1            93.6    6e-18   
gb|AFP55591.1|  topless-related protein                               93.2    6e-18   
gb|KHN38006.1|  Topless-related protein 1                             93.2    6e-18   
ref|XP_006585625.1|  PREDICTED: protein TOPLESS-like isoform X1       93.6    6e-18   
ref|XP_007029511.1|  WD-40 repeat protein-like isoform 3              93.6    6e-18   
ref|XP_004307882.1|  PREDICTED: topless-related protein 1-like is...  93.6    7e-18   
ref|XP_011470138.1|  PREDICTED: topless-related protein 1-like is...  93.6    7e-18   
ref|XP_010691083.1|  PREDICTED: protein TOPLESS                       93.6    7e-18   
ref|XP_008372696.1|  PREDICTED: protein TOPLESS                       93.6    7e-18   
emb|CDX67950.1|  BnaA07g19900D                                        93.6    7e-18   
gb|AES86542.2|  topless-like protein                                  93.6    7e-18   
ref|XP_007029509.1|  WD-40 repeat protein-like isoform 1              93.2    8e-18   
ref|XP_009348312.1|  PREDICTED: protein TOPLESS-like                  93.2    8e-18   
ref|XP_009338495.1|  PREDICTED: protein TOPLESS                       93.2    8e-18   
ref|XP_010462721.1|  PREDICTED: protein TOPLESS-like                  92.8    8e-18   
ref|XP_006369294.1|  WD-40 repeat family protein                      93.2    8e-18   
gb|KGN52925.1|  hypothetical protein Csa_4G006320                     93.2    8e-18   
ref|XP_004165893.1|  PREDICTED: LOW QUALITY PROTEIN: protein TOPL...  93.2    8e-18   
ref|XP_004152185.1|  PREDICTED: protein TOPLESS-like                  93.2    8e-18   
ref|XP_011044877.1|  PREDICTED: topless-related protein 1 isoform X1  93.2    9e-18   
ref|XP_008454191.1|  PREDICTED: protein TOPLESS                       93.2    9e-18   
ref|XP_002892877.1|  wus-interacting protein 1                        93.2    9e-18   
ref|XP_008380984.1|  PREDICTED: topless-related protein 1-like        93.2    9e-18   
ref|XP_008801888.1|  PREDICTED: protein TOPLESS-like                  93.2    9e-18   
ref|XP_008788808.1|  PREDICTED: protein TOPLESS-like                  93.2    9e-18   
ref|XP_009117812.1|  PREDICTED: protein TOPLESS                       92.8    1e-17   
ref|XP_009397650.1|  PREDICTED: topless-related protein 1-like        92.8    1e-17   
ref|XP_009351851.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_009351850.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_009351849.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_009351848.1|  PREDICTED: topless-related protein 1-like is...  92.8    1e-17   
ref|XP_010942722.1|  PREDICTED: protein TOPLESS-like                  92.8    1e-17   
ref|XP_009400780.1|  PREDICTED: topless-related protein 1-like        92.8    1e-17   
ref|XP_011467045.1|  PREDICTED: protein TOPLESS isoform X2            92.8    1e-17   
gb|KCW59942.1|  hypothetical protein EUGRSUZ_H02668                   92.4    1e-17   
ref|XP_003597932.1|  WD repeat-containing protein, putative           92.8    1e-17   
ref|XP_006385279.1|  hypothetical protein POPTR_0003s02410g           90.5    1e-17   
gb|KGN60698.1|  hypothetical protein Csa_2G007420                     92.8    1e-17   
ref|XP_004139298.1|  PREDICTED: topless-related protein 4-like        92.8    1e-17   
ref|XP_003597931.1|  WD repeat-containing protein, putative           92.8    1e-17   
ref|XP_003597933.1|  WD repeat-containing protein, putative           92.8    1e-17   
gb|KCW80498.1|  hypothetical protein EUGRSUZ_C01846                   92.0    1e-17   
gb|KDO52285.1|  hypothetical protein CISIN_1g0012242mg                91.3    1e-17   
ref|XP_003599718.1|  WD repeat-containing protein, putative           92.4    1e-17   
gb|KCW80499.1|  hypothetical protein EUGRSUZ_C01846                   92.0    2e-17   
gb|KDO52287.1|  hypothetical protein CISIN_1g0012242mg                91.3    2e-17   
ref|XP_010026693.1|  PREDICTED: topless-related protein 4-like        92.4    2e-17   
gb|KHN01309.1|  Protein TOPLESS                                       91.3    2e-17   
ref|XP_002324641.2|  WD-40 repeat family protein                      92.4    2e-17   
ref|XP_010278757.1|  PREDICTED: topless-related protein 1-like is...  92.4    2e-17   
ref|XP_010278758.1|  PREDICTED: topless-related protein 1-like is...  92.4    2e-17   
ref|XP_010537925.1|  PREDICTED: protein TOPLESS-like                  92.4    2e-17   
ref|XP_010097168.1|  Protein TOPLESS                                  92.0    2e-17   
ref|XP_010472916.1|  PREDICTED: topless-related protein 1 isoform X1  92.0    2e-17   
ref|NP_178164.3|  Topless-related protein 1                           92.0    2e-17   
dbj|BAE98958.1|  hypothetical protein                                 92.0    2e-17   
ref|XP_006492117.1|  PREDICTED: protein TOPLESS-like isoform X2       92.0    2e-17   
ref|XP_006427464.1|  hypothetical protein CICLE_v10024745mg           92.0    2e-17   
gb|AAF27128.1|AC018849_16  unknown protein; 52184-57536               92.0    2e-17   
ref|XP_006301454.1|  hypothetical protein CARUB_v10021876mg           92.0    2e-17   
ref|NP_849913.2|  Topless-related protein 1                           92.0    2e-17   
ref|XP_002887825.1|  hypothetical protein ARALYDRAFT_895943           92.0    2e-17   
ref|XP_010472920.1|  PREDICTED: topless-related protein 1 isoform X4  92.0    2e-17   
ref|XP_010472918.1|  PREDICTED: topless-related protein 1 isoform X3  92.0    2e-17   
ref|XP_009407206.1|  PREDICTED: protein TOPLESS-like                  92.0    2e-17   
ref|XP_010472917.1|  PREDICTED: topless-related protein 1 isoform X2  92.0    2e-17   
gb|AAN62336.1|AF506028_3  CTV.2                                       92.0    2e-17   
ref|XP_010417699.1|  PREDICTED: topless-related protein 1-like        92.0    2e-17   
ref|XP_007220318.1|  hypothetical protein PRUPE_ppa000528m1g          91.3    2e-17   
ref|XP_006595172.1|  PREDICTED: protein TOPLESS-like isoform X3       92.0    2e-17   
ref|XP_010250163.1|  PREDICTED: protein TOPLESS-like                  91.7    2e-17   
ref|XP_008234585.1|  PREDICTED: topless-related protein 1-like        91.7    3e-17   
ref|XP_010927352.1|  PREDICTED: protein TOPLESS                       91.7    3e-17   
ref|XP_003543688.1|  PREDICTED: protein TOPLESS-like isoform X1       91.7    3e-17   
ref|XP_004165979.1|  PREDICTED: topless-related protein 4-like        90.9    3e-17   
ref|XP_007204297.1|  hypothetical protein PRUPE_ppa000492mg           91.7    3e-17   
ref|XP_010047995.1|  PREDICTED: uncharacterized protein LOC104436835  91.7    3e-17   
ref|XP_011470144.1|  PREDICTED: topless-related protein 1-like is...  91.7    3e-17   
ref|XP_011470143.1|  PREDICTED: topless-related protein 1-like is...  91.7    3e-17   
gb|AES68182.2|  topless-like protein                                  91.7    3e-17   
gb|KEH39610.1|  topless-like protein                                  91.7    3e-17   
ref|XP_002439315.1|  hypothetical protein SORBIDRAFT_09g004230        89.0    3e-17   
gb|AES68183.2|  topless-like protein                                  91.3    3e-17   
ref|XP_008219537.1|  PREDICTED: topless-related protein 1-like        91.3    3e-17   
gb|KCW80090.1|  hypothetical protein EUGRSUZ_C01417                   89.0    3e-17   
gb|KEH39609.1|  topless-like protein                                  91.3    3e-17   
emb|CAN64663.1|  hypothetical protein VITISV_035348                   91.3    4e-17   
ref|XP_007029510.1|  WD-40 repeat protein-like isoform 2              91.3    4e-17   
ref|XP_011017798.1|  PREDICTED: topless-related protein 4-like is...  91.3    4e-17   
ref|XP_011017797.1|  PREDICTED: topless-related protein 4-like is...  91.3    4e-17   
ref|XP_011017799.1|  PREDICTED: topless-related protein 4-like is...  91.3    4e-17   
ref|XP_007225505.1|  hypothetical protein PRUPE_ppa000570mg           91.3    4e-17   
ref|XP_002265778.1|  PREDICTED: topless-related protein 4             91.3    4e-17   
gb|KDO52286.1|  hypothetical protein CISIN_1g0012242mg                89.7    5e-17   
gb|KJB55044.1|  hypothetical protein B456_009G059700                  90.9    5e-17   
gb|EMS49891.1|  Topless-related protein 1                             90.9    5e-17   
gb|KJB26782.1|  hypothetical protein B456_004G259300                  90.9    5e-17   
ref|XP_010103710.1|  Topless-related protein 4                        90.9    5e-17   
gb|KHG11821.1|  Protein TOPLESS -like protein                         90.9    5e-17   
gb|EMT24067.1|  hypothetical protein F775_25939                       90.5    6e-17   
ref|XP_002520011.1|  conserved hypothetical protein                   90.5    6e-17   
ref|XP_008456978.1|  PREDICTED: topless-related protein 4-like is...  90.5    6e-17   
ref|XP_008456972.1|  PREDICTED: topless-related protein 4-like is...  90.5    6e-17   
gb|EEC74885.1|  hypothetical protein OsI_10796                        90.5    7e-17   
ref|XP_011044878.1|  PREDICTED: topless-related protein 1 isoform X2  90.5    7e-17   
ref|XP_010243111.1|  PREDICTED: protein TOPLESS-like                  90.5    7e-17   
gb|KHG17585.1|  Protein TOPLESS -like protein                         90.5    7e-17   
ref|XP_007023319.1|  TOPLESS-related 1 isoform 1                      90.5    7e-17   
ref|NP_001049587.1|  Os03g0254700                                     90.5    7e-17   
ref|XP_009396205.1|  PREDICTED: topless-related protein 1-like        90.5    7e-17   
gb|KHG04944.1|  Topless-related 1 -like protein                       90.5    7e-17   
gb|KJB68075.1|  hypothetical protein B456_010G224000                  90.1    8e-17   
ref|XP_008242803.1|  PREDICTED: topless-related protein 4-like        90.1    8e-17   
ref|XP_009104466.1|  PREDICTED: LOW QUALITY PROTEIN: topless-rela...  90.1    9e-17   
gb|KCW80006.1|  hypothetical protein EUGRSUZ_C013432                  87.0    9e-17   
ref|XP_007155033.1|  hypothetical protein PHAVU_003G167500g           90.1    1e-16   
ref|XP_007155035.1|  hypothetical protein PHAVU_003G167500g           90.1    1e-16   
ref|XP_007155032.1|  hypothetical protein PHAVU_003G167500g           90.1    1e-16   
ref|XP_007155034.1|  hypothetical protein PHAVU_003G167500g           90.1    1e-16   
ref|XP_003573449.1|  PREDICTED: topless-related protein 1-like        90.1    1e-16   
gb|EMT12268.1|  hypothetical protein F775_05335                       89.7    1e-16   
ref|XP_010046869.1|  PREDICTED: topless-related protein 4-like        87.0    1e-16   
emb|CDP19688.1|  unnamed protein product                              85.5    1e-16   
emb|CDX79383.1|  BnaC06g19200D                                        89.7    1e-16   
ref|XP_009772955.1|  PREDICTED: topless-related protein 4 isoform X1  89.7    1e-16   
ref|XP_009613434.1|  PREDICTED: topless-related protein 4 isoform X1  89.4    1e-16   
gb|KJB56591.1|  hypothetical protein B456_009G126400                  89.4    1e-16   
ref|XP_010087497.1|  Protein TOPLESS                                  89.4    1e-16   
gb|KEH32128.1|  topless-like protein                                  89.4    2e-16   
ref|XP_009395323.1|  PREDICTED: protein TOPLESS-like isoform X3       89.4    2e-16   
ref|XP_003609377.1|  WD repeat-containing protein                     89.4    2e-16   
gb|AES91574.2|  topless-like protein                                  89.4    2e-16   
ref|XP_009395318.1|  PREDICTED: protein TOPLESS-like isoform X1       89.4    2e-16   
ref|XP_009395322.1|  PREDICTED: protein TOPLESS-like isoform X2       89.4    2e-16   
ref|XP_011459156.1|  PREDICTED: topless-related protein 1-like        89.4    2e-16   
ref|XP_009355787.1|  PREDICTED: topless-related protein 1-like is...  89.0    2e-16   
ref|XP_009355784.1|  PREDICTED: topless-related protein 1-like is...  89.0    2e-16   
ref|XP_009355785.1|  PREDICTED: topless-related protein 1-like is...  89.0    2e-16   
ref|XP_010533140.1|  PREDICTED: topless-related protein 4-like        89.0    2e-16   
dbj|BAJ91520.1|  predicted protein                                    88.6    2e-16   
ref|XP_002967579.1|  hypothetical protein SELMODRAFT_88677            88.6    3e-16   
gb|KDP33561.1|  hypothetical protein JCGZ_07132                       88.6    3e-16   
ref|XP_011073420.1|  PREDICTED: topless-related protein 4             88.6    3e-16   
ref|XP_002981766.1|  hypothetical protein SELMODRAFT_115161           88.6    3e-16   
dbj|BAJ97681.1|  predicted protein                                    87.4    3e-16   
gb|EPS69099.1|  hypothetical protein M569_05666                       88.2    4e-16   
gb|ACF82743.1|  unknown                                               84.3    4e-16   
ref|XP_004508472.1|  PREDICTED: topless-related protein 4-like is...  87.8    5e-16   
ref|XP_004508471.1|  PREDICTED: topless-related protein 4-like is...  87.8    5e-16   
ref|XP_008456966.1|  PREDICTED: topless-related protein 4-like is...  87.8    5e-16   
ref|XP_008456943.1|  PREDICTED: topless-related protein 4-like is...  87.8    5e-16   
ref|XP_004984975.1|  PREDICTED: protein TOPLESS-like isoform X4       87.8    5e-16   
ref|XP_004984974.1|  PREDICTED: protein TOPLESS-like isoform X3       87.8    5e-16   
ref|XP_004984972.1|  PREDICTED: protein TOPLESS-like isoform X1       87.8    5e-16   
ref|XP_008803471.1|  PREDICTED: topless-related protein 1-like is...  87.8    6e-16   
ref|XP_008803470.1|  PREDICTED: topless-related protein 1-like is...  87.8    6e-16   
gb|EYU21655.1|  hypothetical protein MIMGU_mgv1a000483mg              87.4    6e-16   
gb|KDP30260.1|  hypothetical protein JCGZ_17042                       87.4    6e-16   
ref|XP_010244892.1|  PREDICTED: topless-related protein 1-like is...  87.4    6e-16   
ref|XP_010244887.1|  PREDICTED: topless-related protein 1-like is...  87.4    6e-16   
ref|XP_006594237.1|  PREDICTED: topless-related protein 4-like is...  87.4    7e-16   
ref|XP_006594236.1|  PREDICTED: topless-related protein 4-like is...  87.4    7e-16   
ref|XP_004235952.1|  PREDICTED: topless-related protein 4 isoform X1  87.4    7e-16   
ref|XP_006364222.1|  PREDICTED: topless-related protein 4-like        87.4    7e-16   
ref|XP_006381123.1|  hypothetical protein POPTR_0006s06570g           87.4    7e-16   
ref|XP_003549747.1|  PREDICTED: topless-related protein 4-like is...  87.4    7e-16   
ref|XP_006600746.1|  PREDICTED: topless-related protein 4-like is...  87.4    7e-16   
gb|AFK40029.1|  unknown                                               83.6    7e-16   
ref|XP_002527178.1|  WD-repeat protein, putative                      87.0    8e-16   
gb|KHN22119.1|  Topless-related protein 4                             87.0    8e-16   
ref|XP_009613435.1|  PREDICTED: topless-related protein 4 isoform X2  87.0    8e-16   
ref|XP_009772956.1|  PREDICTED: topless-related protein 4 isoform X2  87.0    9e-16   
ref|XP_006450874.1|  hypothetical protein CICLE_v10007287mg           87.0    1e-15   
ref|XP_011020159.1|  PREDICTED: topless-related protein 4-like is...  87.0    1e-15   
ref|XP_010318758.1|  PREDICTED: topless-related protein 4 isoform X2  87.0    1e-15   
ref|XP_002465540.1|  hypothetical protein SORBIDRAFT_01g040800        86.7    1e-15   
ref|XP_011036613.1|  PREDICTED: protein TOPLESS-like isoform X2       86.7    1e-15   
ref|XP_011036612.1|  PREDICTED: protein TOPLESS-like isoform X1       86.7    1e-15   
gb|KDO80174.1|  hypothetical protein CISIN_1g001163mg                 86.7    1e-15   
ref|XP_008394115.1|  PREDICTED: topless-related protein 1-like is...  86.7    1e-15   
gb|KDP37032.1|  hypothetical protein JCGZ_06088                       86.7    1e-15   
ref|XP_010943653.1|  PREDICTED: topless-related protein 1-like is...  86.7    1e-15   
ref|XP_010943652.1|  PREDICTED: topless-related protein 1-like is...  86.7    1e-15   
ref|XP_008394116.1|  PREDICTED: topless-related protein 1-like is...  86.7    1e-15   
gb|EPS67565.1|  hypothetical protein M569_07208                       83.6    1e-15   
ref|XP_006478899.1|  PREDICTED: protein TOPLESS-like isoform X1       86.7    1e-15   
ref|XP_010928337.1|  PREDICTED: protein TOPLESS-like isoform X3       86.7    1e-15   
ref|XP_006358294.1|  PREDICTED: topless-related protein 4-like is...  86.3    1e-15   
ref|XP_006358293.1|  PREDICTED: topless-related protein 4-like is...  86.3    1e-15   
ref|XP_010920062.1|  PREDICTED: protein TOPLESS-like                  86.3    1e-15   
ref|XP_010928339.1|  PREDICTED: protein TOPLESS-like isoform X5       86.3    2e-15   
ref|XP_010928338.1|  PREDICTED: protein TOPLESS-like isoform X4       86.3    2e-15   
ref|XP_010928336.1|  PREDICTED: protein TOPLESS-like isoform X2       86.3    2e-15   
ref|XP_010928335.1|  PREDICTED: protein TOPLESS-like isoform X1       86.3    2e-15   
ref|XP_004242769.1|  PREDICTED: topless-related protein 4-like is...  86.3    2e-15   
ref|XP_006443166.1|  hypothetical protein CICLE_v100185902mg          84.7    2e-15   
ref|XP_010323294.1|  PREDICTED: topless-related protein 4-like is...  86.3    2e-15   
gb|AFW88942.1|  hypothetical protein ZEAMMB73_764411                  85.1    2e-15   
ref|NP_001132574.1|  uncharacterized protein LOC100194042             82.8    2e-15   
gb|KDP21790.1|  hypothetical protein JCGZ_00577                       85.9    2e-15   
ref|XP_009803412.1|  PREDICTED: topless-related protein 4-like is...  85.5    3e-15   
ref|XP_009595073.1|  PREDICTED: topless-related protein 4-like is...  85.5    3e-15   



>ref|XP_010245461.1| PREDICTED: topless-related protein 2-like isoform X2 [Nelumbo 
nucifera]
Length=1126

 Score =   132 bits (333),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAYL QAV N N  VY +V+ AHPQEPNQLA 
Sbjct  1022  QLVYASFSDGNIGVFDADNLRLRCQIAPSAYLPQAVSNSNHAVYPLVVAAHPQEPNQLAI  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG++
Sbjct  1082  GLTDGSVKVIEPSESEGKWGVA  1103



>ref|XP_010245460.1| PREDICTED: topless-related protein 2-like isoform X1 [Nelumbo 
nucifera]
Length=1129

 Score =   132 bits (333),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAYL QAV N N  VY +V+ AHPQEPNQLA 
Sbjct  1025  QLVYASFSDGNIGVFDADNLRLRCQIAPSAYLPQAVSNSNHAVYPLVVAAHPQEPNQLAI  1084

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG++
Sbjct  1085  GLTDGSVKVIEPSESEGKWGVA  1106



>ref|XP_006344707.1| PREDICTED: topless-related protein 3-like isoform X1 [Solanum 
tuberosum]
Length=1155

 Score =   131 bits (329),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1046  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1105

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1106  GLTDGTVKVIEPLESDGKWGVS  1127



>emb|CDP17223.1| unnamed protein product [Coffea canephora]
Length=1132

 Score =   131 bits (329),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVLN ++ VY +VI AHPQ+PNQ A 
Sbjct  1022  QLVYASFCDGNIGVFDADTLRLRCRVAPSAYLSQAVLNGSQAVYPLVIAAHPQDPNQFAI  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG++
Sbjct  1082  GLTDGSVKVIEPQESEGKWGVT  1103



>ref|XP_006344709.1| PREDICTED: topless-related protein 3-like isoform X3 [Solanum 
tuberosum]
Length=1131

 Score =   130 bits (328),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1022  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1082  GLTDGTVKVIEPLESDGKWGVS  1103



>ref|XP_006344708.1| PREDICTED: topless-related protein 3-like isoform X2 [Solanum 
tuberosum]
Length=1132

 Score =   130 bits (328),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1023  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1083  GLTDGTVKVIEPLESDGKWGVS  1104



>ref|XP_004230269.1| PREDICTED: topless-related protein 3 isoform X3 [Solanum lycopersicum]
Length=1131

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1022  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1082  GLTDGTVKVIEPLESEGKWGVS  1103



>ref|XP_010313271.1| PREDICTED: topless-related protein 3 isoform X2 [Solanum lycopersicum]
Length=1132

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1023  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1083  GLTDGTVKVIEPLESEGKWGVS  1104



>ref|XP_010313267.1| PREDICTED: topless-related protein 3 isoform X1 [Solanum lycopersicum]
Length=1155

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC +APSAYLSQAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1046  QLVYASFSDGNIGVFDADTLRLRCRVAPSAYLSQAVLTGSQSVYPLVVAAHPQEPSQFAV  1105

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG++KVIEPLES G+WG+S
Sbjct  1106  GLTDGTVKVIEPLESEGKWGVS  1127



>ref|XP_009785868.1| PREDICTED: topless-related protein 3-like [Nicotiana sylvestris]
Length=1129

 Score =   129 bits (323),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 59/80 (74%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVLN ++ VY +VI AHPQEPNQ+A 
Sbjct  1019  QLVYASFCDGNIGVFDADSLRLKCHIAPSAYLSQAVLNGSQAVYPLVIAAHPQEPNQIAV  1078

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG +KVIEPLES G+WG
Sbjct  1079  GLSDGIVKVIEPLESEGKWG  1098



>ref|XP_011092107.1| PREDICTED: topless-related protein 3-like [Sesamum indicum]
Length=1129

 Score =   129 bits (323),  Expect = 6e-30, Method: Composition-based stats.
 Identities = 58/82 (71%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++ASF DGNIG+FDA  LR RC +APSAYLSQAVLN ++ VY VV+ AHPQEPNQ A 
Sbjct  1020  QLVFASFCDGNIGIFDADTLRLRCRVAPSAYLSQAVLNGSQAVYPVVVAAHPQEPNQFAV  1079

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES  +WG+S
Sbjct  1080  GLTDGSVKVIEPTESESKWGVS  1101



>gb|KDP23429.1| hypothetical protein JCGZ_23262 [Jatropha curcas]
Length=516

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = -2

Query  708  CQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLA  529
             QLIYA+F DGNIGVFDA  LR RC IA SAYLSQAVLN ++ VY +V+ AHPQEPNQL+
Sbjct  406  SQLIYATFCDGNIGVFDADSLRLRCRIASSAYLSQAVLNGSQSVYPLVVAAHPQEPNQLS  465

Query  528  FGLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG +
Sbjct  466  IGLTDGSVKVMEPTESEGKWGTT  488



>ref|XP_009766750.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
sylvestris]
Length=1131

 Score =   126 bits (317),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1022  QLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQAVYPLVVAAHPQEPSQFAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KVIEPLES G+WG+S
Sbjct  1082  GLSDGTVKVIEPLESEGKWGLS  1103



>ref|XP_009766749.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
sylvestris]
Length=1132

 Score =   126 bits (317),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1023  QLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQAVYPLVVAAHPQEPSQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KVIEPLES G+WG+S
Sbjct  1083  GLSDGTVKVIEPLESEGKWGLS  1104



>ref|XP_009616373.1| PREDICTED: topless-related protein 3-like [Nicotiana tomentosiformis]
Length=1132

 Score =   126 bits (316),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGN+GVFDA  LR RC +APSAYL QAVL  ++ VY +V+ AHPQEP+Q A 
Sbjct  1023  QLVYASFSDGNVGVFDADTLRLRCRVAPSAYLPQAVLTGSQSVYPLVVAAHPQEPSQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KVIEPLES G+WG+S
Sbjct  1083  GLSDGTVKVIEPLESEGKWGLS  1104



>emb|CAN79774.1| hypothetical protein VITISV_013612 [Vitis vinifera]
Length=1088

 Score =   125 bits (314),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAYLSQA LN ++  Y VV+ +HPQE NQLA 
Sbjct  979   QLIYATFCDGNIGVFDADSLRLRCRIAPSAYLSQAALNGSQPPYPVVVASHPQESNQLAV  1038

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG+S
Sbjct  1039  GLTDGSVKVIEPPESEGKWGVS  1060



>ref|XP_009611828.1| PREDICTED: topless-related protein 3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=1101

 Score =   125 bits (314),  Expect = 9e-29, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVL  ++ VY +VI AHPQEPNQ+A 
Sbjct  991   QLVYASFCDGNIGVFDADSLRLKCRIAPSAYLSQAVLIGSQAVYPLVIAAHPQEPNQIAV  1050

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG +KVIEPLES G+WG
Sbjct  1051  GLSDGIVKVIEPLESEGKWG  1070



>ref|XP_009611827.1| PREDICTED: topless-related protein 3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=1129

 Score =   125 bits (314),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR +C IAPSAYLSQAVL  ++ VY +VI AHPQEPNQ+A 
Sbjct  1019  QLVYASFCDGNIGVFDADSLRLKCRIAPSAYLSQAVLIGSQAVYPLVIAAHPQEPNQIAV  1078

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG +KVIEPLES G+WG
Sbjct  1079  GLSDGIVKVIEPLESEGKWG  1098



>ref|XP_007204953.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
 gb|EMJ06152.1| hypothetical protein PRUPE_ppa000487mg [Prunus persica]
Length=1134

 Score =   125 bits (313),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F D NIGVFDA  LR RC IAPSAYLSQAVLN ++ VY +V+  HPQEPNQ A 
Sbjct  1023  QLVYAAFSDSNIGVFDADTLRLRCRIAPSAYLSQAVLNGSQAVYPLVVAVHPQEPNQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1083  GLGDGSVKVIEPTESEGKWGSS  1104



>ref|XP_008795824.1| PREDICTED: topless-related protein 2-like [Phoenix dactylifera]
Length=1029

 Score =   124 bits (311),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 58/80 (73%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QL+YA+F DGNIGVFDA  LR RC IAPSAY+S A  N N  VY +VI AHPQEPNQLA 
Sbjct  920  QLVYATFCDGNIGVFDADNLRLRCRIAPSAYMSPATANSNLPVYPLVIAAHPQEPNQLAV  979

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GLTDG++KVIEPLES G+WG
Sbjct  980  GLTDGAVKVIEPLESEGKWG  999



>ref|XP_002283157.1| PREDICTED: topless-related protein 3 [Vitis vinifera]
 emb|CBI39553.3| unnamed protein product [Vitis vinifera]
Length=1132

 Score =   124 bits (311),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 59/82 (72%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAYLSQA LN ++  Y VV+ +HPQE NQLA 
Sbjct  1023  QLIYATFCDGNIGVFDADSLRLRCRIAPSAYLSQAGLNGSQPPYPVVVASHPQESNQLAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG+S
Sbjct  1083  GLTDGSVKVIEPPESEGKWGVS  1104



>ref|XP_008790866.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Phoenix dactylifera]
Length=1138

 Score =   124 bits (310),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 57/80 (71%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC I PSAY+S A  N N  VY +V+ AHPQEPNQLA 
Sbjct  1027  QLVYASFCDGNIGVFDADNLRLRCRIGPSAYMSPASANSNPPVYPLVVAAHPQEPNQLAV  1086

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEPLES G+WG
Sbjct  1087  GLTDGAVKVIEPLESEGKWG  1106



>ref|XP_010259448.1| PREDICTED: topless-related protein 2 isoform X1 [Nelumbo nucifera]
Length=1136

 Score =   123 bits (309),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQLA 
Sbjct  1027  QLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSNSSHAVYPLVVAAHPQEPNQLAV  1086

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS KVIEP ES G+WG++
Sbjct  1087  GLTDGSAKVIEPSESEGKWGVT  1108



>ref|XP_010259450.1| PREDICTED: topless-related protein 2 isoform X3 [Nelumbo nucifera]
Length=1099

 Score =   123 bits (308),  Expect = 6e-28, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQLA 
Sbjct  990   QLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSNSSHAVYPLVVAAHPQEPNQLAV  1049

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS KVIEP ES G+WG++
Sbjct  1050  GLTDGSAKVIEPSESEGKWGVT  1071



>ref|XP_008245640.1| PREDICTED: topless-related protein 3 [Prunus mume]
Length=1134

 Score =   122 bits (305),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F D NIGVFDA  LR RC IAPSAYLS AVLN ++ VY +V+  HPQEPNQ A 
Sbjct  1023  QLVYAAFSDSNIGVFDADTLRLRCRIAPSAYLSLAVLNGSQAVYPLVVAVHPQEPNQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1083  GLGDGSVKVIEPTESEGKWGSS  1104



>ref|XP_006644007.1| PREDICTED: topless-related protein 2-like [Oryza brachyantha]
Length=1128

 Score =   122 bits (305),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIG+FD   LR RC IAP AY+S A +N N  VY +V+ AHPQEPNQ A 
Sbjct  1019  QLVFAAFTDGNIGIFDVENLRLRCRIAPPAYMSSATINSNPSVYPLVVAAHPQEPNQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEPLES G+WG +
Sbjct  1079  GLSDGSVKVIEPLESEGKWGTT  1100



>ref|XP_002512473.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF49925.1| WD-repeat protein, putative [Ricinus communis]
Length=1132

 Score =   122 bits (305),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLI+ASF+DGNIGVFDA  LR RC IAPSAYLS AVLN ++ +Y +V+ AHP E NQLA 
Sbjct  1023  QLIFASFRDGNIGVFDADSLRLRCRIAPSAYLSPAVLNGSQSIYPLVVAAHPHETNQLAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP  S G+WG S
Sbjct  1083  GLTDGSVKVMEPKASDGKWGTS  1104



>ref|XP_008388509.1| PREDICTED: topless-related protein 3-like [Malus domestica]
Length=1135

 Score =   121 bits (304),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAYL QAVLN ++ +Y +V+  HPQEP Q A 
Sbjct  1025  QLIYAAFYDGNIGVFDADSLRLRCRIAPSAYLPQAVLNGSQAMYPLVVAVHPQEPTQFAV  1084

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1085  GLGDGSVKVIEPKESEGKWGSS  1106



>gb|KDO81757.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1128

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ A 
Sbjct  1020  QLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQFAI  1079

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG+S
Sbjct  1080  GLTDGSVKVMEPSESEGKWGVS  1101



>ref|XP_006433483.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
 gb|ESR46723.1| hypothetical protein CICLE_v10000084mg [Citrus clementina]
Length=1130

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ A 
Sbjct  1022  QLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQFAI  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG+S
Sbjct  1082  GLTDGSVKVMEPSESEGKWGVS  1103



>gb|KDO81755.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1101

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ A 
Sbjct  993   QLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQFAI  1052

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG+S
Sbjct  1053  GLTDGSVKVMEPSESEGKWGVS  1074



>gb|KDO81756.1| hypothetical protein CISIN_1g001190mg [Citrus sinensis]
Length=1096

 Score =   120 bits (302),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY +V+ AHP EPNQ A 
Sbjct  988   QLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPLVVAAHPLEPNQFAI  1047

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG+S
Sbjct  1048  GLTDGSVKVMEPSESEGKWGVS  1069



>ref|XP_010094719.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB56799.1| Topless-related protein 3 [Morus notabilis]
Length=1117

 Score =   120 bits (301),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFD   LR RC IAPSAY SQAVLN ++ VY +V+ AHP E NQ A 
Sbjct  1023  QLIYATFCDGNIGVFDPDSLRLRCRIAPSAYFSQAVLNGSQAVYPLVVAAHPHEANQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+ G+WG +
Sbjct  1083  GLTDGSVKVIEPTEAEGKWGTA  1104



>ref|XP_004144768.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
 gb|KGN60972.1| hypothetical protein Csa_2G033270 [Cucumis sativus]
Length=1127

 Score =   120 bits (301),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGN+GVFDA  LR RC IAPS YL  AVLN ++ +Y +V+  HP +PNQLA 
Sbjct  1018  QLVYATFCDGNVGVFDADTLRLRCRIAPSVYLPSAVLNSSQAIYPLVVATHPLDPNQLAI  1077

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ES G+WG+S
Sbjct  1078  GLSDGSVKVIEPTESEGKWGVS  1099



>ref|XP_004158753.1| PREDICTED: topless-related protein 3-like [Cucumis sativus]
Length=1126

 Score =   120 bits (300),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGN+GVFDA  LR RC IAPS YL  AVLN ++ +Y +V+  HP +PNQLA 
Sbjct  1017  QLVYATFCDGNVGVFDADTLRLRCRIAPSVYLPSAVLNSSQAIYPLVVATHPLDPNQLAI  1076

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ES G+WG+S
Sbjct  1077  GLSDGSVKVIEPTESEGKWGVS  1098



>ref|XP_010921589.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1135

 Score =   119 bits (299),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAP AY+S A  N N  VY +VI AHPQEPNQLA 
Sbjct  1026  QLVYATFCDGNIGVFDADNLRLRCRIAPLAYMSPASANSNPPVYPLVIAAHPQEPNQLAV  1085

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEP ES G+WG
Sbjct  1086  GLTDGAVKVIEPSESEGKWG  1105



>ref|XP_010921588.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1136

 Score =   119 bits (299),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/80 (70%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAP AY+S A  N N  VY +VI AHPQEPNQLA 
Sbjct  1027  QLVYATFCDGNIGVFDADNLRLRCRIAPLAYMSPASANSNPPVYPLVIAAHPQEPNQLAV  1086

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEP ES G+WG
Sbjct  1087  GLTDGAVKVIEPSESEGKWG  1106



>ref|XP_006419483.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
 gb|ESR32723.1| hypothetical protein CICLE_v10004197mg [Citrus clementina]
Length=1131

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQLA 
Sbjct  1022  QLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQLAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+  +WG++
Sbjct  1082  GLTDGSVKVIEPSETERKWGVA  1103



>gb|EAY73338.1| hypothetical protein OsI_01216 [Oryza sativa Indica Group]
Length=1118

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIG+FD   LR RC IAP AYLS A +N N  VY +V+ AHPQE NQ A 
Sbjct  1009  QLVFAAFTDGNIGIFDVENLRLRCRIAPPAYLSSAAINSNPSVYPLVVAAHPQESNQFAV  1068

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEPLES G+WG +
Sbjct  1069  GLSDGSVKVIEPLESEGKWGTT  1090



>ref|XP_004494565.1| PREDICTED: topless-related protein 3-like [Cicer arietinum]
Length=1151

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGN GVFDA  LR RC IAPS Y + + LN ++GVY VV+ AHP EPNQ A 
Sbjct  1041  QLIYATFCDGNTGVFDADSLRLRCRIAPSMYFTPSTLNGSQGVYPVVVAAHPLEPNQFAL  1100

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1101  GLTDGSVKVIEPNESEGKWGSS  1122



>ref|XP_006489020.1| PREDICTED: topless-related protein 2-like isoform X2 [Citrus 
sinensis]
Length=1131

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQLA 
Sbjct  1022  QLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQLAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+  +WG++
Sbjct  1082  GLTDGSVKVIEPSETERKWGVA  1103



>gb|KDO71780.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1131

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQLA 
Sbjct  1022  QLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPNSSQTVFPLVVTSHPQEPNQLAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+  +WG++
Sbjct  1082  GLTDGSVKVIEPSETERKWGVA  1103



>ref|XP_006472151.1| PREDICTED: topless-related protein 3-like [Citrus sinensis]
Length=1128

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIGVFDA  LR RC IAPS YLS +VLN ++ VY  V+ AHP EPNQ A 
Sbjct  1020  QLVFATFCDGNIGVFDADTLRLRCYIAPSTYLSPSVLNGSQTVYPHVVAAHPLEPNQFAI  1079

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG+S
Sbjct  1080  GLTDGSVKVMEPSESEGKWGVS  1101



>ref|XP_010259449.1| PREDICTED: topless-related protein 2 isoform X2 [Nelumbo nucifera]
Length=1135

 Score =   119 bits (298),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAPS+YL Q+V N +  VY +V+ AHPQEPNQLA 
Sbjct  1027  QLVYATFCDGNIGVFDADSLRLRCRIAPSSYLPQSVSN-SHAVYPLVVAAHPQEPNQLAV  1085

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS KVIEP ES G+WG++
Sbjct  1086  GLTDGSAKVIEPSESEGKWGVT  1107



>ref|NP_001042616.1| Os01g0254100 [Oryza sativa Japonica Group]
 dbj|BAD81067.1| putative CTV.2 [Oryza sativa Japonica Group]
 dbj|BAF04530.1| Os01g0254100 [Oryza sativa Japonica Group]
 gb|EEE54253.1| hypothetical protein OsJ_01134 [Oryza sativa Japonica Group]
 dbj|BAL44268.1| ASPR2 protein [Oryza sativa Japonica Group]
Length=1129

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGNIG+FD   LR RC IAP AYLS A +N N  VY +V+ AHPQE NQ A 
Sbjct  1020  QLVFAAFTDGNIGIFDVENLRLRCRIAPPAYLSSAAINSNPSVYPLVVAAHPQESNQFAV  1079

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEPLES G+WG +
Sbjct  1080  GLSDGSVKVIEPLESEGKWGTT  1101



>ref|XP_009338219.1| PREDICTED: topless-related protein 3 isoform X2 [Pyrus x bretschneideri]
Length=1123

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAYL Q VLN ++ +Y +V+  HPQEP Q A 
Sbjct  1013  QLIYAAFCDGNIGVFDADSLRLRCRIAPSAYLPQVVLNGSQAMYPLVVAVHPQEPTQFAV  1072

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1073  GLGDGSVKVIEPNESEGKWGSS  1094



>ref|XP_009338217.1| PREDICTED: topless-related protein 3 isoform X1 [Pyrus x bretschneideri]
Length=1135

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAYL Q VLN ++ +Y +V+  HPQEP Q A 
Sbjct  1025  QLIYAAFCDGNIGVFDADSLRLRCRIAPSAYLPQVVLNGSQAMYPLVVAVHPQEPTQFAV  1084

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1085  GLGDGSVKVIEPNESEGKWGSS  1106



>ref|XP_004508183.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1125

 Score =   119 bits (297),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 64/82 (78%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IA SAYL Q+  N ++ +Y  VI AHPQEPNQ A 
Sbjct  1022  QLVYAAFTDGNIGVFDADSLRLRCRIASSAYLHQSSSN-SQNIYPFVIAAHPQEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DGSIKVIEPLES G WG+S
Sbjct  1081  GMSDGSIKVIEPLESNGRWGVS  1102



>ref|XP_010938347.1| PREDICTED: topless-related protein 2-like isoform X2 [Elaeis 
guineensis]
Length=1134

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG+IGVFDA  LR RC I PSAY+S A  N N  V+ +V+ AHPQEPNQLA 
Sbjct  1025  QLVYASFWDGSIGVFDADYLRLRCRIGPSAYMSPANANSNPPVHPLVVAAHPQEPNQLAV  1084

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEPLES G+WG
Sbjct  1085  GLTDGAVKVIEPLESEGKWG  1104



>ref|XP_010938346.1| PREDICTED: topless-related protein 2-like isoform X1 [Elaeis 
guineensis]
Length=1135

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG+IGVFDA  LR RC I PSAY+S A  N N  V+ +V+ AHPQEPNQLA 
Sbjct  1026  QLVYASFWDGSIGVFDADYLRLRCRIGPSAYMSPANANSNPPVHPLVVAAHPQEPNQLAV  1085

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEPLES G+WG
Sbjct  1086  GLTDGAVKVIEPLESEGKWG  1105



>ref|XP_010024094.1| PREDICTED: topless-related protein 3 isoform X2 [Eucalyptus grandis]
Length=1130

 Score =   118 bits (296),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQLA 
Sbjct  1021  QLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQLAI  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG +
Sbjct  1081  GLTDGSVKVLEPTESDGKWGAT  1102



>ref|XP_010024093.1| PREDICTED: topless-related protein 3 isoform X1 [Eucalyptus grandis]
 gb|KCW60527.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1137

 Score =   118 bits (296),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQLA 
Sbjct  1028  QLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQLAI  1087

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG +
Sbjct  1088  GLTDGSVKVLEPTESDGKWGAT  1109



>gb|KCW60526.1| hypothetical protein EUGRSUZ_H03269 [Eucalyptus grandis]
Length=1138

 Score =   118 bits (296),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF DGN+GVFDA  LR RC I PS YL Q +L  ++ VY +VI  HP EPNQLA 
Sbjct  1029  QLIYASFCDGNVGVFDADTLRLRCRIGPSTYLPQPILTGSQAVYPLVIATHPHEPNQLAI  1088

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KV+EP ES G+WG +
Sbjct  1089  GLTDGSVKVLEPTESDGKWGAT  1110



>ref|XP_008370406.1| PREDICTED: topless-related protein 3-like isoform X2 [Malus domestica]
Length=1123

 Score =   118 bits (295),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAY+ QA LN ++ +Y +V+  HPQEP Q A 
Sbjct  1013  QLIYAAFCDGNIGVFDADSLRLRCRIAPSAYIPQAALNGSQAMYPLVVAVHPQEPTQFAV  1072

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1073  GLGDGSVKVIEPNESEGKWGSS  1094



>ref|XP_008370405.1| PREDICTED: topless-related protein 3-like isoform X1 [Malus domestica]
Length=1135

 Score =   118 bits (295),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAY+ QA LN ++ +Y +V+  HPQEP Q A 
Sbjct  1025  QLIYAAFCDGNIGVFDADSLRLRCRIAPSAYIPQAALNGSQAMYPLVVAVHPQEPTQFAV  1084

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL DGS+KVIEP ES G+WG S
Sbjct  1085  GLGDGSVKVIEPNESEGKWGSS  1106



>ref|XP_008453896.1| PREDICTED: topless-related protein 3-like [Cucumis melo]
Length=1127

 Score =   117 bits (294),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  LR RC IAPS YL   +LN ++ +Y +V+  HP +PNQLA 
Sbjct  1018  QLVYATFCDGNIGVFDADTLRLRCRIAPSVYLPPTLLNSSQAIYPLVVATHPLDPNQLAI  1077

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ES G+WG+S
Sbjct  1078  GLSDGSVKVIEPTESEGKWGVS  1099



>ref|XP_010086586.1| Topless-related protein 3 [Morus notabilis]
 gb|EXB21430.1| Topless-related protein 3 [Morus notabilis]
Length=1132

 Score =   117 bits (293),  Expect = 7e-26, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFD   LR RC IAPSAY SQAVLN ++ VY +V+ AHP E NQ A 
Sbjct  1023  QLIYATFCDCNIGVFDPDSLRLRCRIAPSAYFSQAVLNGSQAVYPLVVAAHPHEANQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+ G+WG +
Sbjct  1083  GLTDGSVKVIEPTEAEGKWGTA  1104



>ref|XP_007163344.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35338.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1102

 Score =   117 bits (292),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGN GVFDA  LR RC IA S Y S A L+ N+ VY VV+ AHP EPNQ A 
Sbjct  993   QLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPATLSVNQSVYPVVVAAHPAEPNQFAV  1052

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1053  GLTDGSVKVIEPCESEGKWGTS  1074



>ref|XP_007163345.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
 gb|ESW35339.1| hypothetical protein PHAVU_001G227000g [Phaseolus vulgaris]
Length=1130

 Score =   116 bits (291),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGN GVFDA  LR RC IA S Y S A L+ N+ VY VV+ AHP EPNQ A 
Sbjct  1021  QLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPATLSVNQSVYPVVVAAHPAEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1081  GLTDGSVKVIEPCESEGKWGTS  1102



>ref|XP_007099669.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY20361.1| TOPLESS-related 3 [Theobroma cacao]
Length=238

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q +YA+F DGN+GVF+A  LR RC IA S YLSQA+L   + VY +V+ AHP E NQ A 
Sbjct  129  QSVYATFLDGNVGVFEADSLRLRCRIASSVYLSQAILKGKQAVYPLVVAAHPMEANQFAI  188

Query  525  GLTDGSIKVIEPLESGGEWGISR  457
            GL+DGS+KV+EP ES G+WG+S+
Sbjct  189  GLSDGSVKVMEPTESEGKWGVSQ  211



>dbj|BAJ96033.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03414.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ A 
Sbjct  1021  QLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1081  GLSDGSVKVMEPLESDGKWG  1100



>dbj|BAJ85297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1130

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ A 
Sbjct  1021  QLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1081  GLSDGSVKVMEPLESDGKWG  1100



>ref|XP_003566431.1| PREDICTED: topless-related protein 2-like isoform X1 [Brachypodium 
distachyon]
Length=1132

 Score =   115 bits (288),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ A 
Sbjct  1023  QLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KV+EPLES G+WG S
Sbjct  1083  GLSDGSVKVMEPLESDGKWGTS  1104



>ref|XP_010230707.1| PREDICTED: topless-related protein 2-like isoform X3 [Brachypodium 
distachyon]
Length=1116

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ A 
Sbjct  1007  QLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQFAV  1066

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KV+EPLES G+WG S
Sbjct  1067  GLSDGSVKVMEPLESDGKWGTS  1088



>ref|XP_010230706.1| PREDICTED: topless-related protein 2-like isoform X2 [Brachypodium 
distachyon]
Length=1121

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S    N N  VY  V+ AHPQEPNQ A 
Sbjct  1012  QLVFAAFTDGNVAIFDAENLRLRCRIASSAYMSSTATNSNPPVYPYVVAAHPQEPNQFAV  1071

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KV+EPLES G+WG S
Sbjct  1072  GLSDGSVKVMEPLESDGKWGTS  1093



>ref|XP_010546750.1| PREDICTED: topless-related protein 3 isoform X1 [Tarenaya hassleriana]
Length=1110

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F+DGNIGVFDA  LR RC IAPSAYLSQ     ++G+  +V+ AHP EPNQLA 
Sbjct  1007  QLIYAAFRDGNIGVFDADSLRLRCRIAPSAYLSQG----SQGLPPLVVAAHPHEPNQLAV  1062

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E  G+WG+
Sbjct  1063  GLTDGSVKVIEPTEPEGKWGM  1083



>ref|XP_010546752.1| PREDICTED: topless-related protein 3 isoform X2 [Tarenaya hassleriana]
Length=1108

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 54/81 (67%), Positives = 64/81 (79%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F+DGNIGVFDA  LR RC IAPSAYLSQ     ++G+  +V+ AHP EPNQLA 
Sbjct  1005  QLIYAAFRDGNIGVFDADSLRLRCRIAPSAYLSQG----SQGLPPLVVAAHPHEPNQLAV  1060

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E  G+WG+
Sbjct  1061  GLTDGSVKVIEPTEPEGKWGM  1081



>ref|XP_006606545.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN20263.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score =   115 bits (287),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ A 
Sbjct  1021  QLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1081  GLTDGSVKVIEPNESEGKWGTS  1102



>ref|XP_004495685.1| PREDICTED: topless-related protein 3-like isoform X2 [Cicer arietinum]
Length=1123

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D NIGVFDA  L+ RC IAPS  LS A LNR++ VY +VI  HP EPNQ A 
Sbjct  1019  QLIYASFCDANIGVFDADSLKLRCRIAPSICLSSAALNRSQAVYPLVIATHPLEPNQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DGS+KVIEP ES G+WG S
Sbjct  1079  GMSDGSVKVIEPSESEGKWGSS  1100



>ref|XP_004495684.1| PREDICTED: topless-related protein 3-like isoform X1 [Cicer arietinum]
Length=1124

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D NIGVFDA  L+ RC IAPS  LS A LNR++ VY +VI  HP EPNQ A 
Sbjct  1020  QLIYASFCDANIGVFDADSLKLRCRIAPSICLSSAALNRSQAVYPLVIATHPLEPNQFAV  1079

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DGS+KVIEP ES G+WG S
Sbjct  1080  GMSDGSVKVIEPSESEGKWGSS  1101



>dbj|BAJ88304.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=609

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  708  CQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLA  529
             QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ A
Sbjct  499  SQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQFA  558

Query  528  FGLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KV+EPLES G+WG 
Sbjct  559  VGLSDGSVKVMEPLESDGKWGT  580



>ref|XP_006489019.1| PREDICTED: topless-related protein 2-like isoform X1 [Citrus 
sinensis]
Length=1130

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQLA 
Sbjct  1022  QLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPN-SQTVFPLVVTSHPQEPNQLAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+  +WG++
Sbjct  1081  GLTDGSVKVIEPSETERKWGVA  1102



>ref|XP_004967836.1| PREDICTED: topless-related protein 2-like [Setaria italica]
Length=1130

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+GVFDA  LR RC IAPS Y+S   +N N  V+ +V+ AHP EPNQ A 
Sbjct  1021  QLVFAAFADGNVGVFDAENLRLRCRIAPSVYMSLTAINSNPPVHPLVVAAHPNEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1081  GLSDGSVKVLEPLESEGKWG  1100



>gb|KDO71781.1| hypothetical protein CISIN_1g001178mg [Citrus sinensis]
Length=1130

 Score =   115 bits (287),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 53/82 (65%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DG+IGVFDA  LR RC IAPSAY+SQA  N ++ V+ +V+ +HPQEPNQLA 
Sbjct  1022  QLIYATFTDGSIGVFDADSLRLRCRIAPSAYMSQASPN-SQTVFPLVVTSHPQEPNQLAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E+  +WG++
Sbjct  1081  GLTDGSVKVIEPSETERKWGVA  1102



>ref|XP_003591186.1| WD repeat-containing protein [Medicago truncatula]
Length=1140

 Score =   114 bits (286),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D NIGVFDA  LR RC IAP   LS A L+R++ VY +VI AHP EPNQ A 
Sbjct  1031  QLIYASFCDANIGVFDADSLRLRCRIAPPICLSSAALSRSQAVYPLVIAAHPLEPNQFAV  1090

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ES G+WG S
Sbjct  1091  GLSDGSVKVIEPSESEGKWGSS  1112



>ref|XP_010043204.1| PREDICTED: topless-related protein 3-like [Eucalyptus grandis]
 gb|KCW85231.1| hypothetical protein EUGRSUZ_B02075 [Eucalyptus grandis]
Length=1131

 Score =   114 bits (286),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 52/81 (64%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA+F DGNIGVFDA  LR RC IAPS YLS   LN ++ VY  V+  HP EPNQLA G
Sbjct  1023  LVYATFCDGNIGVFDADNLRLRCRIAPSTYLSHGALNGSQPVYPFVVATHPVEPNQLAVG  1082

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             LTDGS+KV+EP ES G+WG +
Sbjct  1083  LTDGSVKVMEPAESDGKWGAT  1103



>gb|ABD28351.1| Lissencephaly type-1-like homology motif; CTLH, C-terminal to 
LisH motif; Nitrous oxide reductase, N-terminal; WD40-like; 
Quinonprotein alcohol dehydrogenase-like [Medicago truncatula]
 gb|AES61437.2| topless-like protein [Medicago truncatula]
Length=1128

 Score =   114 bits (286),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 55/82 (67%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D NIGVFDA  LR RC IAP   LS A L+R++ VY +VI AHP EPNQ A 
Sbjct  1019  QLIYASFCDANIGVFDADSLRLRCRIAPPICLSSAALSRSQAVYPLVIAAHPLEPNQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ES G+WG S
Sbjct  1079  GLSDGSVKVIEPSESEGKWGSS  1100



>gb|AAB61051.1| Hypothetical protein F2P16.14 [Arabidopsis thaliana]
Length=123

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ A 
Sbjct  24   QLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQFAV  79

Query  525  GLTDGSIKVIEPLESGGEWGI  463
            GL DGS+K++EP E  G+WG+
Sbjct  80   GLNDGSVKMMEPTEGEGKWGM  100



>emb|CDM82632.1| unnamed protein product [Triticum aestivum]
Length=1130

 Score =   114 bits (285),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  VY  V+  HPQEPNQ A 
Sbjct  1021  QLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPVYPFVVAGHPQEPNQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1081  GLSDGSVKVMEPLESDGKWG  1100



>gb|KHN16088.1| Topless-related protein 3 [Glycine soja]
Length=1121

 Score =   114 bits (284),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ A 
Sbjct  1012  QLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQFAV  1071

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDGS+KVIEP ES G+WG
Sbjct  1072  GLTDGSVKVIEPNESEGKWG  1091



>ref|XP_006589130.1| PREDICTED: topless-related protein 3-like isoform X1 [Glycine 
max]
Length=1129

 Score =   114 bits (284),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ A 
Sbjct  1020  QLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQFAV  1079

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDGS+KVIEP ES G+WG
Sbjct  1080  GLTDGSVKVIEPNESEGKWG  1099



>ref|XP_006589131.1| PREDICTED: topless-related protein 3-like isoform X2 [Glycine 
max]
Length=1153

 Score =   114 bits (284),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFDA  LR RC IAPS  LS A L+ ++GVY +V+ AHP EPNQ A 
Sbjct  1044  QLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALSGSQGVYPLVVAAHPLEPNQFAV  1103

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDGS+KVIEP ES G+WG
Sbjct  1104  GLTDGSVKVIEPNESEGKWG  1123



>dbj|BAJ91882.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   113 bits (282),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QL++A+F DGN+ +FDA  LR RC IA SAY+S A +N N  +Y  V+ AHPQEPNQ A 
Sbjct  661  QLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTAAINSNPPIYPFVVAAHPQEPNQFAV  720

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GL+DGS+KV+EPLES G+WG
Sbjct  721  GLSDGSVKVMEPLESDGKWG  740



>ref|XP_003626186.1| hypothetical protein MTR_7g112460 [Medicago truncatula]
 gb|AES82404.1| topless-like protein [Medicago truncatula]
Length=1129

 Score =   113 bits (283),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/82 (62%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLI+A+F DGN GVFDA  LR RC IAPS Y +   L+ ++ VY  V+ AHP EPNQ A 
Sbjct  1021  QLIFATFCDGNTGVFDADSLRLRCRIAPSTYFTATTLSGSQAVYPFVVAAHPLEPNQFAL  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP+ES G+WG S
Sbjct  1081  GLTDGSVKVIEPIESEGKWGSS  1102



>ref|XP_009421409.1| PREDICTED: topless-related protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=1134

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAY++ A  + N  VY +VI  HPQEPNQ A 
Sbjct  1025  QLVYASFCDGNIGVFDADNLRLRCRIAPSAYMTPAAASSNLPVYPLVIAVHPQEPNQFAV  1084

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL DG++KV EPLES G+WG
Sbjct  1085  GLADGAVKVFEPLESEGKWG  1104



>gb|EPS69182.1| hypothetical protein M569_05580, partial [Genlisea aurea]
Length=1123

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAV-LNRNEGVYAVVIVAHPQEPNQLA  529
             QL++ASF DGN+G+FDA  LR RC IA S+YLSQA  LN ++  Y VVI AHPQEPNQ A
Sbjct  1024  QLVFASFCDGNVGIFDADTLRLRCRIASSSYLSQAAALNGSQPPYPVVIAAHPQEPNQFA  1083

Query  528   FGLTDGSIKVIEPLESGGEWG  466
              GL+DGS+KVIEPLE+  +WG
Sbjct  1084  VGLSDGSVKVIEPLEAENKWG  1104



>emb|CDY25010.1| BnaC02g39980D [Brassica napus]
Length=1112

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1012  QLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQFAV  1067

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WG+
Sbjct  1068  GLNDGSVKVIEPTEAEGKWGM  1088



>emb|CDY05552.1| BnaA02g31390D [Brassica napus]
Length=1111

 Score =   112 bits (281),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1011  QLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQFAV  1066

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WG+
Sbjct  1067  GLNDGSVKVIEPTEAEGKWGM  1087



>ref|XP_009129893.1| PREDICTED: topless-related protein 3 [Brassica rapa]
Length=1116

 Score =   112 bits (281),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1016  QLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQFAV  1071

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WG+
Sbjct  1072  GLNDGSVKVIEPTEAEGKWGM  1092



>ref|XP_010528913.1| PREDICTED: topless-related protein 3-like [Tarenaya hassleriana]
Length=1106

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 0/81 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGN+GVFDA  LR RC IAP+ YLSQA LN    ++  V+ AHP + NQ A 
Sbjct  999   QLIYATFCDGNVGVFDADSLRLRCRIAPNTYLSQAALNAKPPIHPFVVAAHPHDQNQFAV  1058

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KV+EP ES G+WG+
Sbjct  1059  GLTDGSVKVLEPSESEGKWGV  1079



>ref|XP_006604796.1| PREDICTED: topless-related protein 3-like [Glycine max]
 gb|KHN43327.1| Topless-related protein 3 [Glycine soja]
Length=1130

 Score =   112 bits (280),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 55/83 (66%), Positives = 61/83 (73%), Gaps = 1/83 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLS-QAVLNRNEGVYAVVIVAHPQEPNQLA  529
             QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+ VY VV+ AHP EPNQ A
Sbjct  1020  QLIYATFSDGNTGVFDADSLRLRCRIALSTYFSPAAALSGNQSVYPVVVAAHPLEPNQFA  1079

Query  528   FGLTDGSIKVIEPLESGGEWGIS  460
              GLTDGS+KVIEP ES G+WG S
Sbjct  1080  VGLTDGSVKVIEPSESEGKWGTS  1102



>ref|XP_007144973.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
 gb|ESW16967.1| hypothetical protein PHAVU_007G198900g [Phaseolus vulgaris]
Length=1132

 Score =   112 bits (279),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 54/82 (66%), Positives = 61/82 (74%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F D NIGVFDA  LR RC IAPS  LS A LN +  +Y +V+ AHP EPNQ A 
Sbjct  1023  QLIYATFCDANIGVFDADSLRLRCRIAPSICLSPAALNGSPSLYPLVVAAHPLEPNQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1083  GLTDGSVKVIEPSESEGKWGSS  1104



>ref|XP_010524852.1| PREDICTED: topless-related protein 3-like isoform X2 [Tarenaya 
hassleriana]
Length=1115

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F+DGNIG+FDA  LR RC IAP+AYL +     ++G+  +V+ AHPQEPNQ A 
Sbjct  1012  QLIYAAFRDGNIGIFDADSLRLRCRIAPTAYLPRG----SQGLAPLVVAAHPQEPNQFAI  1067

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E  G+WG++
Sbjct  1068  GLTDGSVKVIEPTEPEGKWGMA  1089



>ref|XP_010524851.1| PREDICTED: topless-related protein 3-like isoform X1 [Tarenaya 
hassleriana]
Length=1117

 Score =   111 bits (278),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 64/82 (78%), Gaps = 4/82 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F+DGNIG+FDA  LR RC IAP+AYL +     ++G+  +V+ AHPQEPNQ A 
Sbjct  1014  QLIYAAFRDGNIGIFDADSLRLRCRIAPTAYLPRG----SQGLAPLVVAAHPQEPNQFAI  1069

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP E  G+WG++
Sbjct  1070  GLTDGSVKVIEPTEPEGKWGMA  1091



>ref|XP_007031067.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
 gb|EOY11569.1| Transducin family protein / WD-40 repeat family protein [Theobroma 
cacao]
Length=1761

 Score =   112 bits (279),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F+DGN+GVFDA  L  RC I+ S YLSQA+L  N+ VY +V+ AHP E NQ A 
Sbjct  1617  QSVYATFRDGNVGVFDADSLILRCRISSSVYLSQAILKGNQVVYPLVVAAHPMEANQFAI  1676

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KV+EP ES G+WG+S
Sbjct  1677  GLSDGSVKVMEPTESEGKWGVS  1698



>ref|XP_006394928.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
 gb|ESQ32214.1| hypothetical protein EUTSA_v10003550mg [Eutrema salsugineum]
Length=1136

 Score =   111 bits (277),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+ +  +V+ AHPQEPNQ A 
Sbjct  1036  QLIYTTFRDGNIGVFDADTLRLRCRISPSAYLPQG----NQSLSPLVVAAHPQEPNQFAV  1091

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WGI
Sbjct  1092  GLNDGSVKVIEPTEAEGKWGI  1112



>ref|XP_007031064.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
 gb|EOY11566.1| TOPLESS-related 3 isoform 1 [Theobroma cacao]
Length=1132

 Score =   110 bits (276),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F DGN+GVFDA  LR RC I+ S YLSQA+L  N+ VY +V+ AHP E NQ A 
Sbjct  1023  QSVYATFCDGNVGVFDADSLRLRCRISSSVYLSQAILKGNQAVYPLVVAAHPMEANQFAI  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KV+E  ES G+WG+S
Sbjct  1083  GLSDGSVKVMESTESEGKWGVS  1104



>emb|CDX88252.1| BnaA06g28430D [Brassica napus]
Length=1109

 Score =   110 bits (276),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1014  QLIYATFRDGNIGVFDADTLGLRCRISPSAYLPQV----NQGLSPLVVAAHPQEPNQFAV  1069

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WG+
Sbjct  1070  GLNDGSVKVIEPTEAEGKWGM  1090



>gb|KJB26372.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1157

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ A 
Sbjct  1047  QSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQFAI  1106

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KV+EP ES G+WG+S
Sbjct  1107  GLSDGTVKVLEPSESEGKWGVS  1128



>gb|KJB26373.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1161

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ A 
Sbjct  1051  QSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQFAI  1110

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KV+EP ES G+WG+S
Sbjct  1111  GLSDGTVKVLEPSESEGKWGVS  1132



>ref|XP_009382518.1| PREDICTED: topless-related protein 2-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=1142

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             +L+YASF DGNIGVFDA  LR RC IAPSAY S A  + N   Y +VI AHPQEPNQ A 
Sbjct  1034  ELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSNP-TYPLVIAAHPQEPNQFAV  1092

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEP +S G WG
Sbjct  1093  GLTDGAVKVIEPSKSEGRWG  1112



>ref|XP_009382517.1| PREDICTED: topless-related protein 2-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=1143

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             +L+YASF DGNIGVFDA  LR RC IAPSAY S A  + N   Y +VI AHPQEPNQ A 
Sbjct  1035  ELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSNP-TYPLVIAAHPQEPNQFAV  1093

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG++KVIEP +S G WG
Sbjct  1094  GLTDGAVKVIEPSKSEGRWG  1113



>gb|KJB26374.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1134

 Score =   110 bits (275),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ A 
Sbjct  1024  QSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQFAI  1083

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KV+EP ES G+WG+S
Sbjct  1084  GLSDGTVKVLEPSESEGKWGVS  1105



>gb|KHG26583.1| Topless-related 3 -like protein [Gossypium arboreum]
Length=1134

 Score =   109 bits (273),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IYA+F DGNIGVFDA  LR RC IAPS YLS  +L  ++ VY +V+ AHP E NQ A 
Sbjct  1024  QSIYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVILKGSQTVYPLVVAAHPIEANQFAI  1083

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DG++KV+EP ES G+WG+S
Sbjct  1084  GVSDGTVKVLEPSESEGKWGVS  1105



>gb|AES91919.2| topless-like protein [Medicago truncatula]
Length=1122

 Score =   109 bits (273),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DG+IGVFD+  LR RC IA SAYL Q+  + ++ +Y  V+ AHPQEPNQ A 
Sbjct  1019  QLVYAAFTDGSIGVFDSDSLRLRCRIASSAYLHQSS-SISQNIYPFVVAAHPQEPNQFAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DGSIKVIEP+E  G WG+S
Sbjct  1078  GMSDGSIKVIEPIEPNGRWGVS  1099



>ref|XP_009151171.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 3 [Brassica 
rapa]
Length=1112

 Score =   109 bits (272),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1014  QLIYTTFRDGNIGVFDADTLGLRCRISPSAYLPQV----NQGLSPLVVAAHPQEPNQFAV  1069

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+ G+WG+
Sbjct  1070  GLNDGSVKVIEPTEAEGKWGM  1090



>ref|XP_003609722.1| WD repeat-containing protein [Medicago truncatula]
Length=991

 Score =   108 bits (270),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 63/82 (77%), Gaps = 1/82 (1%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QL+YA+F DG+IGVFD+  LR RC IA SAYL Q+  + ++ +Y  V+ AHPQEPNQ A 
Sbjct  888  QLVYAAFTDGSIGVFDSDSLRLRCRIASSAYLHQSS-SISQNIYPFVVAAHPQEPNQFAV  946

Query  525  GLTDGSIKVIEPLESGGEWGIS  460
            G++DGSIKVIEP+E  G WG+S
Sbjct  947  GMSDGSIKVIEPIEPNGRWGVS  968



>ref|XP_002307097.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE94093.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1133

 Score =   108 bits (270),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPS Y      N ++ VY +V+  HP +PNQLA 
Sbjct  1030  QLIYATFCDGNIGVFDADSLRLRCRIAPSVY------NGSQTVYPLVVATHPLDPNQLAL  1083

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1084  GLTDGSVKVIEPTESEGKWGTS  1105



>ref|NP_198055.3| Topless-related protein 3 [Arabidopsis thaliana]
 sp|Q84JM4.1|TPR3_ARATH RecName: Full=Topless-related protein 3 [Arabidopsis thaliana]
 gb|AAO42071.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50698.1| unknown protein [Arabidopsis thaliana]
 gb|AED93642.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1108

 Score =   108 bits (270),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ A 
Sbjct  1009  QLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQFAV  1064

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+K++EP E  G+WG+
Sbjct  1065  GLNDGSVKMMEPTEGEGKWGM  1085



>emb|CDX80607.1| BnaC07g28370D [Brassica napus]
Length=1117

 Score =   108 bits (270),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  L  RC I+PSAYL Q     N+G+  +V+ AHPQEPNQ A 
Sbjct  1017  QLIYTTFRDGNIGVFDADTLGLRCRISPSAYLPQG----NQGLSPLVVAAHPQEPNQFAV  1072

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DG++KVIEP E+ G+WG+
Sbjct  1073  GLNDGTVKVIEPTEAEGKWGM  1093



>ref|NP_001190409.1| Topless-related protein 3 [Arabidopsis thaliana]
 gb|AED93643.1| Topless-related protein 3 [Arabidopsis thaliana]
Length=1134

 Score =   108 bits (269),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 61/81 (75%), Gaps = 4/81 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY +F+DGNIGVFDA  LR RC I+PSAYL Q     N+G+  +V+ AHPQ+PNQ A 
Sbjct  1035  QLIYTTFRDGNIGVFDADSLRLRCRISPSAYLPQG----NQGLSPLVVAAHPQDPNQFAV  1090

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL DGS+K++EP E  G+WG+
Sbjct  1091  GLNDGSVKMMEPTEGEGKWGM  1111



>ref|XP_011036914.1| PREDICTED: topless-related protein 3 [Populus euphratica]
Length=1127

 Score =   108 bits (269),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 60/82 (73%), Gaps = 6/82 (7%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPS Y      N ++ VY +V+  HP +PNQLA 
Sbjct  1024  QLIYATFCDGNIGVFDADSLRLRCRIAPSVY------NGSQTVYPLVVATHPLDPNQLAL  1077

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES G+WG S
Sbjct  1078  GLTDGSVKVIEPTESEGKWGTS  1099



>ref|XP_006577218.1| PREDICTED: topless-related protein 3-like [Glycine max]
Length=1130

 Score =   108 bits (269),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQ-AVLNRNEGVYAVVIVAHPQEPNQLA  529
             QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+  Y V I AHP EPNQ A
Sbjct  1020  QLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPPAALSGNQSAYPVAIAAHPLEPNQFA  1079

Query  528   FGLTDGSIKVIEPLESGGEWGIS  460
              GLTDGS+KVIEP ES G+WG S
Sbjct  1080  VGLTDGSVKVIEPSESEGKWGTS  1102



>gb|KHN03954.1| Topless-related protein 3 [Glycine soja]
Length=1107

 Score =   108 bits (269),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQ-AVLNRNEGVYAVVIVAHPQEPNQLA  529
             QLIYA+F DGN GVFDA  LR RC IA S Y S  A L+ N+  Y V I AHP EPNQ A
Sbjct  997   QLIYATFCDGNTGVFDADSLRLRCRIALSTYFSPPAALSGNQSAYPVAIAAHPLEPNQFA  1056

Query  528   FGLTDGSIKVIEPLESGGEWGIS  460
              GLTDGS+KVIEP ES G+WG S
Sbjct  1057  VGLTDGSVKVIEPSESEGKWGTS  1079



>ref|XP_010674104.1| PREDICTED: topless-related protein 3-like [Beta vulgaris subsp. 
vulgaris]
Length=1096

 Score =   108 bits (269),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 62/81 (77%), Gaps = 0/81 (0%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             +IYASF DGN+GV+DA  L+ RC IA SA+LS A LN ++ +Y  V+ AHPQEP Q A G
Sbjct  988   IIYASFSDGNVGVYDADTLKLRCRIAASAFLSHAQLNGSQILYPQVVAAHPQEPFQFAVG  1047

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             L DG++KV+EP ES G+WG+S
Sbjct  1048  LNDGTVKVVEPTESEGKWGVS  1068



>gb|KHG04331.1| Topless-related 2 -like protein [Gossypium arboreum]
Length=1039

 Score =   107 bits (268),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IAPSAY+S  + N ++ V+ +V+ AHPQE NQLA 
Sbjct  933   QLVYATFPDGNIGVFDADSLKLRCRIAPSAYISPGMSN-SQIVHPLVVTAHPQEANQLAL  991

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDG +KVIEPLE+  +WG+
Sbjct  992   GLTDGLVKVIEPLETERKWGL  1012



>gb|KJB26371.1| hypothetical protein B456_004G238300 [Gossypium raimondii]
Length=1133

 Score =   107 bits (267),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q +YA+F DGNIGVFDA  LR RC IAPS YLS  +L + + VY +V+ AHP E NQ A 
Sbjct  1024  QSVYATFCDGNIGVFDADSLRLRCRIAPSVYLSSVIL-KGQTVYPLVVAAHPIEANQFAI  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG++KV+EP ES G+WG+S
Sbjct  1083  GLSDGTVKVLEPSESEGKWGVS  1104



>dbj|BAA95777.1| unnamed protein product [Arabidopsis thaliana]
Length=1161

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  ++  VI AHPQEPNQLA 
Sbjct  1020  QLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIFPQVITAHPQEPNQLAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1079  GLSDGSVKVIEPSELSRRWGV  1099



>emb|CDY50502.1| BnaC01g44400D [Brassica napus]
Length=1272

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQLA 
Sbjct  1160  QLVYASFNDGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQLAV  1218

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E+   WG+
Sbjct  1219  GLSDGSVKVIEPSEASRRWGV  1239



>ref|NP_188306.2| Topless-related 2 protein [Arabidopsis thaliana]
 sp|Q9LRZ0.2|TPR2_ARATH RecName: Full=Topless-related protein 2 [Arabidopsis thaliana]
 gb|AEE75871.1| Topless-related 2 protein [Arabidopsis thaliana]
Length=1131

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  ++  VI AHPQEPNQLA 
Sbjct  1020  QLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIFPQVITAHPQEPNQLAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1079  GLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_009114175.1| PREDICTED: topless-related protein 2 [Brassica rapa]
Length=1135

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQLA 
Sbjct  1023  QLVYASFTDGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQLAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E+   WG+
Sbjct  1082  GLSDGSVKVIEPSEASRRWGV  1102



>ref|XP_006406802.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
 gb|ESQ48255.1| hypothetical protein EUTSA_v10019939mg [Eutrema salsugineum]
Length=1131

 Score =   106 bits (265),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC I+PSAY+ Q   N +  +   VI AHPQEPNQLA 
Sbjct  1020  QLVYASFADGNIAVFDAESLRLRCRISPSAYMPQPTPN-SAPIIPQVITAHPQEPNQLAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP ES   WG+
Sbjct  1079  GLSDGSVKVIEPSESSRRWGM  1099



>ref|XP_004487868.1| PREDICTED: topless-related protein 2-like [Cicer arietinum]
Length=1122

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRN-EGVYAVVIVAHPQEPNQLA  529
             +L+YA+F DGN+GVFDA  L+PRC IA SAY+ Q+    N + VY VV+ AHP EPNQ A
Sbjct  1032  RLVYATFTDGNVGVFDAETLKPRCRIASSAYIHQSQTPSNSQNVYPVVVAAHPHEPNQFA  1091

Query  528   FGLTDGSIKVIEPLESGGEWGI  463
              GL+DGSIKVIEP E+ G  GI
Sbjct  1092  IGLSDGSIKVIEPPETEGWQGI  1113



>ref|XP_006299477.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
 gb|EOA32375.1| hypothetical protein CARUB_v10015642mg [Capsella rubella]
Length=1127

 Score =   106 bits (264),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 51/81 (63%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ A 
Sbjct  1016  QLVYASFADGNIGVFDAETLRLRCRIAPSAYMPQPTPN-SAPIVPQVITAHPQEPNQFAV  1074

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1075  GLSDGSVKVIEPSELSRRWGV  1095



>ref|XP_007035678.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
 gb|EOY06604.1| TOPLESS-related 2 isoform 4 [Theobroma cacao]
Length=1101

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ A 
Sbjct  995   QLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQFAV  1053

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E   + G+
Sbjct  1054  GLTDGSVKVIEPSEMERKLGL  1074



>ref|XP_007035677.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
 gb|EOY06603.1| TOPLESS-related 2 isoform 3 [Theobroma cacao]
Length=1107

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ A 
Sbjct  1001  QLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQFAV  1059

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E   + G+
Sbjct  1060  GLTDGSVKVIEPSEMERKLGL  1080



>ref|XP_007035675.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
 gb|EOY06601.1| TOPLESS-related 2 isoform 1 [Theobroma cacao]
Length=1133

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ A 
Sbjct  1027  QLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQFAV  1085

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E   + G+
Sbjct  1086  GLTDGSVKVIEPSEMERKLGL  1106



>ref|XP_007035676.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
 gb|EOY06602.1| TOPLESS-related 2 isoform 2 [Theobroma cacao]
Length=1139

 Score =   106 bits (264),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 63/81 (78%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIG+FDA  LR RC IAPSAY+S A+LN ++ VY +V+ AHPQ+ NQ A 
Sbjct  1033  QLVYATFTDGNIGIFDADSLRLRCRIAPSAYISPALLN-SQTVYPLVVTAHPQDANQFAV  1091

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E   + G+
Sbjct  1092  GLTDGSVKVIEPSEMERKLGL  1112



>ref|XP_009146056.1| PREDICTED: topless-related protein 2-like [Brassica rapa]
Length=1132

 Score =   105 bits (263),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q + N +  +   VI  HPQEPNQLA 
Sbjct  1019  QLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPIPN-SAPIIPQVITTHPQEPNQLAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E+   WG+
Sbjct  1078  GLSDGSVKVIEPSEASRRWGV  1098



>gb|KFK39016.1| hypothetical protein AALP_AA3G189500 [Arabis alpina]
Length=1131

 Score =   105 bits (262),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQ+A 
Sbjct  1020  QLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQVAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP ES   WG+
Sbjct  1079  GLSDGSVKVIEPSESSRRWGV  1099



>ref|XP_008673872.1| PREDICTED: topless-related protein 2 isoform X2 [Zea mays]
Length=1109

 Score =   105 bits (261),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+GVFDA  LR RC IAPS      V+N N  V+ +V+ AHP EPNQ A 
Sbjct  1005  QLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINSNPPVHPLVVAAHPHEPNQFAV  1058

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1059  GLSDGSVKVLEPLESEGKWG  1078



>ref|XP_008673871.1| PREDICTED: topless-related protein 2 isoform X1 [Zea mays]
Length=1125

 Score =   105 bits (261),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 6/80 (8%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++A+F DGN+GVFDA  LR RC IAPS      V+N N  V+ +V+ AHP EPNQ A 
Sbjct  1021  QLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINSNPPVHPLVVAAHPHEPNQFAV  1074

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DGS+KV+EPLES G+WG
Sbjct  1075  GLSDGSVKVLEPLESEGKWG  1094



>gb|KFK27551.1| hypothetical protein AALP_AA8G398300 [Arabis alpina]
Length=1125

 Score =   105 bits (261),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA +LR RC IAPSAY+ Q   N +  V  +VI +HPQEPNQ+A 
Sbjct  1019  QLVYASFADGNIGVFDAEQLRLRCRIAPSAYMPQPTPN-SAPVMPLVITSHPQEPNQIAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DGS+KV+E  E    WG++ K
Sbjct  1078  GLSDGSVKVLETPEPFRRWGVADK  1101



>ref|XP_001781989.1| predicted protein [Physcomitrella patens]
 gb|EDQ53213.1| predicted protein [Physcomitrella patens]
Length=1102

 Score =   105 bits (261),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 48/80 (60%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA F DG++GVFDA  LRPRC +APS ++   V      VY +VI AHP EPNQ A 
Sbjct  996   QLIYAGFVDGSVGVFDAESLRPRCRLAPSVHIPPGV--SGSTVYPLVIAAHPAEPNQFAL  1053

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG ++VIEPLES G+WG
Sbjct  1054  GLSDGGVQVIEPLESEGKWG  1073



>emb|CDY50500.1| BnaC01g44380D [Brassica napus]
Length=505

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  708  CQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLA  529
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q     +  +   VI AHPQEPNQLA
Sbjct  394  SQLVYASFTDGNIAVFDAESLRLRCRIAPSAYMPQP---NSAPIIPQVITAHPQEPNQLA  450

Query  528  FGLTDGSIKVIEPLESGGEWGI  463
             GL DGS+KVIEP E+   WG+
Sbjct  451  VGLADGSVKVIEPSEASRRWGV  472



>emb|CDX92100.1| BnaA05g23070D [Brassica napus]
Length=1132

 Score =   105 bits (261),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQLA 
Sbjct  1019  QLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQLAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E+   WG+
Sbjct  1078  GLSDGSVKVIEPSEASRRWGV  1098



>ref|XP_010440213.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1115

 Score =   105 bits (261),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ+A 
Sbjct  1009  QLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTQN-SAPIMPLVITAHPQEPNQIAV  1067

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DGS+KV+E  E    WG++ K
Sbjct  1068  GLSDGSVKVLETPEPFRRWGVAEK  1091



>emb|CDX95900.1| BnaC05g36510D [Brassica napus]
Length=1136

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQLA 
Sbjct  1024  QLVYASFADGNIAVFDADSLRLRCRIAPSAYMPQPTPN-SAPIIPQVITTHPQEPNQLAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E+   WG+
Sbjct  1083  GLSDGSVKVIEPSEASRRWGV  1103



>ref|XP_011023731.1| PREDICTED: topless-related protein 3-like [Populus euphratica]
Length=1124

 Score =   104 bits (260),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 50/82 (61%), Positives = 59/82 (72%), Gaps = 6/82 (7%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGNIGVFDA  LR RC IAPSAY      N ++  + +V+  HP +PNQLA 
Sbjct  1021  QLIYATFSDGNIGVFDADHLRLRCRIAPSAY------NGSQTAHPLVVATHPLDPNQLAV  1074

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES  +WG S
Sbjct  1075  GLTDGSVKVIEPTESEKKWGTS  1096



>ref|XP_007031068.1| TOPLESS-related 3 [Theobroma cacao]
 gb|EOY11570.1| TOPLESS-related 3 [Theobroma cacao]
Length=715

 Score =   103 bits (257),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/83 (57%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q +YA+F DGN+GVFDA  LR  C IA S +LSQA+L   + VY  V+ AHP+E NQ A 
Sbjct  606  QSVYATFCDGNVGVFDADSLRLICRIASSVHLSQAILKGKQVVYPFVVAAHPKEANQFAI  665

Query  525  GLTDGSIKVIEPLESGGEWGISR  457
            GL+DGS+KV+EP ES G+W +S+
Sbjct  666  GLSDGSVKVMEPTESEGKWQVSQ  688



>ref|XP_010487553.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQEPNQ A 
Sbjct  1020  QLVYASFADGNIAVFDAETLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEPNQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1079  GLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_002319498.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE95421.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1124

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/82 (60%), Positives = 59/82 (72%), Gaps = 6/82 (7%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA+F DGN+GVFDA  LR RC IAPSAY      N ++  + +V+  HP +PNQLA 
Sbjct  1021  QLIYATFSDGNVGVFDADHLRLRCRIAPSAY------NGSQTAHPLVVATHPLDPNQLAV  1074

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS+KVIEP ES  +WG S
Sbjct  1075  GLTDGSVKVIEPTESEKKWGTS  1096



>ref|XP_001768092.1| predicted protein [Physcomitrella patens]
 gb|EDQ67164.1| predicted protein [Physcomitrella patens]
Length=1158

 Score =   103 bits (258),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYA F DG++GVFDA  LRPRC +AP+ ++   V      VY +VI AHP EPNQ A 
Sbjct  1052  QLIYAGFVDGSVGVFDAESLRPRCRLAPTVHVPSGV--SGSTVYPLVIAAHPAEPNQFAL  1109

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG ++VIEPLES G+WG
Sbjct  1110  GLSDGGVQVIEPLESEGKWG  1129



>ref|XP_004495686.1| PREDICTED: topless-related protein 3-like isoform X3 [Cicer arietinum]
Length=1115

 Score =   103 bits (256),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 52/82 (63%), Positives = 58/82 (71%), Gaps = 7/82 (9%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D NIGVFDA  L+ RC IAPS  LSQAV       Y +VI  HP EPNQ A 
Sbjct  1018  QLIYASFCDANIGVFDADSLKLRCRIAPSICLSQAV-------YPLVIATHPLEPNQFAV  1070

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             G++DGS+KVIEP ES G+WG S
Sbjct  1071  GMSDGSVKVIEPSESEGKWGSS  1092



>ref|XP_009369993.1| PREDICTED: topless-related protein 2-like [Pyrus x bretschneideri]
Length=1140

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1038  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLPQASSN-SPSVYPLALTAHLQEPYQFAV  1096

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1097  GLTDGSVKVIEPSESEGKWGV  1117



>ref|XP_008390610.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1146

 Score =   102 bits (255),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1044  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLPQASSN-SPSVYPLALTAHLQEPYQFAV  1102

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1103  GLTDGSVKVIEPSESEGKWGV  1123



>gb|KEH37175.1| topless-like protein [Medicago truncatula]
Length=972

 Score =   102 bits (254),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q++YA+F +GNIGVFDA RL+ RC IA SAYL+Q   N ++ VY +   AHP+EPNQ A 
Sbjct  888  QIVYAAFTNGNIGVFDAVRLQLRCHIASSAYLNQTPSN-SQNVYPLGFTAHPKEPNQFAI  946

Query  525  GLTDGSIKVIEPLESGGEWG  466
             L+DG++KV+EP ES G WG
Sbjct  947  ALSDGTVKVLEPTESAGSWG  966



>ref|XP_010449856.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1125

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ+A 
Sbjct  1019  QLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTQN-SAPIMPLVITAHPQEPNQIAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DG +KV+E  E    WG++ K
Sbjct  1078  GLSDGLVKVLETPEPFRRWGVAEK  1101



>ref|XP_004506964.1| PREDICTED: protein TOPLESS-like [Cicer arietinum]
Length=1134

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF+A  LR RC I+PSAYL  +V N N  V  +VI AHPQEPNQ A 
Sbjct  1028  QLIYASFLDATVCVFNASNLRLRCRISPSAYLPSSVSNSN--VQPLVIAAHPQEPNQFAI  1085

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1086  GLSDGGVHVFEPLESEGKWGV  1106



>ref|XP_010465706.1| PREDICTED: topless-related protein 2-like [Camelina sativa]
Length=1131

 Score =   102 bits (254),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPS Y+ Q   N +  +   VI AHPQEPNQ A 
Sbjct  1020  QLVYASFADGNIAVFDAETLRLRCRIAPSVYMPQPTPN-SAPIIPQVITAHPQEPNQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1079  GLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_007227035.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
 gb|EMJ28234.1| hypothetical protein PRUPE_ppa000503mg [Prunus persica]
Length=1125

 Score =   102 bits (253),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IA S YLSQA  N ++ VY + + AH  EP Q A 
Sbjct  1024  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLSQASSN-SQTVYPLALTAHLHEPYQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E+ G+WG+
Sbjct  1083  GLTDGSVKVIEPSEAEGKWGV  1103



>ref|XP_002883029.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59288.1| hypothetical protein ARALYDRAFT_479149 [Arabidopsis lyrata subsp. 
lyrata]
Length=1131

 Score =   102 bits (253),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI  HPQEPNQLA 
Sbjct  1020  QLVYASFADGNIAVFDAESLRLRCRIAPSAYMPQPTPN-SALIIPHVITTHPQEPNQLAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KV+EP E    WG+
Sbjct  1079  GLSDGSVKVLEPSELSRRWGV  1099



>ref|XP_006285940.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
 gb|EOA18838.1| hypothetical protein CARUB_v10007460mg [Capsella rubella]
Length=1107

 Score =   101 bits (251),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC IAPSAY+ Q   N +  +  +VI AHPQEPNQ+A 
Sbjct  1001  QLVYASFADGNIGVFDAEYLRLRCRIAPSAYMPQPTPN-SAPLMPLVITAHPQEPNQIAV  1059

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DG +KV+E  E    WG++ K
Sbjct  1060  GLSDGLVKVLETPEPFRRWGVAEK  1083



>gb|KJB72745.1| hypothetical protein B456_011G194100 [Gossypium raimondii]
 gb|KJB72746.1| hypothetical protein B456_011G194100 [Gossypium raimondii]
Length=1123

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IAPSAY+S  + N ++ V+ +V+  HPQE NQLA 
Sbjct  1017  QLVYATFTDGNIGVFDADSLKLRCRIAPSAYISPGMSN-SQIVHPLVVATHPQEANQLAV  1075

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLT+G +KVIEP E+  +WG+
Sbjct  1076  GLTNGLVKVIEPSETERKWGL  1096



>ref|XP_010504697.1| PREDICTED: topless-related protein 2 [Camelina sativa]
Length=1131

 Score =   100 bits (250),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNI VFDA  LR RC IAPSAY+ Q   N +  +   VI AHPQE NQ A 
Sbjct  1020  QLVYASFADGNIAVFDAETLRLRCRIAPSAYMPQPTPN-SAPIIPQVITAHPQEANQFAV  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+KVIEP E    WG+
Sbjct  1079  GLSDGSVKVIEPSELSRRWGV  1099



>ref|XP_008223259.1| PREDICTED: topless-related protein 2 [Prunus mume]
Length=1125

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC IA S YLSQ   N ++ VY + + AH  EP Q A 
Sbjct  1024  QLVYAAFTDGNIGVFDADSLKLRCRIAMSVYLSQTSSN-SQTVYPLALTAHLHEPYQFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP E+ G+WG+
Sbjct  1083  GLTDGSVKVIEPSEAEGKWGV  1103



>ref|XP_006341391.1| PREDICTED: protein TOPLESS-like [Solanum tuberosum]
Length=1130

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF A  L  RC I PSAYLS ++ N N  ++ VV+ AHPQ+PNQ A 
Sbjct  1024  QLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSN--IHPVVVAAHPQDPNQFAL  1081

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+ V EPLES G+WG+
Sbjct  1082  GLSDGSVHVFEPLESEGKWGV  1102



>ref|XP_010318715.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
 ref|XP_010318716.1| PREDICTED: protein TOPLESS-like isoform X1 [Solanum lycopersicum]
Length=1130

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF A  L  RC I PSAYLS ++ N N  ++ VV+ AHPQ+PNQ A 
Sbjct  1024  QLIYASFLDATVCVFTAGHLHMRCRIIPSAYLSPSISNSN--IHPVVVAAHPQDPNQFAL  1081

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+ V EPLES G+WG+
Sbjct  1082  GLSDGSVHVFEPLESEGKWGV  1102



>ref|XP_002960294.1| hypothetical protein SELMODRAFT_163891 [Selaginella moellendorffii]
 gb|EFJ37833.1| hypothetical protein SELMODRAFT_163891 [Selaginella moellendorffii]
Length=1119

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             +L+YA+F DG IGVF+A  LRP C IAP+ YL Q V     G + +V+ AHP EPN  A 
Sbjct  1014  RLVYAAFLDGAIGVFEAETLRPYCRIAPTVYLPQGV----TGAHPLVVAAHPSEPNLFAL  1069

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS++V+EPLES  +WG++
Sbjct  1070  GLTDGSVQVLEPLESEAKWGVA  1091



>ref|XP_006414395.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
 gb|ESQ55848.1| hypothetical protein EUTSA_v10024263mg [Eutrema salsugineum]
Length=1120

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/84 (58%), Positives = 60/84 (71%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DGNIGVFDA  LR RC I+PSAY+ Q   N +  +  +VI AHPQE NQ+A 
Sbjct  1017  QLVYASFADGNIGVFDAEYLRLRCRISPSAYMPQPTPN-SAPIMPLVITAHPQESNQVAV  1075

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DGS+KVIE  E    WG++ K
Sbjct  1076  GLSDGSVKVIETPEPFRRWGVADK  1099



>gb|EYU21684.1| hypothetical protein MIMGU_mgv1a000459mg [Erythranthe guttata]
Length=1138

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF A +LR RC I PSAYLS    N +  V+ +VI AHPQEPNQ A 
Sbjct  1032  QLVYASFLDSTVCVFTAAQLRLRCRINPSAYLSP---NISSNVHPLVIAAHPQEPNQFAL  1088

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+ V EPLES G+WG++
Sbjct  1089  GLSDGSVHVFEPLESEGKWGLT  1110



>ref|XP_009346204.1| PREDICTED: topless-related protein 2-like isoform X2 [Pyrus x 
bretschneideri]
Length=1141

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DG+IGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1039  QLVYAAFTDGSIGVFDADSLKLRCRIAMSVYLPQASSN-SPTVYPLALTAHLQEPYQFAV  1097

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1098  GLTDGSVKVIEPSESEGKWGV  1118



>ref|XP_002967419.1| hypothetical protein SELMODRAFT_439915 [Selaginella moellendorffii]
 gb|EFJ32018.1| hypothetical protein SELMODRAFT_439915 [Selaginella moellendorffii]
Length=1111

 Score =   100 bits (249),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             +L+YA+F DG IGVF+A  LRP C IAP+ YL Q V     G + +V+ AHP EPN  A 
Sbjct  1006  RLVYAAFLDGAIGVFEAETLRPYCRIAPTVYLPQGV----TGAHPLVVAAHPSEPNLFAL  1061

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDGS++V+EPLES  +WG++
Sbjct  1062  GLTDGSVQVLEPLESEAKWGVA  1083



>ref|XP_010050139.1| PREDICTED: topless-related protein 4-like [Eucalyptus grandis]
Length=1298

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IYASF+DG+I V  A  LR RCCI P+AY+     N +  VY +VI AHP +PNQ A 
Sbjct  1198  QSIYASFEDGSISVLSASTLRLRCCINPAAYIPP---NPDLRVYPLVIAAHPSQPNQFAL  1254

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLT+GS+ V+EPLES GEWG S
Sbjct  1255  GLTNGSVYVLEPLESEGEWGGS  1276



>ref|XP_009346203.1| PREDICTED: topless-related protein 2-like isoform X1 [Pyrus x 
bretschneideri]
Length=1167

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 49/81 (60%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DG+IGVFDA  L+ RC IA S YL QA  N +  VY + + AH QEP Q A 
Sbjct  1065  QLVYAAFTDGSIGVFDADSLKLRCRIAMSVYLPQASSN-SPTVYPLALTAHLQEPYQFAV  1123

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1124  GLTDGSVKVIEPSESEGKWGV  1144



>ref|XP_008655511.1| PREDICTED: LOW QUALITY PROTEIN: topless-related protein 2-like 
[Zea mays]
Length=1462

 Score =   100 bits (249),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 6/80 (8%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++++F DGNIGVFDA  LR RC IA      Q+V+N N  V+ +V+ AHP EPNQ A 
Sbjct  1359  QLVFSAFIDGNIGVFDAENLRLRCRIA------QSVINSNPHVHPLVVAAHPHEPNQFAV  1412

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GL+DG +KV+EPLES G+WG
Sbjct  1413  GLSDGFVKVLEPLESEGKWG  1432



>ref|XP_009382516.1| PREDICTED: topless-related protein 2-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1164

 Score =   100 bits (248),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 52/101 (51%), Positives = 60/101 (59%), Gaps = 21/101 (21%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR---------------------  589
             +L+YASF DGNIGVFDA  LR RC IAPSAY S A  +                      
Sbjct  1034  ELVYASFCDGNIGVFDADNLRLRCRIAPSAYTSPAAASSFSQSIVRIVDSPADQHSFSFF  1093

Query  588   NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  466
             +   Y +VI AHPQEPNQ A GLTDG++KVIEP +S G WG
Sbjct  1094  SNPTYPLVIAAHPQEPNQFAVGLTDGAVKVIEPSKSEGRWG  1134



>ref|XP_011073378.1| PREDICTED: protein TOPLESS [Sesamum indicum]
Length=1132

 Score = 99.8 bits (247),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + +F A  LR RC I PSAYLS  V   +  V+ +VI AHPQEPNQ A 
Sbjct  1027  QLVYASFLDATVCIFTAAHLRLRCRINPSAYLSPGV---SSNVHPLVIAAHPQEPNQFAL  1083

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+ V EPLES G+WG+
Sbjct  1084  GLSDGSVHVFEPLESEGKWGV  1104



>gb|EMS62858.1| Topless-related protein 2 [Triticum urartu]
Length=1197

 Score = 99.8 bits (247),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 62/111 (56%), Gaps = 30/111 (27%)
 Frame = -2

Query  708   CQLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR--------------------  589
              QL++A+F DGN+ +FDA  LR RC IA SAY+S   +NR                    
Sbjct  1057  SQLVFAAFTDGNVAIFDADNLRLRCRIASSAYMSTTAINRCKIISVEIAGELPRRFEAPS  1116

Query  588   ----------NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  466
                       N  VY  V+ AHPQEPNQ A GL+DGS+KV+EPLES G+WG
Sbjct  1117  HPVKVTINHRNPPVYPFVVAAHPQEPNQFAVGLSDGSVKVMEPLESDGKWG  1167



>ref|XP_002309645.1| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEE93168.1| WD-40 repeat family protein [Populus trichocarpa]
Length=1099

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ A 
Sbjct  992   QLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQFAI  1048

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS++V EPLES G+WG+
Sbjct  1049  GLTDGSVQVFEPLESDGKWGV  1069



>ref|XP_006855163.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
 gb|ERN16630.1| hypothetical protein AMTR_s00051p00079490 [Amborella trichopoda]
Length=1138

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF DG++GVF A  LR RC I P+AYL     N +   Y +VI AHP EPNQ A 
Sbjct  1033  QLIYTSFVDGSVGVFSAATLRLRCRINPTAYLPA---NLSSNTYPLVIAAHPSEPNQFAL  1089

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG + V+EPLES G+WG
Sbjct  1090  GLTDGGVHVLEPLESEGKWG  1109



>ref|XP_009405763.1| PREDICTED: protein TOPLESS-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=1130

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ A 
Sbjct  1024  QLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQFAL  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG+S
Sbjct  1081  GLTDGGVHVLEPLESEGKWGVS  1102



>ref|XP_009405760.1| PREDICTED: protein TOPLESS-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=1169

 Score = 99.4 bits (246),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ A 
Sbjct  1063  QLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQFAL  1119

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG+S
Sbjct  1120  GLTDGGVHVLEPLESEGKWGVS  1141



>ref|XP_002324880.2| WD-40 repeat family protein [Populus trichocarpa]
 gb|EEF03445.2| WD-40 repeat family protein [Populus trichocarpa]
Length=1114

 Score = 99.4 bits (246),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG + +F A  L+ RC I P+AYL   V      VY + + AHPQEPNQ A 
Sbjct  1009  QLVYASFVDGTLRIFGASNLQVRCQINPNAYLQSDV---GSSVYPLAVAAHPQEPNQFAI  1065

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGSI+V EPLES G+WG+
Sbjct  1066  GLTDGSIQVFEPLESEGKWGM  1086



>ref|XP_009405761.1| PREDICTED: protein TOPLESS-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=1132

 Score = 99.4 bits (246),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF D  + +F+A  LR RC I P+AYL  +V   +  VY VVI AHP EPNQ A 
Sbjct  1026  QLIYVSFLDATVCIFNAMNLRLRCRILPAAYLPPSV---STTVYPVVIAAHPSEPNQFAL  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG+S
Sbjct  1083  GLTDGGVHVLEPLESEGKWGVS  1104



>ref|XP_010241551.1| PREDICTED: topless-related protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=1134

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GVF A  LR RC I P+AYL     N +  VY +VI AHP EPNQ A 
Sbjct  1033  QSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPS---NPSVRVYPLVIAAHPSEPNQFAV  1089

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG S
Sbjct  1090  GLTDGGVYVLEPLESEGKWGTS  1111



>ref|XP_010241550.1| PREDICTED: topless-related protein 4-like isoform X1 [Nelumbo 
nucifera]
Length=1135

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/82 (59%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GVF A  LR RC I P+AYL     N +  VY +VI AHP EPNQ A 
Sbjct  1034  QSIYTSFEDGSVGVFTATTLRLRCRINPTAYLPS---NPSVRVYPLVIAAHPSEPNQFAV  1090

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG S
Sbjct  1091  GLTDGGVYVLEPLESEGKWGTS  1112



>gb|KJB34663.1| hypothetical protein B456_006G077300 [Gossypium raimondii]
Length=1114

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F D NIGVFDA  LR RC IAPSAY+S  V + +  ++ +V+ AHPQE NQ+A 
Sbjct  1008  QLVYATFTDDNIGVFDADSLRLRCRIAPSAYIS-PVSSNSPTIHPLVVAAHPQEANQIAV  1066

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL++G++KVIEP E+  +WG+
Sbjct  1067  GLSNGAVKVIEPSEAERKWGL  1087



>ref|XP_007150781.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 ref|XP_007150782.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22775.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
 gb|ESW22776.1| hypothetical protein PHAVU_005G180100g [Phaseolus vulgaris]
Length=1132

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF A  LR RC I PSAYLS +V   +  V  +VI AHPQEPNQ A 
Sbjct  1029  QLIYASFLDATVCVFSASNLRLRCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQFAV  1085

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1086  GLSDGGVHVFEPLESEGKWGV  1106



>gb|KJB34661.1| hypothetical protein B456_006G077300 [Gossypium raimondii]
Length=1128

 Score = 98.6 bits (244),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F D NIGVFDA  LR RC IAPSAY+S  V + +  ++ +V+ AHPQE NQ+A 
Sbjct  1022  QLVYATFTDDNIGVFDADSLRLRCRIAPSAYIS-PVSSNSPTIHPLVVAAHPQEANQIAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL++G++KVIEP E+  +WG+
Sbjct  1081  GLSNGAVKVIEPSEAERKWGL  1101



>ref|XP_010318718.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318719.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318720.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318721.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
 ref|XP_010318722.1| PREDICTED: protein TOPLESS-like [Solanum lycopersicum]
Length=405

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QLIYASF D  + +F A  L  +CCI PSAYLS  + N N  ++ VV+ AHP++PNQ A 
Sbjct  303  QLIYASFLDATVCIFTAGNLHMQCCIYPSAYLSPGISNLN--IHPVVVAAHPEDPNQFAL  360

Query  525  GLTDGSIKVIEPLESGGEWGI  463
            G++DG + V EPLES G+WG+
Sbjct  361  GMSDGGVHVFEPLESEGKWGV  381



>ref|XP_002870186.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46445.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1125

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/84 (56%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
              L+YASF DG+IGVFDA  LR RC I PSAY+ Q   N +  +  +VI AHPQEPNQ+A 
Sbjct  1019  HLVYASFADGSIGVFDAEYLRLRCRIGPSAYMPQPTSN-SAPIMPLVITAHPQEPNQIAV  1077

Query  525   GLTDGSIKVIEPLESGGEWGISRK  454
             GL+DGS+KV+E  E    WG+  K
Sbjct  1078  GLSDGSVKVLETPEPFRRWGVVEK  1101



>ref|XP_008340770.1| PREDICTED: topless-related protein 2 [Malus domestica]
Length=1127

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC I  S YL Q   N +  VY + + AH QEP Q A 
Sbjct  1025  QLVYAAFTDGNIGVFDADSLKLRCRIXMSVYLPQPSSN-SPTVYPLALTAHLQEPCQFAV  1083

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1084  GLTDGSVKVIEPSESEGKWGV  1104



>ref|XP_008353208.1| PREDICTED: topless-related protein 2-like [Malus domestica]
Length=1137

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 48/81 (59%), Positives = 57/81 (70%), Gaps = 1/81 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIGVFDA  L+ RC I  S YL Q   N +  VY + + AH QEP Q A 
Sbjct  1035  QLVYAAFTDGNIGVFDADSLKLRCRIXMSVYLPQPSSN-SPTVYPLALTAHLQEPCQFAV  1093

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS+KVIEP ES G+WG+
Sbjct  1094  GLTDGSVKVIEPSESEGKWGV  1114



>ref|XP_004486640.1| PREDICTED: protein TOPLESS-like isoform X1 [Cicer arietinum]
Length=1150

 Score = 98.2 bits (243),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 58/81 (72%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++ASF D  + VF A  LR RC I PSAYLS  V + N  V+++VI AHPQEPNQ A 
Sbjct  1046  QLVFASFLDATVCVFSASNLRLRCRINPSAYLSANVSSSN--VHSLVIAAHPQEPNQFAV  1103

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1104  GLSDGIVHVFEPLESEGKWGV  1124



>ref|XP_006341390.1| PREDICTED: protein TOPLESS-like [Solanum tuberosum]
Length=257

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QLIYASF D  + VF A  L  +CCI P AYLS  + N N  ++ VV+ AHP++PNQ A 
Sbjct  151  QLIYASFLDATVCVFTAGNLHMQCCIIPFAYLSPGISNSN--IHPVVVAAHPEDPNQFAL  208

Query  525  GLTDGSIKVIEPLESGGEWGI  463
            G++DG + V EPLES G+WG+
Sbjct  209  GMSDGGVHVFEPLESEGKWGV  229



>ref|XP_009361201.1| PREDICTED: topless-related protein 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=1133

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ+A G
Sbjct  1029  LVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQVALG  1087

Query  522   LTDGSIKVIEPLESGGEWG  466
             +TDGS+ V+EP E+  +WG
Sbjct  1088  MTDGSVHVVEPSEAELKWG  1106



>ref|XP_009361190.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361191.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361193.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361194.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361195.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361196.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361197.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361198.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361199.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009361200.1| PREDICTED: topless-related protein 1-like isoform X1 [Pyrus x 
bretschneideri]
Length=1134

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 46/79 (58%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ+A G
Sbjct  1030  LVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQVALG  1088

Query  522   LTDGSIKVIEPLESGGEWG  466
             +TDGS+ V+EP E+  +WG
Sbjct  1089  MTDGSVHVVEPSEAELKWG  1107



>ref|XP_009611336.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
 ref|XP_009611337.1| PREDICTED: protein TOPLESS-like [Nicotiana tomentosiformis]
Length=1127

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF    L  RC I PSAYLS ++ N N  V+ VV+ AHPQ+PNQ A 
Sbjct  1021  QLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSN--VHPVVVAAHPQDPNQFAL  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+ V EPLES G+WG+
Sbjct  1079  GLSDGSVHVFEPLESEGKWGV  1099



>ref|XP_011036611.1| PREDICTED: topless-related protein 1-like [Populus euphratica]
Length=1102

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG + +F A  L+ RC I P+AYL   V      VY + + AHPQEPNQ + 
Sbjct  997   QLVYASFVDGTLRIFGASNLQVRCQINPNAYLPSDV---GSSVYPLAVAAHPQEPNQFSI  1053

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGSI+V EPLES G+WG+
Sbjct  1054  GLTDGSIQVFEPLESEGKWGL  1074



>ref|XP_009796750.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
 ref|XP_009796751.1| PREDICTED: protein TOPLESS-like [Nicotiana sylvestris]
Length=1127

 Score = 97.8 bits (242),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 47/81 (58%), Positives = 57/81 (70%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF    L  RC I PSAYLS ++ N N  V+ VV+ AHPQ+PNQ A 
Sbjct  1021  QLIYASFLDATVCVFTFTPLHMRCRIIPSAYLSPSISNSN--VHPVVVAAHPQDPNQFAL  1078

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DGS+ V EPLES G+WG+
Sbjct  1079  GLSDGSVHVFEPLESEGKWGV  1099



>ref|XP_008337262.1| PREDICTED: topless-related protein 4 [Malus domestica]
 ref|XP_008337263.1| PREDICTED: topless-related protein 4 [Malus domestica]
Length=1131

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ A 
Sbjct  1030  QLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPS---NPSLRVYPLVVAAHPSEPNQFAL  1086

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG + V+EPLES G+WG
Sbjct  1087  GLTDGGVHVLEPLESEGKWG  1106



>ref|XP_010539522.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539523.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
 ref|XP_010539524.1| PREDICTED: protein TOPLESS-like [Tarenaya hassleriana]
Length=1120

 Score = 97.4 bits (241),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASFKD  + VF +  LR RC + PSAYL   + N N  V+ VVI AHPQEPN  A 
Sbjct  1029  QLIYASFKDATVCVFTSSNLRLRCRVNPSAYLPSNLSNSN--VHPVVIAAHPQEPNMFAE  1086

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG + + EPLES G WG++
Sbjct  1087  GLSDGGVHIFEPLESEGGWGVA  1108



>gb|KCW80100.1| hypothetical protein EUGRSUZ_C014271, partial [Eucalyptus grandis]
Length=177

 Score = 92.0 bits (227),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 3/79 (4%)
 Frame = -2

Query  699  IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
            IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ A GL
Sbjct  85   IYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQFALGL  141

Query  519  TDGSIKVIEPLESGGEWGI  463
            TDGS+ V+EPLE  GEWG 
Sbjct  142  TDGSVYVLEPLEYEGEWGT  160



>ref|XP_004296880.1| PREDICTED: topless-related protein 2 [Fragaria vesca subsp. vesca]
Length=1124

 Score = 97.4 bits (241),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA F DGNIGVFDA  L+ RC IA S YL+QA  + +  VY + + AH QEP Q A 
Sbjct  1022  QLVYAGFTDGNIGVFDADSLKLRCRIAMSVYLAQASPSSHT-VYPLALTAHLQEPYQFAV  1080

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DGS+KVIEP ++ G+WG++
Sbjct  1081  GLSDGSVKVIEPSDAEGKWGVT  1102



>ref|XP_009395915.1| PREDICTED: topless-related protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=1133

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  I VF+A   R RC I P+AYL  +V   +  +Y +VI AHP EPNQ A 
Sbjct  1028  QLIYASFLDATICVFNATNFRLRCRILPAAYLPASV---STTLYPLVIAAHPSEPNQFAL  1084

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG++
Sbjct  1085  GLTDGGVHVLEPLESEGKWGVN  1106



>ref|XP_002517701.1| WD-repeat protein, putative [Ricinus communis]
 gb|EEF44865.1| WD-repeat protein, putative [Ricinus communis]
Length=1115

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF A  LR RC I PS+YLS    N +  ++ +VI AHPQEPNQ A 
Sbjct  1010  QLVYASFLDATVCVFSAQNLRLRCRINPSSYLSA---NVSSSLHPLVIAAHPQEPNQFAL  1066

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1067  GLSDGGVHVFEPLESEGKWGV  1087



>ref|XP_002275116.1| PREDICTED: protein TOPLESS isoform X3 [Vitis vinifera]
 emb|CBI26554.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ+A G
Sbjct  1030  LVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS--SGVYPLVIAAHPSEPNQIALG  1087

Query  522   LTDGSIKVIEPLESGGEWG  466
             ++DG++ V+EP ++  +WG
Sbjct  1088  MSDGAVHVVEPTDTEPKWG  1106



>ref|XP_010662133.1| PREDICTED: protein TOPLESS isoform X1 [Vitis vinifera]
Length=1139

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 2/79 (3%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ+A G
Sbjct  1034  LVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS--SGVYPLVIAAHPSEPNQIALG  1091

Query  522   LTDGSIKVIEPLESGGEWG  466
             ++DG++ V+EP ++  +WG
Sbjct  1092  MSDGAVHVVEPTDTEPKWG  1110



>ref|XP_004486641.1| PREDICTED: protein TOPLESS-like isoform X2 [Cicer arietinum]
Length=1149

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL++ASF D  + VF A  LR RC I PSAYLS    N +  V+++VI AHPQEPNQ A 
Sbjct  1046  QLVFASFLDATVCVFSASNLRLRCRINPSAYLSA---NVSSNVHSLVIAAHPQEPNQFAV  1102

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1103  GLSDGIVHVFEPLESEGKWGV  1123



>ref|XP_009363995.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
 ref|XP_009363996.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
Length=1129

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ A 
Sbjct  1028  QLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQFAL  1084

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG + V+EPLES G+WG
Sbjct  1085  GLTDGGVHVLEPLESEGKWG  1104



>ref|XP_002268265.1| PREDICTED: protein TOPLESS [Vitis vinifera]
 emb|CBI36431.3| unnamed protein product [Vitis vinifera]
Length=1138

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YASF D  + VF A  LR RC I P+AYL  +V N N  V+ +VI AHPQEPNQ A G
Sbjct  1033  LVYASFLDATVCVFSAANLRLRCRINPTAYLPASVSNSN--VHPLVIAAHPQEPNQFALG  1090

Query  522   LTDGSIKVIEPLESGGEWGI  463
             L+DG + V EPLES G+WG+
Sbjct  1091  LSDGGVCVFEPLESEGKWGV  1110



>ref|XP_008385358.1| PREDICTED: topless-related protein 4-like [Malus domestica]
Length=254

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ A 
Sbjct  153  QLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQFAL  209

Query  525  GLTDGSIKVIEPLESGGEWGIS  460
            GL+DG + V+EPLES G+WG +
Sbjct  210  GLSDGGVHVLEPLESEGKWGTN  231



>ref|XP_010662135.1| PREDICTED: protein TOPLESS isoform X4 [Vitis vinifera]
Length=1134

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ+A G
Sbjct  1030  LVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS---GVYPLVIAAHPSEPNQIALG  1086

Query  522   LTDGSIKVIEPLESGGEWG  466
             ++DG++ V+EP ++  +WG
Sbjct  1087  MSDGAVHVVEPTDTEPKWG  1105



>ref|XP_010662134.1| PREDICTED: protein TOPLESS isoform X2 [Vitis vinifera]
Length=1138

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA F DG +GVFDA  LR RC IAPSAY+    L+   GVY +VI AHP EPNQ+A G
Sbjct  1034  LVYAGFGDGAVGVFDADSLRLRCRIAPSAYIPSPALS---GVYPLVIAAHPSEPNQIALG  1090

Query  522   LTDGSIKVIEPLESGGEWG  466
             ++DG++ V+EP ++  +WG
Sbjct  1091  MSDGAVHVVEPTDTEPKWG  1109



>ref|XP_008376897.1| PREDICTED: topless-related protein 1-like isoform X2 [Malus domestica]
Length=1133

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ+A G
Sbjct  1029  LVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQIALG  1087

Query  522   LTDGSIKVIEPLESGGEWG  466
             +TDGS+ V+EP ++  +WG
Sbjct  1088  MTDGSVHVVEPSDAELKWG  1106



>ref|XP_008376892.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376893.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376895.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
 ref|XP_008376896.1| PREDICTED: topless-related protein 1-like isoform X1 [Malus domestica]
Length=1134

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YASF DG +GVFDA  LR RC IAP+AY+    L+ N   YA+VI AHP EPNQ+A G
Sbjct  1030  LVYASFCDGAVGVFDADTLRLRCRIAPTAYIPSFSLSGNPS-YALVIAAHPSEPNQIALG  1088

Query  522   LTDGSIKVIEPLESGGEWG  466
             +TDGS+ V+EP ++  +WG
Sbjct  1089  MTDGSVHVVEPSDAELKWG  1107



>ref|XP_010906011.1| PREDICTED: protein TOPLESS [Elaeis guineensis]
Length=1135

 Score = 96.7 bits (239),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  I +  A  LRPRC I P+AYL     N +  V+ +V+ AHP EPNQ A 
Sbjct  1030  QLIYASFLDATICILSAANLRPRCRILPAAYLPA---NISTTVHPLVVAAHPSEPNQFAL  1086

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG++
Sbjct  1087  GLTDGGVHILEPLESEGKWGVA  1108



>gb|KCW80088.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=334

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ A 
Sbjct  233  QSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQFAL  289

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GLTDGS+ V+EPLES G+WG
Sbjct  290  GLTDGSVYVLEPLESQGKWG  309



>gb|KCW80012.1| hypothetical protein EUGRSUZ_C01349 [Eucalyptus grandis]
Length=411

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q IY SF+DG+I V  A  LR RC I P+AY+     N N  VY +VI AHP +PNQ A 
Sbjct  310  QSIYVSFEDGSINVLSASTLRLRCHINPAAYIPP---NPNLRVYPLVIAAHPSQPNQFAL  366

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GLTDGS+ V+EPLES GEWG
Sbjct  367  GLTDGSVYVLEPLESEGEWG  386



>ref|XP_009368882.1| PREDICTED: topless-related protein 4-like [Pyrus x bretschneideri]
Length=1096

 Score = 96.3 bits (238),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ A 
Sbjct  995   QLIYVSFEDGSVGVLTALALRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQFAL  1051

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG + V+EPLES G+WG
Sbjct  1052  GLTDGGVHVLEPLESEGKWG  1071



>ref|XP_010047998.1| PREDICTED: topless-related protein 4-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW80087.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=366

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ A 
Sbjct  265  QSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQFAL  321

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GLTDGS+ V+EPLES G+WG
Sbjct  322  GLTDGSVYVLEPLESQGKWG  341



>ref|XP_002443908.1| hypothetical protein SORBIDRAFT_07g004180 [Sorghum bicolor]
 gb|EES13403.1| hypothetical protein SORBIDRAFT_07g004180 [Sorghum bicolor]
Length=1136

 Score = 96.3 bits (238),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA+F DG IGVF+A  LR RC IAPSAY+  ++L     VY +V+ AHP EPNQ+A G
Sbjct  1028  LVYAAFCDGAIGVFEAESLRLRCRIAPSAYIPPSILACAGRVYPLVVAAHPMEPNQIALG  1087

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             ++DG + V+EPL+   +WG +
Sbjct  1088  MSDGKVHVVEPLDGDPKWGTA  1108



>ref|XP_011039630.1| PREDICTED: topless-related protein 1-like isoform X2 [Populus 
euphratica]
Length=1087

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ A 
Sbjct  980   QLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQFAI  1036

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS++V EPLES  +WG+
Sbjct  1037  GLTDGSVQVFEPLESDCKWGV  1057



>ref|XP_011039629.1| PREDICTED: topless-related protein 1-like isoform X1 [Populus 
euphratica]
Length=1099

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 45/81 (56%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF DG + VF A  L+ RC I P++YL   V   +  VY + I AHPQEPNQ A 
Sbjct  992   QLVYASFLDGTLRVFSASNLQVRCQINPNSYLPSDV---SSTVYPLAIAAHPQEPNQFAI  1048

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GLTDGS++V EPLES  +WG+
Sbjct  1049  GLTDGSVQVFEPLESDCKWGV  1069



>emb|CDP10439.1| unnamed protein product [Coffea canephora]
Length=1136

 Score = 96.3 bits (238),  Expect = 9e-19, Method: Composition-based stats.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N N  V+ +VI AHP EPNQ A 
Sbjct  1036  QSIYVSFEDGSVGVLTASSLRLRCRINPAAYLPT---NPNLRVHPLVIAAHPSEPNQFAL  1092

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDG I+V EPLES G+WG
Sbjct  1093  GLTDGGIQVFEPLESEGKWG  1112



>ref|XP_010048001.1| PREDICTED: topless-related protein 4-like isoform X3 [Eucalyptus 
grandis]
Length=797

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = -2

Query  699  IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
            IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ A GL
Sbjct  705  IYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQFALGL  761

Query  519  TDGSIKVIEPLESGGEWG  466
            TDGS+ V+EPLE  GEWG
Sbjct  762  TDGSVYVLEPLEYEGEWG  779



>gb|KCW80076.1| hypothetical protein EUGRSUZ_C01409 [Eucalyptus grandis]
Length=800

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = -2

Query  699  IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
            IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ A GL
Sbjct  708  IYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQFALGL  764

Query  519  TDGSIKVIEPLESGGEWG  466
            TDGS+ V+EPLE  GEWG
Sbjct  765  TDGSVYVLEPLEYEGEWG  782



>ref|XP_008363005.1| PREDICTED: topless-related protein 4-like [Malus domestica]
Length=800

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 45/80 (56%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            QLIY SF+DG++GV  A  LR RC I P+AYL     N +  VY +V+ AHP EPNQ A 
Sbjct  699  QLIYVSFEDGSVGVLTALTLRLRCRILPTAYLPP---NPSLRVYPLVVAAHPSEPNQFAL  755

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GL+DG + V+EPLES G+WG
Sbjct  756  GLSDGGVHVLEPLESEGKWG  775



>ref|XP_006389801.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27087.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1115

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  I VF +  LR RC I PSAYL  ++ N N  V+ +VI AHPQE N LA 
Sbjct  1013  QLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSN--VHPLVIAAHPQESNMLAV  1070

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG + + EPLES G+WG++
Sbjct  1071  GLSDGGVHIFEPLESEGKWGVA  1092



>ref|XP_006389802.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
 gb|ESQ27088.1| hypothetical protein EUTSA_v10018037mg [Eutrema salsugineum]
Length=1116

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  I VF +  LR RC I PSAYL  ++ N N  V+ +VI AHPQE N LA 
Sbjct  1014  QLIYASFMDATICVFSSANLRLRCRINPSAYLPASLSNSN--VHPLVIAAHPQESNMLAV  1071

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG + + EPLES G+WG++
Sbjct  1072  GLSDGGVHIFEPLESEGKWGVA  1093



>ref|XP_010050137.1| PREDICTED: topless-related protein 1-like [Eucalyptus grandis]
Length=457

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = -2

Query  699  IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
            IY SF+DG+IGV     LR  CCI P+AY+      R   VY +VIVAHP EPNQ A GL
Sbjct  359  IYVSFEDGSIGVLSTSTLRLICCINPAAYILPKPSLR---VYPLVIVAHPSEPNQFALGL  415

Query  519  TDGSIKVIEPLESGGEWG  466
            TDGS+ V+EPLES GEWG
Sbjct  416  TDGSVYVLEPLESEGEWG  433



>ref|XP_010048000.1| PREDICTED: topless-related protein 4-like isoform X2 [Eucalyptus 
grandis]
Length=1084

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = -2

Query  699   IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
             IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ A GL
Sbjct  992   IYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQFALGL  1048

Query  519   TDGSIKVIEPLESGGEWG  466
             TDGS+ V+EPLE  GEWG
Sbjct  1049  TDGSVYVLEPLEYEGEWG  1066



>ref|XP_010047999.1| PREDICTED: topless-related protein 4-like isoform X1 [Eucalyptus 
grandis]
Length=1092

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/78 (59%), Positives = 54/78 (69%), Gaps = 3/78 (4%)
 Frame = -2

Query  699   IYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFGL  520
             IY SF+DG+IGVF A  LR RC I P+ Y+     N +  VY +VI AHP EPNQ A GL
Sbjct  1000  IYVSFEDGSIGVFTASTLRLRCRINPATYIPP---NPSFRVYPLVIAAHPSEPNQFALGL  1056

Query  519   TDGSIKVIEPLESGGEWG  466
             TDGS+ V+EPLE  GEWG
Sbjct  1057  TDGSVYVLEPLEYEGEWG  1074



>ref|NP_001061055.1| Os08g0162100 [Oryza sativa Japonica Group]
 dbj|BAF22969.1| Os08g0162100 [Oryza sativa Japonica Group]
 gb|EAZ05686.1| hypothetical protein OsI_27917 [Oryza sativa Indica Group]
 dbj|BAL44266.1| ASP1 protein [Oryza sativa Japonica Group]
Length=1133

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             LIYA F DG IGVF+A  LR RC IAPSAY+  + ++    VY +V+ AHP EPNQ+A G
Sbjct  1031  LIYAGFCDGAIGVFEAESLRLRCRIAPSAYIPPS-MSSGGSVYPMVVAAHPLEPNQIAVG  1089

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             ++DG++ V+EPL+S  +WG++
Sbjct  1090  MSDGAVHVVEPLDSDPKWGVA  1110



>gb|KCW80086.1| hypothetical protein EUGRSUZ_C01415 [Eucalyptus grandis]
Length=423

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 3/80 (4%)
 Frame = -2

Query  705  QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
            Q IY SF+DG+IGV  A  LR RC I P+AY+       +  VY +VI AHP EPNQ A 
Sbjct  322  QSIYVSFEDGSIGVLIAPTLRMRCLINPAAYIPP---TPSLKVYPIVIAAHPSEPNQFAL  378

Query  525  GLTDGSIKVIEPLESGGEWG  466
            GLTDGS+ V+EPLES G+WG
Sbjct  379  GLTDGSVYVLEPLESQGKWG  398



>ref|XP_010050598.1| PREDICTED: topless-related protein 4-like [Eucalyptus grandis]
Length=1620

 Score = 95.9 bits (237),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 46/80 (58%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG+I V  A  LR RCCI P+AY+     N +  VY +VI AHP EPNQ A 
Sbjct  1519  QSIYVSFEDGSISVLTASTLRLRCCINPAAYVPP---NPSFRVYPLVIAAHPSEPNQFAL  1575

Query  525   GLTDGSIKVIEPLESGGEWG  466
             GLTDGS+ V+EP E  GEWG
Sbjct  1576  GLTDGSVYVLEPWEFEGEWG  1595



>ref|XP_007138952.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
 gb|ESW10946.1| hypothetical protein PHAVU_009G252100g [Phaseolus vulgaris]
Length=1047

 Score = 95.5 bits (236),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YA+F DGNIG+FDA+ L+ +C +A SAYL Q  + R + VY  V+ AHP EP+Q+A 
Sbjct  968   QLVYATFTDGNIGIFDANTLKLKCRMASSAYLHQPSIIR-QNVYPTVVAAHPGEPDQIAI  1026

Query  525   GLTDGSIKVIEPLESGGEW  469
             GL+DGSIKVIEP     +W
Sbjct  1027  GLSDGSIKVIEPRGCDRKW  1045



>dbj|BAC99788.1| WD-40 repeat protein-like [Oryza sativa Japonica Group]
 gb|EAZ41606.1| hypothetical protein OsJ_26138 [Oryza sativa Japonica Group]
Length=1150

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             LIYA F DG IGVF+A  LR RC IAPSAY+  + ++    VY +V+ AHP EPNQ+A G
Sbjct  1048  LIYAGFCDGAIGVFEAESLRLRCRIAPSAYIPPS-MSSGGSVYPMVVAAHPLEPNQIAVG  1106

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             ++DG++ V+EPL+S  +WG++
Sbjct  1107  MSDGAVHVVEPLDSDPKWGVA  1127



>gb|KHG27106.1| Topless-related 1 -like protein [Gossypium arboreum]
Length=1133

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  I VF A  LRPRC I PSAYL  +V + N  V+ +VI AHP EPN+ A 
Sbjct  1027  QLVYASFLDATICVFVAANLRPRCRINPSAYLPASVSSSN--VHPLVIAAHPSEPNEFAV  1084

Query  525   GLTDGSIKVIEPLESGGEWGISR  457
             GL+DG + V EPLES   WG+ +
Sbjct  1085  GLSDGGVHVFEPLESENRWGVPQ  1107



>ref|XP_007013512.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
 gb|EOY31131.1| Transducin family protein / WD-40 repeat family protein isoform 
7 [Theobroma cacao]
Length=1057

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  956   QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1012

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1013  GLTDGGVHILEPLESEGKWGTS  1034



>ref|XP_007013513.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
 gb|EOY31132.1| Transducin family protein / WD-40 repeat family protein isoform 
8 [Theobroma cacao]
Length=1055

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  954   QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1010

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1011  GLTDGGVHILEPLESEGKWGTS  1032



>ref|NP_563981.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_849672.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031050.1| protein TOPLESS [Arabidopsis thaliana]
 ref|NP_001031051.1| protein TOPLESS [Arabidopsis thaliana]
 sp|Q94AI7.1|TPL_ARATH RecName: Full=Protein TOPLESS; AltName: Full=WUS-interacting 
protein 1 [Arabidopsis thaliana]
 gb|AAK76687.1| unknown protein [Arabidopsis thaliana]
 gb|AAN13188.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29356.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29357.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29358.1| protein TOPLESS [Arabidopsis thaliana]
 gb|AEE29359.1| protein TOPLESS [Arabidopsis thaliana]
Length=1131

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF +  LR RC + PSAYL  ++ N N  V+ +VI AHPQEPN  A 
Sbjct  1025  QLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSN--VHPLVIAAHPQEPNMFAV  1082

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG + + EPLES G+WG++
Sbjct  1083  GLSDGGVHIFEPLESEGKWGVA  1104



>gb|AAF82145.1|AC034256_9 Strong similarity to an unknown protein T21F11.18 gi|6730738 
from Arabidopsis thaliana BAC T21F11 gb|AC018849 and contains 
multiple WD PF|00400 domains. ESTs gb|Z34157, gb|AA006273, 
gb|AA605431, gb|W43588, gb|W43605, gb|Z34559, gb|R90037, gb|AI994125 
come from this gene [Arabidopsis thaliana]
Length=1153

 Score = 95.5 bits (236),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/82 (52%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF +  LR RC + PSAYL  ++ N N  V+ +VI AHPQEPN  A 
Sbjct  1047  QLVYASFMDATVCVFSSANLRLRCRVNPSAYLPASLSNSN--VHPLVIAAHPQEPNMFAV  1104

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GL+DG + + EPLES G+WG++
Sbjct  1105  GLSDGGVHIFEPLESEGKWGVA  1126



>gb|KJB64727.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
 gb|KJB64728.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
 gb|KJB64730.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
Length=1134

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I+P+AYL     N +  V+ +VI AHP +PNQ A 
Sbjct  1033  QSIYVSFEDGSVGVLTASTLRLRCRISPAAYLPP---NPSLRVFPLVIAAHPSDPNQFAL  1089

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG ++++EPLES G+WG S
Sbjct  1090  GLTDGGVQIVEPLESEGKWGTS  1111



>ref|XP_004972767.1| PREDICTED: topless-related protein 1-like [Setaria italica]
Length=1138

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA+F DG IGVF+A  LR RC I PSAY+  ++L  +  VY +V+ AHP EPNQ+A G
Sbjct  1030  LVYATFCDGAIGVFEADSLRLRCRIGPSAYIPPSMLPTSGRVYPLVVAAHPVEPNQIALG  1089

Query  522   LTDGSIKVIEPLESGGEWGIS  460
             ++DG + V+EPL++  +WG +
Sbjct  1090  MSDGKVHVVEPLDADPKWGTA  1110



>gb|KJB64729.1| hypothetical protein B456_010G062200 [Gossypium raimondii]
Length=1135

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/82 (54%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I+P+AYL     N +  V+ +VI AHP +PNQ A 
Sbjct  1034  QSIYVSFEDGSVGVLTASTLRLRCRISPAAYLPP---NPSLRVFPLVIAAHPSDPNQFAL  1090

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG ++++EPLES G+WG S
Sbjct  1091  GLTDGGVQIVEPLESEGKWGTS  1112



>ref|NP_001167872.2| ramosa 1 enhancer locus 2 [Zea mays]
 gb|ADM15670.1| ramosa 1 enhancer locus 2 [Zea mays]
 gb|ADM15671.1| ramosa 1 enhancer locus 2 [Zea mays]
 gb|AFW57245.1| ramosa1 enhancer locus2 [Zea mays]
Length=1141

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  702   LIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAFG  523
             L+YA F DG IGVF+A  LR RC IAPSAY+  ++L     VY +V+ AHP EPNQ+A G
Sbjct  1029  LVYAGFCDGAIGVFEAESLRLRCRIAPSAYIPPSILACAGRVYPLVVAAHPMEPNQIAIG  1088

Query  522   LTDGSIKVIEPLESGGEWG  466
             ++DG + V+EPL+   +WG
Sbjct  1089  MSDGKVHVVEPLDGDPKWG  1107



>ref|XP_006597113.1| PREDICTED: protein TOPLESS-like isoform X1 [Glycine max]
 ref|XP_006597114.1| PREDICTED: protein TOPLESS-like isoform X2 [Glycine max]
Length=1130

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF    LR +C I PSAYLS +V   +  V  +VI AHPQEPNQ A 
Sbjct  1027  QLIYASFLDATVCVFSVSNLRLQCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQFAV  1083

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1084  GLSDGGVHVFEPLESEGKWGV  1104



>ref|XP_007013509.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
 gb|EOY31128.1| WUS-interacting protein 2 isoform 4 [Theobroma cacao]
Length=1132

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  1031  QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1087

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1088  GLTDGGVHILEPLESEGKWGTS  1109



>ref|XP_007013508.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 ref|XP_007013511.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31127.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
 gb|EOY31130.1| WUS-interacting protein 2 isoform 3 [Theobroma cacao]
Length=1135

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  1034  QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1090

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1091  GLTDGGVHILEPLESEGKWGTS  1112



>ref|XP_007013506.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
 gb|EOY31125.1| WUS-interacting protein 2 isoform 1 [Theobroma cacao]
Length=1137

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  1036  QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1092

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1093  GLTDGGVHILEPLESEGKWGTS  1114



>ref|XP_008813124.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813126.1| PREDICTED: protein TOPLESS-like isoform X2 [Phoenix dactylifera]
 ref|XP_008813127.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813128.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
 ref|XP_008813129.1| PREDICTED: protein TOPLESS-like isoform X1 [Phoenix dactylifera]
Length=1136

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  I +F+A  L  RC I P AYL  +V   +  VY +V+ AHP EPNQ A 
Sbjct  1031  QLIYASFLDATICIFNAANLTLRCRILPVAYLPASV---STTVYPLVVAAHPSEPNQFAL  1087

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + V+EPLES G+WG++
Sbjct  1088  GLTDGGVHVLEPLESEGKWGVA  1109



>ref|XP_007013510.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
 gb|EOY31129.1| WUS-interacting protein 2 isoform 5 [Theobroma cacao]
Length=1136

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  1035  QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1091

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1092  GLTDGGVHILEPLESEGKWGTS  1113



>ref|XP_007013507.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
 gb|EOY31126.1| WUS-interacting protein 2 isoform 2 [Theobroma cacao]
Length=1144

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/82 (55%), Positives = 56/82 (68%), Gaps = 3/82 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             Q IY SF+DG++GV  A  LR RC I P+AYL     N +  VY +VI AHP +PNQ A 
Sbjct  1043  QSIYVSFEDGSVGVLTASTLRLRCRIGPAAYLPP---NPSLRVYPLVIAAHPSDPNQFAL  1099

Query  525   GLTDGSIKVIEPLESGGEWGIS  460
             GLTDG + ++EPLES G+WG S
Sbjct  1100  GLTDGGVHILEPLESEGKWGTS  1121



>gb|KHN22427.1| Topless-related protein 1 [Glycine soja]
Length=1128

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 55/81 (68%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QLIYASF D  + VF    LR +C I PSAYLS +V   +  V  +VI AHPQEPNQ A 
Sbjct  1025  QLIYASFLDATVCVFSVSNLRLQCRINPSAYLSASV---SSNVQPLVIAAHPQEPNQFAV  1081

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG + V EPLES G+WG+
Sbjct  1082  GLSDGGVHVFEPLESEGKWGV  1102



>emb|CDO98186.1| unnamed protein product [Coffea canephora]
Length=1130

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF A  L+ RC I+P AYL  ++ N N  V  +VI AHPQ+PNQ A 
Sbjct  1025  QLVYASFLDAAVCVFTATHLQMRCRISPPAYLPNSISNSN--VQPLVIAAHPQDPNQFAI  1082

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG++ V EPLES G WG+
Sbjct  1083  GLSDGAVHVFEPLESDGRWGV  1103



>tpg|DAA53973.1| TPA: hypothetical protein ZEAMMB73_351755 [Zea mays]
Length=1086

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 49/102 (48%), Positives = 61/102 (60%), Gaps = 28/102 (27%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNR---------------------  589
             QL++A+F DGN+GVFDA  LR RC IAPS      V+NR                     
Sbjct  960   QLVFAAFTDGNLGVFDAENLRLRCRIAPS------VINRSIRSVIELTQGFRQLGCLFCL  1013

Query  588   -NEGVYAVVIVAHPQEPNQLAFGLTDGSIKVIEPLESGGEWG  466
              N  V+ +V+ AHP EPNQ A GL+DGS+KV+EPLES G+WG
Sbjct  1014  CNPPVHPLVVAAHPHEPNQFAVGLSDGSVKVLEPLESEGKWG  1055



>ref|XP_007214907.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
 gb|EMJ16106.1| hypothetical protein PRUPE_ppa000478mg [Prunus persica]
Length=1139

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF A  LR RC I PS YL   V N    V  +VI AHPQEPNQ A 
Sbjct  1035  QLVYASFLDATVCVFSAANLRLRCRINPSVYLPANVSNN---VQPLVIAAHPQEPNQFAL  1091

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG++ V EPLES G+WG+
Sbjct  1092  GLSDGAVHVFEPLESEGKWGV  1112



>ref|XP_008228737.1| PREDICTED: protein TOPLESS [Prunus mume]
Length=1139

 Score = 95.1 bits (235),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 46/81 (57%), Positives = 54/81 (67%), Gaps = 3/81 (4%)
 Frame = -2

Query  705   QLIYASFKDGNIGVFDAHRLRPRCCIAPSAYLSQAVLNRNEGVYAVVIVAHPQEPNQLAF  526
             QL+YASF D  + VF A  LR RC I PS YL   V N    V  +VI AHPQEPNQ A 
Sbjct  1035  QLVYASFLDATVCVFSAANLRLRCRINPSVYLPANVSNN---VQPLVIAAHPQEPNQFAL  1091

Query  525   GLTDGSIKVIEPLESGGEWGI  463
             GL+DG++ V EPLES G+WG+
Sbjct  1092  GLSDGAVHVFEPLESEGKWGV  1112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365