BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032G09

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796243.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    308   6e-98   Nicotiana sylvestris
ref|XP_009605827.1|  PREDICTED: glutamate receptor 3.6-like             311   2e-95   Nicotiana tomentosiformis
ref|XP_010316484.1|  PREDICTED: glutamate receptor 3.6 isoform X2       311   3e-95   Solanum lycopersicum
ref|XP_010316485.1|  PREDICTED: glutamate receptor 3.6 isoform X3       310   4e-95   Solanum lycopersicum
ref|XP_004232576.1|  PREDICTED: glutamate receptor 3.6 isoform X1       310   5e-95   
ref|XP_006340926.1|  PREDICTED: glutamate receptor 3.6-like             308   4e-94   
ref|XP_008242064.1|  PREDICTED: glutamate receptor 3.6-like             283   1e-90   Prunus mume [ume]
ref|XP_011022205.1|  PREDICTED: glutamate receptor 3.6-like isofo...    294   1e-89   Populus euphratica
ref|XP_011022202.1|  PREDICTED: glutamate receptor 3.6-like isofo...    294   5e-89   Populus euphratica
ref|XP_011022201.1|  PREDICTED: glutamate receptor 3.6-like isofo...    294   6e-89   Populus euphratica
ref|XP_011022199.1|  PREDICTED: glutamate receptor 3.6-like isofo...    294   7e-89   Populus euphratica
gb|KJB17453.1|  hypothetical protein B456_003G001400                    293   2e-88   Gossypium raimondii
ref|XP_002306436.1|  glutamate receptor family protein                  289   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_002276999.1|  PREDICTED: glutamate receptor 3.6                  288   9e-87   Vitis vinifera
emb|CBI21566.3|  unnamed protein product                                288   9e-87   Vitis vinifera
gb|KHG10460.1|  Glutamate receptor 3.6 -like protein                    286   6e-86   Gossypium arboreum [tree cotton]
gb|KDP43782.1|  hypothetical protein JCGZ_22409                         285   9e-86   Jatropha curcas
ref|XP_008245275.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    282   1e-85   
ref|XP_010029575.1|  PREDICTED: glutamate receptor 3.6                  284   2e-85   
gb|KCW56490.1|  hypothetical protein EUGRSUZ_I02216                     284   2e-85   Eucalyptus grandis [rose gum]
ref|XP_008241921.1|  PREDICTED: glutamate receptor 3.6-like isofo...    283   4e-85   
ref|XP_008241916.1|  PREDICTED: glutamate receptor 3.6-like isofo...    283   4e-85   Prunus mume [ume]
ref|XP_008440927.1|  PREDICTED: glutamate receptor 3.6 isoform X2       281   2e-84   Cucumis melo [Oriental melon]
emb|CDP01776.1|  unnamed protein product                                281   2e-84   Coffea canephora [robusta coffee]
ref|XP_008440920.1|  PREDICTED: glutamate receptor 3.6 isoform X1       281   3e-84   
ref|XP_007203996.1|  hypothetical protein PRUPE_ppa000995mg             280   6e-84   Prunus persica
gb|ABO28526.1|  glutamate receptor                                      279   1e-83   Malus hupehensis
ref|XP_009359614.1|  PREDICTED: glutamate receptor 3.6-like isofo...    278   2e-83   Pyrus x bretschneideri [bai li]
ref|XP_009359613.1|  PREDICTED: glutamate receptor 3.6-like isofo...    279   2e-83   
ref|XP_007203104.1|  hypothetical protein PRUPE_ppa023817mg             278   3e-83   Prunus persica
ref|XP_009359612.1|  PREDICTED: glutamate receptor 3.6-like isofo...    278   3e-83   
ref|XP_008337897.1|  PREDICTED: glutamate receptor 3.6-like             278   4e-83   
ref|XP_007046473.1|  Glutamate receptor 3.6                             277   6e-83   
ref|XP_007203235.1|  hypothetical protein PRUPE_ppa001033mg             277   8e-83   Prunus persica
gb|KGN48998.1|  hypothetical protein Csa_6G509670                       275   3e-82   Cucumis sativus [cucumbers]
ref|XP_004134824.1|  PREDICTED: glutamate receptor 3.6-like             275   5e-82   Cucumis sativus [cucumbers]
ref|XP_004158839.1|  PREDICTED: glutamate receptor 3.6-like             275   7e-82   
ref|XP_008337223.1|  PREDICTED: glutamate receptor 3.3-like             266   7e-81   
ref|XP_009369789.1|  PREDICTED: glutamate receptor 3.6-like             271   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_003608144.1|  Glutamate receptor 3.3                             261   1e-80   
ref|XP_006425261.1|  hypothetical protein CICLE_v10024825mg             270   2e-80   
ref|XP_006467098.1|  PREDICTED: glutamate receptor 3.6-like isofo...    268   1e-79   Citrus sinensis [apfelsine]
ref|XP_006467097.1|  PREDICTED: glutamate receptor 3.6-like isofo...    268   2e-79   Citrus sinensis [apfelsine]
gb|KHN38860.1|  Glutamate receptor 3.6                                  265   2e-78   Glycine soja [wild soybean]
ref|XP_008337216.1|  PREDICTED: glutamate receptor 3.3-like             254   2e-78   
ref|XP_007158022.1|  hypothetical protein PHAVU_002G117500g             264   2e-78   Phaseolus vulgaris [French bean]
ref|XP_003629105.1|  Glutamate receptor 3.6                             262   2e-78   
ref|XP_008344238.1|  PREDICTED: glutamate receptor 3.6-like             253   3e-78   
ref|XP_006587552.1|  PREDICTED: glutamate receptor 3.6-like isofo...    263   3e-78   Glycine max [soybeans]
ref|XP_003533407.2|  PREDICTED: glutamate receptor 3.6-like isofo...    264   5e-78   Glycine max [soybeans]
ref|XP_007158020.1|  hypothetical protein PHAVU_002G117500g             264   5e-78   Phaseolus vulgaris [French bean]
gb|KDO71524.1|  hypothetical protein CISIN_1g002301mg                   263   6e-78   Citrus sinensis [apfelsine]
ref|XP_007158021.1|  hypothetical protein PHAVU_002G117500g             264   7e-78   Phaseolus vulgaris [French bean]
gb|KDO71522.1|  hypothetical protein CISIN_1g002301mg                   263   2e-77   Citrus sinensis [apfelsine]
gb|KDO71521.1|  hypothetical protein CISIN_1g002301mg                   263   2e-77   Citrus sinensis [apfelsine]
ref|XP_008354606.1|  PREDICTED: glutamate receptor 3.6-like             252   2e-77   
gb|AET03581.2|  glutamate receptor 3.2                                  262   2e-77   Medicago truncatula
ref|XP_009791964.1|  PREDICTED: glutamate receptor 3.6-like             243   3e-77   Nicotiana sylvestris
ref|XP_007203997.1|  hypothetical protein PRUPE_ppa001054mg             262   3e-77   
ref|XP_006467103.1|  PREDICTED: glutamate receptor 3.6-like isofo...    262   4e-77   Citrus sinensis [apfelsine]
ref|XP_006425257.1|  hypothetical protein CICLE_v10024813mg             261   4e-77   Citrus clementina [clementine]
gb|KDO71514.1|  hypothetical protein CISIN_1g002505mg                   261   6e-77   Citrus sinensis [apfelsine]
ref|XP_007046474.1|  Glutamate receptor isoform 1                       261   9e-77   
gb|KHN12498.1|  Glutamate receptor 3.6                                  259   2e-76   Glycine soja [wild soybean]
ref|XP_007156253.1|  hypothetical protein PHAVU_003G270900g             259   4e-76   Phaseolus vulgaris [French bean]
ref|XP_010266354.1|  PREDICTED: glutamate receptor 3.3-like             256   6e-76   
ref|NP_190716.3|  glutamate receptor 3.6                                257   9e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876089.1|  ATGLR3.6                                           257   1e-75   
ref|XP_006292183.1|  hypothetical protein CARUB_v10018389mg             257   1e-75   Capsella rubella
emb|CDX80728.1|  BnaC08g05620D                                          241   2e-75   
ref|XP_006403911.1|  hypothetical protein EUTSA_v10010111mg             256   3e-75   Eutrema salsugineum [saltwater cress]
emb|CAB63012.1|  putative glutamate receptor                            257   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004289031.1|  PREDICTED: glutamate receptor 3.3-like             248   6e-75   Fragaria vesca subsp. vesca
ref|XP_010550509.1|  PREDICTED: glutamate receptor 3.6 isoform X2       254   1e-74   Tarenaya hassleriana [spider flower]
ref|XP_010550505.1|  PREDICTED: glutamate receptor 3.6 isoform X1       254   2e-74   Tarenaya hassleriana [spider flower]
ref|XP_009418664.1|  PREDICTED: glutamate receptor 3.3-like             254   2e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010680623.1|  PREDICTED: glutamate receptor 3.6-like             254   2e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004287716.1|  PREDICTED: glutamate receptor 3.6                  253   3e-74   Fragaria vesca subsp. vesca
ref|XP_010426704.1|  PREDICTED: glutamate receptor 3.6 isoform X1       253   3e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010503841.1|  PREDICTED: glutamate receptor 3.6-like isofo...    253   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008804484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    253   5e-74   Phoenix dactylifera
ref|XP_008804475.1|  PREDICTED: glutamate receptor 3.1-like isofo...    253   6e-74   Phoenix dactylifera
ref|XP_010515556.1|  PREDICTED: glutamate receptor 3.6-like isofo...    253   6e-74   Camelina sativa [gold-of-pleasure]
ref|XP_008786666.1|  PREDICTED: glutamate receptor 3.1                  252   8e-74   
ref|XP_004238633.2|  PREDICTED: glutamate receptor 3.3                  252   1e-73   Solanum lycopersicum
ref|XP_003547880.2|  PREDICTED: glutamate receptor 3.6-like             251   2e-73   Glycine max [soybeans]
ref|XP_006435401.1|  hypothetical protein CICLE_v10000195mg             251   2e-73   Citrus clementina [clementine]
ref|XP_003612376.1|  Glutamate receptor 3.6                             252   2e-73   
gb|KEH27628.1|  glutamate receptor 3.2                                  251   2e-73   Medicago truncatula
gb|KDO85160.1|  hypothetical protein CISIN_1g002309mg                   251   2e-73   Citrus sinensis [apfelsine]
gb|KDO85161.1|  hypothetical protein CISIN_1g002309mg                   251   2e-73   Citrus sinensis [apfelsine]
ref|XP_010110512.1|  Glutamate receptor 3.6                             251   2e-73   
ref|XP_006473826.1|  PREDICTED: glutamate receptor 3.3-like isofo...    251   3e-73   Citrus sinensis [apfelsine]
gb|KDP36767.1|  hypothetical protein JCGZ_08058                         251   3e-73   Jatropha curcas
emb|CDX73718.1|  BnaC08g22850D                                          250   5e-73   
ref|XP_010463180.1|  PREDICTED: glutamate receptor 3.3-like             249   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010478979.1|  PREDICTED: glutamate receptor 3.3-like             250   5e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010500221.1|  PREDICTED: glutamate receptor 3.3                  250   6e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006342151.1|  PREDICTED: glutamate receptor 3.3-like isofo...    249   2e-72   Solanum tuberosum [potatoes]
ref|XP_009401867.1|  PREDICTED: glutamate receptor 3.1-like             249   2e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003533409.1|  PREDICTED: glutamate receptor 3.3-like isofo...    249   2e-72   Glycine max [soybeans]
gb|AFK41266.1|  unknown                                                 232   2e-72   Lotus japonicus
ref|XP_002510703.1|  glutamate receptor 3 plant, putative               247   7e-72   Ricinus communis
ref|XP_011100274.1|  PREDICTED: glutamate receptor 3.3                  246   1e-71   Sesamum indicum [beniseed]
ref|XP_010103244.1|  Glutamate receptor 3.6                             247   1e-71   
ref|XP_010094542.1|  Glutamate receptor 3.3                             246   1e-71   Morus notabilis
ref|XP_010918356.1|  PREDICTED: glutamate receptor 3.1                  246   2e-71   Elaeis guineensis
ref|XP_006306244.1|  hypothetical protein CARUB_v10012075mg             245   3e-71   
gb|KHN35947.1|  Glutamate receptor 3.6                                  245   4e-71   Glycine soja [wild soybean]
ref|XP_003517130.1|  PREDICTED: glutamate receptor 3.6-like isofo...    245   4e-71   Glycine max [soybeans]
ref|XP_011461520.1|  PREDICTED: glutamate receptor 3.6-like             240   6e-71   Fragaria vesca subsp. vesca
ref|XP_008241924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    244   8e-71   
ref|XP_009786331.1|  PREDICTED: glutamate receptor 3.3 isoform X1       244   9e-71   Nicotiana sylvestris
ref|XP_004509457.1|  PREDICTED: glutamate receptor 3.6-like isofo...    243   1e-70   
ref|XP_004509455.1|  PREDICTED: glutamate receptor 3.6-like isofo...    244   1e-70   Cicer arietinum [garbanzo]
ref|XP_009115836.1|  PREDICTED: glutamate receptor 3.6 isoform X2       243   1e-70   Brassica rapa
ref|XP_003533408.1|  PREDICTED: glutamate receptor 3.3-like             243   2e-70   Glycine max [soybeans]
ref|XP_009115834.1|  PREDICTED: glutamate receptor 3.6 isoform X1       243   2e-70   Brassica rapa
ref|XP_009618635.1|  PREDICTED: glutamate receptor 3.3-like             243   2e-70   Nicotiana tomentosiformis
emb|CAN72607.1|  hypothetical protein VITISV_021339                     243   3e-70   Vitis vinifera
emb|CBI40741.3|  unnamed protein product                                243   3e-70   Vitis vinifera
ref|XP_011465033.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    242   3e-70   Fragaria vesca subsp. vesca
ref|XP_002272859.2|  PREDICTED: glutamate receptor 3.3                  242   4e-70   Vitis vinifera
ref|NP_174978.1|  glutamate receptor 3.3                                242   4e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008241922.1|  PREDICTED: glutamate receptor 3.6-like             242   4e-70   Prunus mume [ume]
ref|XP_002891241.1|  predicted protein                                  241   7e-70   Arabidopsis lyrata subsp. lyrata
ref|XP_006396004.1|  hypothetical protein EUTSA_v10003614mg             241   7e-70   Eutrema salsugineum [saltwater cress]
emb|CDY35797.1|  BnaA08g04580D                                          240   7e-70   Brassica napus [oilseed rape]
ref|XP_010266234.1|  PREDICTED: glutamate receptor 3.3-like isofo...    241   8e-70   Nelumbo nucifera [Indian lotus]
ref|XP_010266233.1|  PREDICTED: glutamate receptor 3.3-like isofo...    241   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010266235.1|  PREDICTED: glutamate receptor 3.3-like isofo...    241   1e-69   
ref|XP_010266230.1|  PREDICTED: glutamate receptor 3.3-like isofo...    241   1e-69   Nelumbo nucifera [Indian lotus]
gb|AAR27949.1|  GLR3.3                                                  241   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359611.1|  PREDICTED: glutamate receptor 3.6-like             240   2e-69   Pyrus x bretschneideri [bai li]
ref|XP_008337900.1|  PREDICTED: glutamate receptor 3.6-like             239   3e-69   
ref|XP_002306435.2|  hypothetical protein POPTR_0005s10560g             239   4e-69   
ref|XP_002306988.2|  Glutamate receptor 3.3 precursor family protein    239   4e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007018099.1|  Glutamate receptor 3.3 isoform 6                   239   5e-69   
ref|XP_007018096.1|  Glutamate receptor 3.3 isoform 3                   239   6e-69   
ref|XP_010266236.1|  PREDICTED: glutamate receptor 3.2-like             239   6e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007018094.1|  Glutamate receptor 3.3 isoform 1                   239   7e-69   
ref|XP_009392852.1|  PREDICTED: glutamate receptor 3.1-like isofo...    237   3e-68   
ref|XP_009392853.1|  PREDICTED: glutamate receptor 3.1-like isofo...    236   4e-68   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP43779.1|  hypothetical protein JCGZ_22406                         236   4e-68   Jatropha curcas
ref|XP_010530328.1|  PREDICTED: glutamate receptor 3.3                  236   4e-68   Tarenaya hassleriana [spider flower]
ref|XP_009107640.1|  PREDICTED: glutamate receptor 3.3 isoform X1       236   5e-68   Brassica rapa
gb|AET03597.2|  glutamate receptor 3.2                                  236   6e-68   Medicago truncatula
ref|XP_007203444.1|  hypothetical protein PRUPE_ppa022019mg             234   2e-67   
ref|XP_007135963.1|  hypothetical protein PHAVU_009G006500g             234   3e-67   Phaseolus vulgaris [French bean]
ref|XP_011022198.1|  PREDICTED: glutamate receptor 3.6-like             234   3e-67   Populus euphratica
ref|XP_011041194.1|  PREDICTED: glutamate receptor 3.3-like             234   3e-67   Populus euphratica
ref|XP_010935350.1|  PREDICTED: glutamate receptor 3.1                  233   8e-67   Elaeis guineensis
ref|XP_009359749.1|  PREDICTED: glutamate receptor 3.6-like             232   1e-66   
ref|XP_008237957.1|  PREDICTED: glutamate receptor 3.3                  232   2e-66   Prunus mume [ume]
ref|XP_008337899.1|  PREDICTED: glutamate receptor 3.6-like             231   3e-66   Malus domestica [apple tree]
ref|XP_007210370.1|  hypothetical protein PRUPE_ppa001283mg             231   3e-66   
ref|XP_004512282.1|  PREDICTED: glutamate receptor 3.6-like isofo...    231   3e-66   Cicer arietinum [garbanzo]
ref|XP_004512281.1|  PREDICTED: glutamate receptor 3.6-like isofo...    231   4e-66   Cicer arietinum [garbanzo]
ref|XP_010923968.1|  PREDICTED: glutamate receptor 3.4-like             230   6e-66   Elaeis guineensis
gb|KJB57940.1|  hypothetical protein B456_009G186500                    230   7e-66   Gossypium raimondii
ref|XP_008373417.1|  PREDICTED: glutamate receptor 3.3                  230   9e-66   
ref|XP_008453000.1|  PREDICTED: glutamate receptor 3.3 isoform X2       229   9e-66   Cucumis melo [Oriental melon]
gb|KCW70331.1|  hypothetical protein EUGRSUZ_F03574                     229   9e-66   Eucalyptus grandis [rose gum]
ref|XP_006590755.1|  PREDICTED: glutamate receptor 3.6-like isofo...    229   1e-65   Glycine max [soybeans]
ref|XP_010063139.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    229   2e-65   
ref|XP_008452999.1|  PREDICTED: glutamate receptor 3.3 isoform X1       229   2e-65   Cucumis melo [Oriental melon]
ref|XP_003603849.1|  Glutamate-gated kainate-type ion channel rec...    229   2e-65   
gb|KEH36346.1|  glutamate receptor 3.2                                  229   3e-65   Medicago truncatula
ref|XP_002313575.2|  Glutamate receptor 3.1 precursor family protein    228   3e-65   
emb|CDP07274.1|  unnamed protein product                                228   4e-65   Coffea canephora [robusta coffee]
ref|XP_008803655.1|  PREDICTED: glutamate receptor 3.5-like             228   4e-65   Phoenix dactylifera
ref|XP_009372603.1|  PREDICTED: glutamate receptor 3.3-like             227   9e-65   Pyrus x bretschneideri [bai li]
gb|KHG26328.1|  Glutamate receptor 3.3 -like protein                    227   9e-65   Gossypium arboreum [tree cotton]
gb|KHN41809.1|  Glutamate receptor 3.6                                  227   1e-64   Glycine soja [wild soybean]
ref|XP_008392995.1|  PREDICTED: glutamate receptor 3.6-like             226   2e-64   
ref|XP_002520606.1|  glutamate receptor 3 plant, putative               226   3e-64   Ricinus communis
ref|XP_011034843.1|  PREDICTED: glutamate receptor 3.3-like isofo...    225   4e-64   Populus euphratica
ref|XP_011034842.1|  PREDICTED: glutamate receptor 3.3-like isofo...    225   4e-64   Populus euphratica
ref|XP_011034844.1|  PREDICTED: glutamate receptor 3.3-like isofo...    225   4e-64   Populus euphratica
ref|XP_002301908.2|  Glutamate receptor 3.3 precursor family protein    225   4e-64   Populus trichocarpa [western balsam poplar]
ref|XP_004500849.1|  PREDICTED: glutamate receptor 3.3-like isofo...    225   5e-64   
ref|XP_011000874.1|  PREDICTED: glutamate receptor 3.2                  225   5e-64   Populus euphratica
ref|XP_004500848.1|  PREDICTED: glutamate receptor 3.3-like isofo...    225   5e-64   Cicer arietinum [garbanzo]
gb|KJB47169.1|  hypothetical protein B456_008G013900                    224   6e-64   Gossypium raimondii
ref|XP_009417233.1|  PREDICTED: glutamate receptor 3.4-like             224   6e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB47170.1|  hypothetical protein B456_008G013900                    224   8e-64   Gossypium raimondii
ref|XP_006577929.1|  PREDICTED: glutamate receptor 3.3-like             224   9e-64   Glycine max [soybeans]
gb|EYU41186.1|  hypothetical protein MIMGU_mgv1a000937mg                224   1e-63   Erythranthe guttata [common monkey flower]
gb|KHG21169.1|  Glutamate receptor 3.2 -like protein                    224   1e-63   Gossypium arboreum [tree cotton]
ref|XP_006855692.1|  hypothetical protein AMTR_s00044p00137040          224   1e-63   Amborella trichopoda
gb|KHN33784.1|  Glutamate receptor 3.3                                  223   3e-63   Glycine soja [wild soybean]
gb|KDP43780.1|  hypothetical protein JCGZ_22407                         221   9e-63   Jatropha curcas
gb|KHN46864.1|  Glutamate receptor 3.2                                  221   1e-62   Glycine soja [wild soybean]
ref|XP_003545055.1|  PREDICTED: glutamate receptor 3.2-like isofo...    221   1e-62   
ref|XP_006595634.1|  PREDICTED: glutamate receptor 3.2-like isofo...    221   1e-62   
ref|XP_011087613.1|  PREDICTED: glutamate receptor 3.2-like isofo...    221   2e-62   Sesamum indicum [beniseed]
ref|XP_004952127.1|  PREDICTED: glutamate receptor 3.1-like isofo...    221   2e-62   Setaria italica
ref|XP_004952125.1|  PREDICTED: glutamate receptor 3.1-like isofo...    220   2e-62   
ref|XP_007043075.1|  Glutamate receptor 2 isoform 1                     220   3e-62   
ref|XP_002279899.1|  PREDICTED: glutamate receptor 3.2                  220   3e-62   Vitis vinifera
ref|XP_007043076.1|  Glutamate receptor 2 isoform 2                     220   3e-62   
gb|EEE56178.1|  hypothetical protein OsJ_05129                          219   3e-62   Oryza sativa Japonica Group [Japonica rice]
gb|KHG05232.1|  Glutamate receptor 3.2 -like protein                    219   5e-62   Gossypium arboreum [tree cotton]
ref|NP_001045687.1|  Os02g0117500                                       219   5e-62   
ref|XP_003527293.1|  PREDICTED: glutamate receptor 3.3-like isofo...    219   6e-62   Glycine max [soybeans]
ref|XP_010270511.1|  PREDICTED: glutamate receptor 3.3-like isofo...    218   8e-62   
ref|XP_010270510.1|  PREDICTED: glutamate receptor 3.3-like isofo...    218   1e-61   
ref|XP_010270508.1|  PREDICTED: glutamate receptor 3.3-like isofo...    218   1e-61   
emb|CBI37733.3|  unnamed protein product                                220   1e-61   Vitis vinifera
ref|XP_010270507.1|  PREDICTED: glutamate receptor 3.3-like isofo...    218   1e-61   
emb|CDX75491.1|  BnaA01g02110D                                          203   2e-61   
ref|XP_010907850.1|  PREDICTED: glutamate receptor 3.4-like             217   3e-61   Elaeis guineensis
ref|XP_010270512.1|  PREDICTED: glutamate receptor 3.2-like isofo...    217   3e-61   
gb|EYU33298.1|  hypothetical protein MIMGU_mgv1a001051mg                217   3e-61   Erythranthe guttata [common monkey flower]
ref|XP_008645171.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    217   3e-61   
ref|XP_006422389.1|  hypothetical protein CICLE_v10027770mg             216   4e-61   
ref|XP_007203978.1|  hypothetical protein PRUPE_ppa025247mg             216   4e-61   
ref|XP_010028854.1|  PREDICTED: glutamate receptor 3.2-like isofo...    216   5e-61   
gb|KCW55682.1|  hypothetical protein EUGRSUZ_I01532                     216   5e-61   Eucalyptus grandis [rose gum]
ref|XP_004145549.1|  PREDICTED: glutamate receptor 3.3-like             216   6e-61   Cucumis sativus [cucumbers]
ref|XP_006422390.1|  hypothetical protein CICLE_v10027770mg             216   6e-61   Citrus clementina [clementine]
ref|XP_006486565.1|  PREDICTED: glutamate receptor 3.2-like isofo...    216   6e-61   Citrus sinensis [apfelsine]
gb|KDO68407.1|  hypothetical protein CISIN_1g002211mg                   216   6e-61   Citrus sinensis [apfelsine]
gb|EEC72350.1|  hypothetical protein OsI_05591                          216   8e-61   Oryza sativa Indica Group [Indian rice]
gb|AFW69814.1|  hypothetical protein ZEAMMB73_405216                    215   1e-60   
gb|ACN36836.1|  unknown                                                 206   2e-60   Zea mays [maize]
ref|XP_006646788.1|  PREDICTED: glutamate receptor 3.1-like             215   2e-60   Oryza brachyantha
emb|CAN64711.1|  hypothetical protein VITISV_043726                     214   4e-60   Vitis vinifera
ref|XP_009416682.1|  PREDICTED: glutamate receptor 3.4-like             214   4e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007046476.1|  Glutamate receptor 3.4, putative isoform 3         211   2e-59   
ref|XP_002451392.1|  hypothetical protein SORBIDRAFT_04g001300          211   3e-59   
ref|XP_008242065.1|  PREDICTED: glutamate receptor 3.6-like             210   8e-59   Prunus mume [ume]
gb|KJB79723.1|  hypothetical protein B456_013G064100                    209   1e-58   Gossypium raimondii
ref|XP_009763348.1|  PREDICTED: glutamate receptor 3.2-like             209   2e-58   Nicotiana sylvestris
ref|XP_008812266.1|  PREDICTED: glutamate receptor 3.4 isoform X2       208   2e-58   
gb|KJB79725.1|  hypothetical protein B456_013G064100                    209   2e-58   Gossypium raimondii
ref|XP_009608800.1|  PREDICTED: glutamate receptor 3.2-like             209   2e-58   Nicotiana tomentosiformis
ref|XP_008812265.1|  PREDICTED: glutamate receptor 3.4 isoform X1       209   3e-58   Phoenix dactylifera
ref|XP_006283116.1|  hypothetical protein CARUB_v10004138mg             208   3e-58   
ref|XP_010446945.1|  PREDICTED: glutamate receptor 3.2-like             208   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_008358485.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    205   3e-58   
gb|KDP47011.1|  hypothetical protein JCGZ_10738                         208   4e-58   Jatropha curcas
ref|XP_003608176.1|  Glutamate receptor 3.3                             207   4e-58   
ref|XP_010680624.1|  PREDICTED: glutamate receptor 3.6-like             208   5e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|AFW66756.1|  hypothetical protein ZEAMMB73_452909                    207   7e-58   
ref|XP_010276016.1|  PREDICTED: glutamate receptor 3.4-like             207   8e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008235912.1|  PREDICTED: glutamate receptor 3.2-like             207   9e-58   Prunus mume [ume]
ref|XP_010090700.1|  Glutamate receptor 3.2                             207   1e-57   Morus notabilis
ref|XP_010432300.1|  PREDICTED: glutamate receptor 3.2                  206   1e-57   
ref|XP_003629121.1|  Glutamate receptor                                 205   2e-57   
ref|XP_009419590.1|  PREDICTED: glutamate receptor 3.5-like             206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002869097.1|  hypothetical protein ARALYDRAFT_491120             206   2e-57   
ref|XP_009399220.1|  PREDICTED: glutamate receptor 3.5-like             207   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010323822.1|  PREDICTED: glutamate receptor 3.4 isoform X2       206   2e-57   Solanum lycopersicum
ref|XP_010240316.1|  PREDICTED: glutamate receptor 3.1-like             206   2e-57   
gb|AAL24126.1|  unknown protein                                         206   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567981.1|  glutamate receptor 3.2                                206   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092253.1|  PREDICTED: glutamate receptor 3.2-like             206   3e-57   
ref|XP_004243468.1|  PREDICTED: glutamate receptor 3.4 isoform X1       206   4e-57   Solanum lycopersicum
dbj|BAL15055.1|  glutamate receptor 3.2                                 206   4e-57   Solanum lycopersicum
ref|XP_007202847.1|  hypothetical protein PRUPE_ppa014700mg             205   4e-57   
ref|XP_009403107.1|  PREDICTED: glutamate receptor 3.5-like             205   6e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010437494.1|  PREDICTED: glutamate receptor 3.2-like             205   6e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002459199.1|  hypothetical protein SORBIDRAFT_02g000430          205   7e-57   Sorghum bicolor [broomcorn]
ref|XP_010530965.1|  PREDICTED: glutamate receptor 3.2-like             204   8e-57   Tarenaya hassleriana [spider flower]
ref|XP_009103268.1|  PREDICTED: glutamate receptor 3.2                  204   1e-56   Brassica rapa
ref|XP_004290072.1|  PREDICTED: glutamate receptor 3.2-like             204   1e-56   Fragaria vesca subsp. vesca
ref|XP_006367285.1|  PREDICTED: glutamate receptor 3.4-like isofo...    204   1e-56   Solanum tuberosum [potatoes]
emb|CDX69127.1|  BnaC01g03260D                                          204   1e-56   
ref|XP_004966219.1|  PREDICTED: glutamate receptor 3.4-like             204   1e-56   Setaria italica
ref|XP_006858062.1|  hypothetical protein AMTR_s00062p00050250          204   1e-56   Amborella trichopoda
ref|XP_011079012.1|  PREDICTED: glutamate receptor 3.4                  203   3e-56   Sesamum indicum [beniseed]
ref|XP_009121143.1|  PREDICTED: glutamate receptor 3.1 isoform X2       202   3e-56   Brassica rapa
emb|CDY24327.1|  BnaA07g02520D                                          203   3e-56   Brassica napus [oilseed rape]
ref|XP_009121142.1|  PREDICTED: glutamate receptor 3.1 isoform X1       202   3e-56   Brassica rapa
gb|AAF21901.1|AF109392_1  ligand gated channel-like protein             202   4e-56   Brassica napus [oilseed rape]
emb|CDY65624.1|  BnaCnng48020D                                          202   6e-56   Brassica napus [oilseed rape]
ref|XP_007149970.1|  hypothetical protein PHAVU_005G114800g             202   7e-56   Phaseolus vulgaris [French bean]
ref|XP_004987272.1|  PREDICTED: glutamate receptor 3.4-like             202   8e-56   Setaria italica
ref|XP_006296930.1|  hypothetical protein CARUB_v10012924mg             202   8e-56   
ref|XP_006858063.1|  hypothetical protein AMTR_s00062p00055860          192   1e-55   
ref|XP_008670454.1|  PREDICTED: glutamate receptor 3.4-like             201   1e-55   
ref|NP_001053676.1|  Os04g0585200                                       192   1e-55   
ref|XP_006652703.1|  PREDICTED: glutamate receptor 3.1-like isofo...    194   2e-55   
ref|XP_010690549.1|  PREDICTED: glutamate receptor 3.2-like             201   2e-55   
ref|XP_003539503.1|  PREDICTED: glutamate receptor 3.4-like isofo...    201   2e-55   
gb|KHN44877.1|  Glutamate receptor 3.4                                  201   3e-55   
ref|XP_006364369.1|  PREDICTED: glutamate receptor 3.2-like             199   5e-55   
ref|XP_007200076.1|  hypothetical protein PRUPE_ppa021130mg             199   5e-55   
emb|CDY52597.1|  BnaCnng22760D                                          199   5e-55   
ref|XP_008382743.1|  PREDICTED: glutamate receptor 3.2-like             199   5e-55   
ref|XP_004957886.1|  PREDICTED: glutamate receptor 3.4-like             199   6e-55   
ref|XP_010515566.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   6e-55   
emb|CAA18740.1|  putative protein                                       199   6e-55   
ref|XP_006412122.1|  hypothetical protein EUTSA_v10024351mg             199   6e-55   
ref|XP_010426721.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   6e-55   
gb|EMT17124.1|  Glutamate receptor 3.1                                  199   7e-55   
ref|XP_010515561.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   1e-54   
ref|XP_010426707.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   1e-54   
ref|XP_010515560.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   1e-54   
ref|XP_008651910.1|  PREDICTED: glutamate receptor 3.4-like             199   1e-54   
ref|XP_010426717.1|  PREDICTED: glutamate receptor 3.6-like isofo...    198   1e-54   
ref|XP_008812269.1|  PREDICTED: glutamate receptor 3.7 isoform X2       198   1e-54   
ref|XP_008812267.1|  PREDICTED: glutamate receptor 3.7 isoform X1       198   1e-54   
ref|XP_008379924.1|  PREDICTED: glutamate receptor 3.4-like             197   2e-54   
ref|XP_010515565.1|  PREDICTED: glutamate receptor 3.6-like isofo...    197   2e-54   
ref|XP_008230073.1|  PREDICTED: glutamate receptor 3.4-like             198   2e-54   
ref|XP_007217063.1|  hypothetical protein PRUPE_ppa001079mg             197   2e-54   
ref|XP_002884045.1|  predicted protein                                  197   3e-54   
ref|XP_008348134.1|  PREDICTED: glutamate receptor 3.4-like             197   3e-54   
ref|XP_010233709.1|  PREDICTED: glutamate receptor 3.1 isoform X2       197   3e-54   
gb|AAK13248.1|AF159498_1  putative glutamate receptor like-protein      197   4e-54   
gb|EEE67292.1|  hypothetical protein OsJ_24491                          197   5e-54   
ref|XP_003573352.1|  PREDICTED: glutamate receptor 3.1 isoform X1       197   5e-54   
ref|XP_010548171.1|  PREDICTED: glutamate receptor 3.1-like isofo...    196   6e-54   
ref|XP_010548165.1|  PREDICTED: glutamate receptor 3.1-like isofo...    196   6e-54   
gb|EAZ02474.1|  hypothetical protein OsI_24580                          197   6e-54   
ref|XP_011463243.1|  PREDICTED: glutamate receptor 3.4 isoform X2       196   7e-54   
ref|XP_004151932.1|  PREDICTED: glutamate receptor 3.4-like             196   7e-54   
ref|XP_004171803.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    196   7e-54   
ref|XP_009353269.1|  PREDICTED: glutamate receptor 3.4-like             196   8e-54   
ref|XP_004487406.1|  PREDICTED: glutamate receptor 3.4-like isofo...    196   9e-54   
ref|XP_004289164.2|  PREDICTED: glutamate receptor 3.5 isoform X1       196   1e-53   
ref|XP_004487403.1|  PREDICTED: glutamate receptor 3.4-like isofo...    196   1e-53   
gb|EMT06356.1|  Glutamate receptor 3.1                                  195   1e-53   
ref|XP_010237634.1|  PREDICTED: glutamate receptor 3.4-like isofo...    196   1e-53   
gb|EMT02755.1|  Glutamate receptor 3.3                                  195   1e-53   
emb|CDP16877.1|  unnamed protein product                                195   2e-53   
ref|XP_003541945.1|  PREDICTED: glutamate receptor 3.4-like isofo...    196   2e-53   
ref|XP_003563011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    195   2e-53   
ref|XP_009765170.1|  PREDICTED: glutamate receptor 3.4                  195   2e-53   
gb|EEC82165.1|  hypothetical protein OsI_26240                          194   2e-53   
ref|XP_010507397.1|  PREDICTED: glutamate receptor 3.6-like             194   2e-53   
ref|XP_010267710.1|  PREDICTED: glutamate receptor 3.5-like isofo...    195   2e-53   
gb|EEE66428.1|  hypothetical protein OsJ_22782                          182   2e-53   
ref|XP_010267711.1|  PREDICTED: glutamate receptor 3.5-like isofo...    195   3e-53   
ref|XP_010267709.1|  PREDICTED: glutamate receptor 3.5-like isofo...    195   3e-53   
ref|XP_008455862.1|  PREDICTED: glutamate receptor 3.4-like             194   3e-53   
ref|XP_010467485.1|  PREDICTED: glutamate receptor 3.1-like isofo...    194   3e-53   
ref|XP_010467484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    194   3e-53   
ref|XP_009589005.1|  PREDICTED: glutamate receptor 3.4 isoform X2       194   3e-53   
gb|AAB92421.1|  ligand gated channel-like protein                       194   4e-53   
sp|Q7XJL2.2|GLR31_ARATH  RecName: Full=Glutamate receptor 3.1; Sh...    194   4e-53   
gb|AAR88099.1|  putative glutamate receptor ion channel                 194   4e-53   
tpg|DAA59325.1|  TPA: hypothetical protein ZEAMMB73_375779              194   5e-53   
gb|EMS57750.1|  Glutamate receptor 3.3                                  194   5e-53   
ref|XP_006652702.1|  PREDICTED: glutamate receptor 3.1-like isofo...    194   5e-53   
gb|EMS61084.1|  Glutamate receptor 3.4                                  194   6e-53   
ref|XP_009589003.1|  PREDICTED: glutamate receptor 3.4 isoform X1       194   6e-53   
gb|EYU35042.1|  hypothetical protein MIMGU_mgv1a001148mg                193   6e-53   
ref|NP_028351.2|  glutamate receptor                                    194   7e-53   
dbj|BAC10393.1|  glutamate receptor, ionotropic kainate 5 precurs...    194   7e-53   
ref|NP_001058687.1|  Os07g0103100                                       194   8e-53   
ref|XP_002437454.1|  hypothetical protein SORBIDRAFT_10g027370          194   9e-53   
gb|EYU24786.1|  hypothetical protein MIMGU_mgv1a000911mg                194   9e-53   
ref|XP_010689636.1|  PREDICTED: glutamate receptor 3.4-like             193   1e-52   
sp|Q7XP59.1|GLR31_ORYSJ  RecName: Full=Glutamate receptor 3.1; Al...    193   1e-52   
emb|CAH66856.1|  H0307D04.1                                             193   1e-52   
ref|XP_010515365.1|  PREDICTED: glutamate receptor 3.1                  192   2e-52   
dbj|BAK02402.1|  predicted protein                                      192   2e-52   
gb|EYU43117.1|  hypothetical protein MIMGU_mgv1a000935mg                192   2e-52   
gb|AAQ02674.1|  glutamate receptor                                      192   2e-52   
ref|XP_004966221.1|  PREDICTED: glutamate receptor 3.5-like             192   2e-52   
ref|XP_008644926.1|  PREDICTED: glutamate receptor 3.5-like isofo...    191   3e-52   
gb|EMS53869.1|  Glutamate receptor 3.3                                  191   3e-52   
dbj|BAJ99508.1|  predicted protein                                      192   3e-52   
gb|AFW69068.1|  hypothetical protein ZEAMMB73_591659                    192   3e-52   
emb|CDP11785.1|  unnamed protein product                                191   4e-52   
ref|XP_002460792.1|  hypothetical protein SORBIDRAFT_02g034960          192   4e-52   
ref|XP_008644925.1|  PREDICTED: glutamate receptor 3.5-like isofo...    191   4e-52   
dbj|BAK06938.1|  predicted protein                                      191   4e-52   
gb|AGN92471.1|  glutamate receptor 1                                    191   4e-52   
ref|XP_003561526.1|  PREDICTED: glutamate receptor 3.4-like             191   7e-52   
dbj|BAJ91183.1|  predicted protein                                      191   7e-52   
ref|XP_008455860.1|  PREDICTED: glutamate receptor 3.4-like isofo...    190   7e-52   
ref|XP_008455858.1|  PREDICTED: glutamate receptor 3.4-like isofo...    190   8e-52   
ref|XP_007204033.1|  hypothetical protein PRUPE_ppa020695mg             191   8e-52   
emb|CDY71348.1|  BnaAnng37040D                                          180   1e-51   
dbj|BAK04480.1|  predicted protein                                      190   2e-51   
gb|EPS72720.1|  glutamate receptor                                      188   3e-51   
ref|XP_010686867.1|  PREDICTED: glutamate receptor 3.3                  189   4e-51   
ref|XP_009625697.1|  PREDICTED: glutamate receptor 3.4-like isofo...    188   5e-51   
ref|XP_006409331.1|  hypothetical protein EUTSA_v10022533mg             189   5e-51   
ref|XP_004158559.1|  PREDICTED: glutamate receptor 3.4-like             189   5e-51   
ref|XP_004151885.1|  PREDICTED: glutamate receptor 3.4-like             189   6e-51   
ref|XP_008353536.1|  PREDICTED: glutamate receptor 3.4-like             189   6e-51   
ref|XP_002273744.3|  PREDICTED: glutamate receptor 3.4 isoform X1       188   6e-51   
gb|KJB50472.1|  hypothetical protein B456_008G173300                    187   7e-51   
emb|CAN66741.1|  hypothetical protein VITISV_021644                     188   7e-51   
ref|XP_004976611.1|  PREDICTED: glutamate receptor 3.1-like             188   8e-51   
ref|XP_009108610.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   8e-51   
ref|XP_009625694.1|  PREDICTED: glutamate receptor 3.4-like isofo...    188   9e-51   
ref|XP_004966220.1|  PREDICTED: glutamate receptor 3.5-like             187   1e-50   
ref|XP_009794415.1|  PREDICTED: glutamate receptor 3.4-like isofo...    187   1e-50   
ref|XP_002524179.1|  glutamate receptor 3 plant, putative               188   1e-50   
ref|XP_010690551.1|  PREDICTED: glutamate receptor 3.2-like             187   1e-50   
gb|EMS57327.1|  Glutamate receptor 3.4                                  187   1e-50   
ref|XP_008347560.1|  PREDICTED: glutamate receptor 3.2-like             180   1e-50   
ref|XP_011100303.1|  PREDICTED: glutamate receptor 3.5-like             186   1e-50   
ref|XP_006657772.1|  PREDICTED: glutamate receptor 3.4-like             187   1e-50   
gb|EMS63860.1|  Glutamate receptor 3.4                                  187   1e-50   
ref|XP_002301627.1|  Glutamate receptor 3.5 precursor family protein    187   1e-50   
gb|KJB50475.1|  hypothetical protein B456_008G173300                    187   2e-50   
gb|KJB50471.1|  hypothetical protein B456_008G173300                    187   2e-50   
gb|KJB50476.1|  hypothetical protein B456_008G173300                    187   2e-50   
dbj|BAD45488.1|  putative ionotropic glutamate receptor ortholog ...    186   2e-50   
ref|XP_009794414.1|  PREDICTED: glutamate receptor 3.4-like isofo...    187   2e-50   
ref|XP_009108609.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   2e-50   
ref|XP_008379630.1|  PREDICTED: glutamate receptor 3.4                  187   2e-50   
emb|CBI28943.3|  unnamed protein product                                188   2e-50   
ref|XP_010909025.1|  PREDICTED: glutamate receptor 3.7                  186   2e-50   
ref|NP_001058372.1|  Os06g0680500                                       186   3e-50   
ref|XP_009108608.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   3e-50   
gb|EAZ38031.1|  hypothetical protein OsJ_22375                          186   3e-50   
ref|XP_011008405.1|  PREDICTED: glutamate receptor 3.4 isoform X1       186   4e-50   
gb|EMT06987.1|  Glutamate receptor 3.3                                  186   4e-50   
gb|KHN20098.1|  Glutamate receptor 3.3                                  185   5e-50   
ref|XP_007045627.1|  Glutamate receptor isoform 1                       186   7e-50   
gb|KHG01323.1|  Glutamate receptor 3.4 -like protein                    185   9e-50   
ref|XP_002459200.1|  hypothetical protein SORBIDRAFT_02g000440          185   1e-49   
gb|EAZ02098.1|  hypothetical protein OsI_24185                          185   1e-49   
ref|XP_009399221.1|  PREDICTED: glutamate receptor 3.7-like             185   1e-49   
ref|XP_009353274.1|  PREDICTED: glutamate receptor 3.4-like isofo...    185   1e-49   
ref|XP_003620829.1|  Glutamate receptor 3.6                             179   1e-49   
gb|KEH39013.1|  glutamate receptor 3.2                                  183   2e-49   
ref|XP_009353273.1|  PREDICTED: glutamate receptor 3.4-like isofo...    185   2e-49   
ref|XP_006657254.1|  PREDICTED: glutamate receptor 3.5-like             184   2e-49   
gb|KEH39011.1|  glutamate receptor 3.2                                  184   2e-49   
ref|XP_010035563.1|  PREDICTED: glutamate receptor 3.7                  184   2e-49   
ref|XP_003596996.1|  Glutamate receptor 3.4                             184   3e-49   
ref|XP_010267707.1|  PREDICTED: glutamate receptor 3.7-like isofo...    183   3e-49   
gb|KDO41668.1|  hypothetical protein CISIN_1g002267mg                   182   3e-49   
ref|XP_010267706.1|  PREDICTED: glutamate receptor 3.7-like isofo...    183   4e-49   
ref|XP_008644922.1|  PREDICTED: glutamate receptor 3.4-like isofo...    184   4e-49   
ref|NP_001146373.1|  hypothetical protein                               178   4e-49   
ref|XP_010035564.1|  PREDICTED: glutamate receptor 3.4                  184   4e-49   
gb|AFW69063.1|  hypothetical protein ZEAMMB73_044126                    183   4e-49   
ref|XP_007046477.1|  Glutamate receptor isoform 4                       182   4e-49   
gb|EMT00479.1|  Glutamate receptor 3.1                                  185   4e-49   
ref|XP_008644923.1|  PREDICTED: glutamate receptor 3.4-like isofo...    183   4e-49   
gb|EMT10329.1|  Glutamate receptor 3.4                                  182   7e-49   
ref|XP_006447543.1|  hypothetical protein CICLE_v10014175mg             182   8e-49   
gb|KDP25838.1|  hypothetical protein JCGZ_22868                         182   8e-49   
ref|XP_004172056.1|  PREDICTED: glutamate receptor 3.7-like             172   1e-48   
ref|XP_007132553.1|  hypothetical protein PHAVU_011G104300g             182   2e-48   
ref|XP_010321555.1|  PREDICTED: glutamate receptor 3.4-like isofo...    181   2e-48   
ref|XP_009359750.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    175   2e-48   
ref|XP_007217061.1|  hypothetical protein PRUPE_ppa001093mg             181   2e-48   
ref|XP_004240147.1|  PREDICTED: glutamate receptor 3.4-like isofo...    181   2e-48   
gb|KDP25837.1|  hypothetical protein JCGZ_22867                         181   3e-48   
emb|CDX76331.1|  BnaA08g10690D                                          181   3e-48   
ref|XP_006592379.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   3e-48   
ref|XP_010276025.1|  PREDICTED: glutamate receptor 3.7-like isofo...    181   4e-48   
ref|XP_010276019.1|  PREDICTED: glutamate receptor 3.7-like isofo...    181   4e-48   
ref|XP_008377883.1|  PREDICTED: glutamate receptor 3.2-like             181   4e-48   
ref|XP_011005110.1|  PREDICTED: glutamate receptor 3.4 isoform X2       181   4e-48   
ref|XP_006592378.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   4e-48   
ref|XP_011005108.1|  PREDICTED: glutamate receptor 3.4 isoform X1       181   4e-48   
ref|XP_002321123.2|  hypothetical protein POPTR_0014s15030g             181   5e-48   
ref|XP_009341487.1|  PREDICTED: glutamate receptor 3.2-like             180   6e-48   
ref|XP_010557012.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   7e-48   
ref|XP_008341999.1|  PREDICTED: glutamate receptor 3.7-like             179   8e-48   
ref|XP_008447826.1|  PREDICTED: glutamate receptor 3.2                  179   1e-47   
ref|XP_003540841.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   1e-47   
ref|XP_009353277.1|  PREDICTED: glutamate receptor 3.7 isoform X2       179   1e-47   
gb|KHN21237.1|  Glutamate receptor 3.4                                  179   1e-47   
ref|XP_010557011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   1e-47   
ref|XP_009353276.1|  PREDICTED: glutamate receptor 3.7 isoform X1       179   2e-47   
ref|XP_006356918.1|  PREDICTED: glutamate receptor 3.4-like isofo...    179   2e-47   
ref|XP_010109511.1|  Glutamate receptor 3.4                             179   2e-47   
ref|XP_008667840.1|  PREDICTED: hypothetical protein isoform X3         178   2e-47   
ref|XP_009108617.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   2e-47   
ref|XP_009108616.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   2e-47   
ref|XP_008667839.1|  PREDICTED: hypothetical protein isoform X2         178   2e-47   
ref|XP_003563418.1|  PREDICTED: glutamate receptor 3.4                  178   2e-47   
ref|XP_008667836.1|  PREDICTED: hypothetical protein isoform X1         178   3e-47   
ref|XP_008455863.1|  PREDICTED: glutamate receptor 3.7-like             178   3e-47   
ref|XP_009333813.1|  PREDICTED: glutamate receptor 3.2-like             178   3e-47   
ref|XP_009108612.1|  PREDICTED: glutamate receptor 3.2-like isofo...    178   3e-47   
pir||A84550  probable ligand-gated ion channel protein [imported]...    178   3e-47
ref|XP_008379927.1|  PREDICTED: glutamate receptor 3.4-like             178   4e-47   
ref|XP_006582348.1|  PREDICTED: glutamate receptor 3.4-like isofo...    176   7e-47   
ref|XP_007045624.1|  Glutamate receptor isoform 5                       177   1e-46   
ref|XP_007045620.1|  Glutamate receptor isoform 1                       176   1e-46   
ref|XP_003527492.1|  PREDICTED: glutamate receptor 3.4-like isofo...    176   1e-46   
ref|XP_010522331.1|  PREDICTED: glutamate receptor 3.4                  176   2e-46   
ref|XP_010323823.1|  PREDICTED: glutamate receptor 3.7 isoform X2       174   2e-46   
emb|CDP11784.1|  unnamed protein product                                176   2e-46   
gb|EMT02012.1|  Glutamate receptor 3.4                                  174   3e-46   
ref|XP_009765707.1|  PREDICTED: glutamate receptor 3.7 isoform X2       174   3e-46   
dbj|BAL15054.1|  glutamate receptor 3.1                                 174   5e-46   
ref|XP_004144891.1|  PREDICTED: glutamate receptor 3.2-like             174   5e-46   
ref|XP_009765706.1|  PREDICTED: glutamate receptor 3.7 isoform X1       174   6e-46   
gb|KHN41219.1|  Glutamate receptor 3.4                                  175   6e-46   
ref|XP_010484800.1|  PREDICTED: glutamate receptor 3.4 isoform X2       174   6e-46   
ref|XP_010276026.1|  PREDICTED: glutamate receptor 3.7-like isofo...    174   7e-46   
ref|XP_004243469.1|  PREDICTED: glutamate receptor 3.7 isoform X1       174   7e-46   
ref|XP_006367287.1|  PREDICTED: glutamate receptor 3.7-like             174   9e-46   
gb|KDO41665.1|  hypothetical protein CISIN_1g003633mg                   172   1e-45   
ref|XP_010484773.1|  PREDICTED: glutamate receptor 3.4 isoform X1       174   1e-45   



>ref|XP_009796243.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3-like, 
partial [Nicotiana sylvestris]
Length=527

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 190/231 (82%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  LNLPEDY KALK+GP +GGV A+VDERAYMELFLST C+FSI+GQEF 
Sbjct  303  EELGIHESRLVPLNLPEDYAKALKDGPSHGGVAAIVDERAYMELFLSTRCQFSILGQEFT  362

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLA+DMSTAILKLSENGELQRIHDKWL   ACTSQNTKLEVDRL+LKS
Sbjct  363  KNGWGFAFPRDSPLAIDMSTAILKLSENGELQRIHDKWLSGIACTSQNTKLEVDRLQLKS  422

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLALL+YF+++  Q+  Y     ++ SSGGSSRS RLQTFLSF DEKE
Sbjct  423  FSGLFFLCGLACFLALLIYFVMIACQYCHYY---PESESSGGSSRSGRLQTFLSFADEKE  479

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS KR+Q++  S RS+D D S VNGS   I RS+++SNR  S G S
Sbjct  480  ESVRSRS-KRRQLDATSVRSVDQDAS-VNGS--RIDRSEIYSNRVVSFGES  526



>ref|XP_009605827.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605828.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
 ref|XP_009605829.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana tomentosiformis]
Length=936

 Score =   311 bits (797),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 191/231 (83%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  LNLPEDY KALK+GP +GGV A+VDERAYMELFLST C+FSI+GQEF 
Sbjct  712  EELGIHESRLVPLNLPEDYAKALKDGPSHGGVAAIVDERAYMELFLSTRCQFSILGQEFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL   ACTSQNTKLEVDRL+LKS
Sbjct  772  KNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIACTSQNTKLEVDRLQLKS  831

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLALL+YF+++T Q+  Y     ++ SSGGSSRS RLQTFLSF DEKE
Sbjct  832  FSGLFFLCGLACFLALLIYFVMITCQYCHYY---PESESSGGSSRSGRLQTFLSFADEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS KR+Q++  S RS+D D S VNGS   I RS+++SNR  S G S
Sbjct  889  ESVRSRS-KRRQLDATSVRSVDQDAS-VNGS--RIDRSEIYSNRVVSFGES  935



>ref|XP_010316484.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Solanum lycopersicum]
Length=951

 Score =   311 bits (796),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 184/231 (80%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LNLPEDY KALK+GP  GGV AVVDERAYMELFLS+ C+FSI+GQEF 
Sbjct  727  QELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMELFLSSRCQFSILGQEFT  786

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL   ACTSQ+TKLEVDRL+LKS
Sbjct  787  KNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIACTSQSTKLEVDRLQLKS  846

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLALL+YF++L  Q+ +Y  + E    +  SSRS RLQTFLSF DEKE
Sbjct  847  FSGLFFLCGLACFLALLIYFVMLACQYCQYYPNSE---VASESSRSGRLQTFLSFADEKE  903

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS KR+Q+E  S RSID D S VNGS     RS+++SNR  S G S
Sbjct  904  ESVRSRS-KRRQLEVTSVRSIDQDAS-VNGSRTD--RSEIYSNRVVSFGES  950



>ref|XP_010316485.1| PREDICTED: glutamate receptor 3.6 isoform X3 [Solanum lycopersicum]
Length=937

 Score =   310 bits (795),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 184/231 (80%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LNLPEDY KALK+GP  GGV AVVDERAYMELFLS+ C+FSI+GQEF 
Sbjct  713  QELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMELFLSSRCQFSILGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL   ACTSQ+TKLEVDRL+LKS
Sbjct  773  KNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIACTSQSTKLEVDRLQLKS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLALL+YF++L  Q+ +Y  + E    +  SSRS RLQTFLSF DEKE
Sbjct  833  FSGLFFLCGLACFLALLIYFVMLACQYCQYYPNSE---VASESSRSGRLQTFLSFADEKE  889

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS KR+Q+E  S RSID D S VNGS     RS+++SNR  S G S
Sbjct  890  ESVRSRS-KRRQLEVTSVRSIDQDAS-VNGSRTD--RSEIYSNRVVSFGES  936



>ref|XP_004232576.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Solanum lycopersicum]
 dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum]
Length=958

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 184/231 (80%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LNLPEDY KALK+GP  GGV AVVDERAYMELFLS+ C+FSI+GQEF 
Sbjct  734  QELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMELFLSSRCQFSILGQEFT  793

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL   ACTSQ+TKLEVDRL+LKS
Sbjct  794  KNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIACTSQSTKLEVDRLQLKS  853

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLALL+YF++L  Q+ +Y  + E    +  SSRS RLQTFLSF DEKE
Sbjct  854  FSGLFFLCGLACFLALLIYFVMLACQYCQYYPNSE---VASESSRSGRLQTFLSFADEKE  910

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS KR+Q+E  S RSID D S VNGS     RS+++SNR  S G S
Sbjct  911  ESVRSRS-KRRQLEVTSVRSIDQDAS-VNGSRTD--RSEIYSNRVVSFGES  957



>ref|XP_006340926.1| PREDICTED: glutamate receptor 3.6-like [Solanum tuberosum]
Length=976

 Score =   308 bits (789),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 181/231 (78%), Gaps = 7/231 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LNLPEDY KAL +GP  GGV AVVDERAYMELFLSTHC FSI GQEF 
Sbjct  752  QELHIDESRLVPLNLPEDYAKALNDGPSRGGVAAVVDERAYMELFLSTHCHFSIRGQEFT  811

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL   ACTSQNTKLEVDRL+LKS
Sbjct  812  KNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIACTSQNTKLEVDRLKLKS  871

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +ACFLA+L+YF++L  Q+ +Y  + E    +  SSRS RLQTFLSF DEK+
Sbjct  872  FSGLFFLCGLACFLAVLIYFVMLACQYCQYHPNSE---VANESSRSGRLQTFLSFADEKD  928

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGNS  51
            E+ +SRS K++Q+E  S RSID D S VNGS     RS+++SNR    G S
Sbjct  929  ESVRSRS-KQRQLEVTSVRSIDQDAS-VNGSRND--RSEIYSNRVVGFGES  975



>ref|XP_008242064.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=347

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 4/217 (2%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  SRL  L +P+DY KALK+GP+ GGV AV+DERAY+ELFLS+ C+FSIVGQEF K
Sbjct  123  ELNVDESRLVPLIMPDDYAKALKDGPQRGGVAAVIDERAYIELFLSSRCDFSIVGQEFTK  182

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
             GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S+C SQ  KLEVDRL+LKSF
Sbjct  183  TGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSCASQGAKLEVDRLQLKSF  242

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEE  201
             GLF +C  ACFLAL++YFI + RQF+++ ++   + S   SS SARLQTF+SFVDEKEE
Sbjct  243  WGLFVLCGSACFLALIIYFINMLRQFSKHYTEEVISAS---SSTSARLQTFISFVDEKEE  299

Query  200  TAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
              KSRS KR+QME  S RS  +D+S  N   R I +S
Sbjct  300  EVKSRS-KRRQMERMSNRSASEDESMYNSKRRHIDQS  335



>ref|XP_011022205.1| PREDICTED: glutamate receptor 3.6-like isoform X4 [Populus euphratica]
Length=845

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             ELGIH SRL +L +PEDY KALK+GP  GGV AVVDERAY+ELFLS  CEFSIVGQEF 
Sbjct  622  NELGIHKSRLISLKMPEDYTKALKDGPHKGGVAAVVDERAYVELFLSNQCEFSIVGQEFT  681

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWL+RSAC+SQ TK EVDRL+L+S
Sbjct  682  KNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSACSSQGTKFEVDRLDLRS  741

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ IC +AC LAL +YF+ + RQF+R+ S   +  SSG SS SARLQTFLSFVDEKE
Sbjct  742  FWGLYLICGIACLLALFIYFLKMVRQFSRHYS--SELDSSGRSSTSARLQTFLSFVDEKE  799

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               KSRS KR+Q+E  S R+   D+
Sbjct  800  LEVKSRS-KRRQLEMASNRNESMDN  823



>ref|XP_011022202.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022203.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
 ref|XP_011022204.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Populus euphratica]
Length=937

 Score =   294 bits (752),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             ELGIH SRL +L +PEDY KALK+GP  GGV AVVDERAY+ELFLS  CEFSIVGQEF 
Sbjct  714  NELGIHKSRLISLKMPEDYTKALKDGPHKGGVAAVVDERAYVELFLSNQCEFSIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWL+RSAC+SQ TK EVDRL+L+S
Sbjct  774  KNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSACSSQGTKFEVDRLDLRS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ IC +AC LAL +YF+ + RQF+R+ S   +  SSG SS SARLQTFLSFVDEKE
Sbjct  834  FWGLYLICGIACLLALFIYFLKMVRQFSRHYS--SELDSSGRSSTSARLQTFLSFVDEKE  891

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               KSRS KR+Q+E  S R+   D+
Sbjct  892  LEVKSRS-KRRQLEMASNRNESMDN  915



>ref|XP_011022201.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Populus euphratica]
Length=965

 Score =   294 bits (753),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             ELGIH SRL +L +PEDY KALK+GP  GGV AVVDERAY+ELFLS  CEFSIVGQEF 
Sbjct  742  NELGIHKSRLISLKMPEDYTKALKDGPHKGGVAAVVDERAYVELFLSNQCEFSIVGQEFT  801

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWL+RSAC+SQ TK EVDRL+L+S
Sbjct  802  KNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSACSSQGTKFEVDRLDLRS  861

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ IC +AC LAL +YF+ + RQF+R+ S   +  SSG SS SARLQTFLSFVDEKE
Sbjct  862  FWGLYLICGIACLLALFIYFLKMVRQFSRHYS--SELDSSGRSSTSARLQTFLSFVDEKE  919

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               KSRS KR+Q+E  S R+   D+
Sbjct  920  LEVKSRS-KRRQLEMASNRNESMDN  943



>ref|XP_011022199.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Populus euphratica]
Length=967

 Score =   294 bits (752),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 167/205 (81%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             ELGIH SRL +L +PEDY KALK+GP  GGV AVVDERAY+ELFLS  CEFSIVGQEF 
Sbjct  744  NELGIHKSRLISLKMPEDYTKALKDGPHKGGVAAVVDERAYVELFLSNQCEFSIVGQEFT  803

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWL+RSAC+SQ TK EVDRL+L+S
Sbjct  804  KNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSACSSQGTKFEVDRLDLRS  863

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ IC +AC LAL +YF+ + RQF+R+ S   +  SSG SS SARLQTFLSFVDEKE
Sbjct  864  FWGLYLICGIACLLALFIYFLKMVRQFSRHYS--SELDSSGRSSTSARLQTFLSFVDEKE  921

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               KSRS KR+Q+E  S R+   D+
Sbjct  922  LEVKSRS-KRRQLEMASNRNESMDN  945



>gb|KJB17453.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17454.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17455.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
 gb|KJB17457.1| hypothetical protein B456_003G001400 [Gossypium raimondii]
Length=944

 Score =   293 bits (749),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 180/229 (79%), Gaps = 7/229 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            ++L I  SRL ALN PE+  KALK+GP  GGV A+VD+RAY+ELFLST CEFSIVGQEF 
Sbjct  715  DDLKIDASRLVALNSPEECAKALKDGPHKGGVAAMVDDRAYIELFLSTRCEFSIVGQEFT  774

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENG+LQRIHDKWLLR AC+ Q  K+EVDRL+L+S
Sbjct  775  KNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLLRRACSYQGAKMEVDRLQLRS  834

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC +AL +YF+ + RQF+R+ S  E++  SG S+RSAR+QTFLSFVDEKE
Sbjct  835  FWGLFLICGLACLIALFLYFLKMVRQFSRHYS--EESDLSGQSARSARIQTFLSFVDEKE  892

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLG  57
            E  KSRS KR+QME  S RS DD     N +S SI R+  F++   SLG
Sbjct  893  EEVKSRS-KRRQMERTSNRSTDDGS---NSTSYSIRRNSEFASNK-SLG  936



>ref|XP_002306436.1| glutamate receptor family protein [Populus trichocarpa]
 gb|EEE93432.1| glutamate receptor family protein [Populus trichocarpa]
Length=937

 Score =   289 bits (740),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 166/205 (81%), Gaps = 3/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             ELGIH SRL +L +PEDY KALK+GP  GGV AVVDERAY+ELFLS  CEFSIVG+EF 
Sbjct  714  NELGIHKSRLISLKMPEDYAKALKDGPHKGGVAAVVDERAYLELFLSNQCEFSIVGREFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWL+RSAC+SQ  K EVDRL+L+S
Sbjct  774  KNGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIHDKWLMRSACSSQGAKFEVDRLDLRS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ IC +AC LAL +YF+ + RQF+R+ S   +  SSG  S SARLQTFLSFVDEKE
Sbjct  834  FWGLYLICGIACLLALFLYFLKMVRQFSRHYS--SELDSSGRGSTSARLQTFLSFVDEKE  891

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            +  KSRS KR+Q+E  S R+   D+
Sbjct  892  QEVKSRS-KRRQLEMASNRNESMDN  915



>ref|XP_002276999.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
 ref|XP_010652906.1| PREDICTED: glutamate receptor 3.6 [Vitis vinifera]
Length=938

 Score =   288 bits (736),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL IH SRL  LN  EDY KAL++GPK GGV AVVDERAY+ELFLST CEF+IVGQEF 
Sbjct  713  EELNIHKSRLVPLNSAEDYAKALRDGPKKGGVAAVVDERAYIELFLSTRCEFTIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAILKLSE G+LQRIHDKWL  SAC SQ+ KL VDRL+L+S
Sbjct  773  KSGWGFAFPRDSPLAVDMSTAILKLSETGDLQRIHDKWLKGSACRSQDAKLAVDRLQLRS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL++IC +AC +AL +Y IL+ RQF+++    E++ SS  +SRS RLQTFLSFVDEKE
Sbjct  833  FWGLYAICGLACLVALFIYAILMVRQFSKHYI--EESDSSVQNSRSGRLQTFLSFVDEKE  890

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E  KSRS KR+QME  S RS  +D+S  +   R I
Sbjct  891  EDVKSRS-KRRQMEMASTRSTYEDESLSSSKRRHI  924



>emb|CBI21566.3| unnamed protein product [Vitis vinifera]
Length=936

 Score =   288 bits (736),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 170/215 (79%), Gaps = 3/215 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL IH SRL  LN  EDY KAL++GPK GGV AVVDERAY+ELFLST CEF+IVGQEF 
Sbjct  711  EELNIHKSRLVPLNSAEDYAKALRDGPKKGGVAAVVDERAYIELFLSTRCEFTIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAILKLSE G+LQRIHDKWL  SAC SQ+ KL VDRL+L+S
Sbjct  771  KSGWGFAFPRDSPLAVDMSTAILKLSETGDLQRIHDKWLKGSACRSQDAKLAVDRLQLRS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL++IC +AC +AL +Y IL+ RQF+++    E++ SS  +SRS RLQTFLSFVDEKE
Sbjct  831  FWGLYAICGLACLVALFIYAILMVRQFSKHYI--EESDSSVQNSRSGRLQTFLSFVDEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E  KSRS KR+QME  S RS  +D+S  +   R I
Sbjct  889  EDVKSRS-KRRQMEMASTRSTYEDESLSSSKRRHI  922



>gb|KHG10460.1| Glutamate receptor 3.6 -like protein [Gossypium arboreum]
Length=947

 Score =   286 bits (731),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 166/202 (82%), Gaps = 3/202 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL ALN PE+  KALK+GP  GGV A+VD+RAY+ELFLST CEFSIVGQEF 
Sbjct  714  DELKIDASRLVALNSPEECAKALKDGPHKGGVAAMVDDRAYIELFLSTRCEFSIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENG+LQRIHDKWLLR AC+ Q  K+EVDRL+L+S
Sbjct  774  KNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLLRRACSYQGAKMEVDRLQLRS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC +AL +YF+ + RQF+R+ +  E++  SG SSRSAR+QTFLSFVDEKE
Sbjct  834  FWGLFLICGLACLIALFLYFLKMVRQFSRHYA--EESDLSGQSSRSARIQTFLSFVDEKE  891

Query  203  ETAKSRSIKRKQMEGDSARSID  138
            E  KSRS KR+QME  S R+ D
Sbjct  892  EEVKSRS-KRRQMERASNRTDD  912



>gb|KDP43782.1| hypothetical protein JCGZ_22409 [Jatropha curcas]
Length=941

 Score =   285 bits (729),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 163/199 (82%), Gaps = 3/199 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  +RL  L  PE+Y KALK+GP+ GGV A+VDERAY+ELFLST CEFSIVGQEF 
Sbjct  713  EELSIEEARLVPLVTPEEYAKALKDGPQKGGVAAIVDERAYIELFLSTRCEFSIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAF +DSPLAVDMSTAILKLSENG+LQR+HDKWL+RSAC+S  TKLE+DRL+L+S
Sbjct  773  KNGWGFAFARDSPLAVDMSTAILKLSENGDLQRLHDKWLMRSACSSTATKLEIDRLQLRS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LAL +YF+ + RQF+R+ S  E+  SSG SS SARLQTFLSFVDEKE
Sbjct  833  FWGLFMICGLACLLALFLYFLKMLRQFSRFQS--EELASSGRSSTSARLQTFLSFVDEKE  890

Query  203  ETAKSRSIKRKQMEGDSAR  147
            E  K RS KR+ +EG S R
Sbjct  891  EGVKHRS-KRQHLEGISNR  908



>ref|XP_008245275.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=761

 Score =   282 bits (721),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            ++L +  SRL  L +P DY KALK+GP+ GGV AV+DERAY+ELFLS+ C+FSIVGQEF 
Sbjct  547  DKLNVDESRLVPLIMPNDYAKALKDGPQRGGVAAVIDERAYIELFLSSRCDFSIVGQEFT  606

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S+C SQ  KLEVDRL+LKS
Sbjct  607  KTGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSCASQGAKLEVDRLQLKS  666

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C  ACFLAL++YFI + RQF+++ +   +   S GSS SARLQTF+SFVDEKE
Sbjct  667  FWGLFVLCGSACFLALIIYFINMLRQFSKHYT---EEVISAGSSTSARLQTFISFVDEKE  723

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            E  K+RS KR+QME  S RS  +D+S  N   R I +S
Sbjct  724  EEVKNRS-KRRQMERMSNRSASEDESMYNSKRRHIDQS  760



>ref|XP_010029575.1| PREDICTED: glutamate receptor 3.6 [Eucalyptus grandis]
 gb|KCW56489.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=942

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L +PEDY KAL++GP  GGV AV+DERAY+ELFLST CEFSIVGQEF 
Sbjct  718  EELGIHESRLVPLIMPEDYAKALRDGPSKGGVAAVIDERAYIELFLSTRCEFSIVGQEFT  777

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENG+LQRIHDKWL+RSACTSQ TKL +DRL LKS
Sbjct  778  KNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSACTSQGTKLALDRLHLKS  837

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C  ACFLAL++YF+ + RQF R+ S+  ++ +S  SSR +RL+TFLSF+DEKE
Sbjct  838  FWGLFVLCGSACFLALIIYFLRMVRQFGRHYSEEPESSTS--SSRMSRLRTFLSFIDEKE  895

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  KSRS KR+QME  S RS D++ S VNG+ +
Sbjct  896  EVVKSRS-KRRQMEEASNRSNDEEGS-VNGTKK  926



>gb|KCW56490.1| hypothetical protein EUGRSUZ_I02216 [Eucalyptus grandis]
Length=944

 Score =   284 bits (727),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/213 (70%), Positives = 176/213 (83%), Gaps = 4/213 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L +PEDY KAL++GP  GGV AV+DERAY+ELFLST CEFSIVGQEF 
Sbjct  720  EELGIHESRLVPLIMPEDYAKALRDGPSKGGVAAVIDERAYIELFLSTRCEFSIVGQEFT  779

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAILKLSENG+LQRIHDKWL+RSACTSQ TKL +DRL LKS
Sbjct  780  KNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSACTSQGTKLALDRLHLKS  839

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C  ACFLAL++YF+ + RQF R+ S+  ++ +S  SSR +RL+TFLSF+DEKE
Sbjct  840  FWGLFVLCGSACFLALIIYFLRMVRQFGRHYSEEPESSTS--SSRMSRLRTFLSFIDEKE  897

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  KSRS KR+QME  S RS D++ S VNG+ +
Sbjct  898  EVVKSRS-KRRQMEEASNRSNDEEGS-VNGTKK  928



>ref|XP_008241921.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Prunus mume]
Length=937

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 4/217 (2%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  SRL  L +P+DY KALK+GP+ GGV AV+DERAY+ELFLS+ C+FSIVGQEF K
Sbjct  713  ELNVDESRLIPLIMPDDYAKALKDGPQRGGVAAVIDERAYIELFLSSRCDFSIVGQEFTK  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
             GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S+C SQ  KL+VDRL+LKSF
Sbjct  773  TGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSCASQGAKLQVDRLQLKSF  832

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEE  201
             GLF +C  ACFLAL++YFI + RQF+++ +   +   S GSS SARLQTF+SFVDEKEE
Sbjct  833  WGLFVLCGSACFLALIIYFINMLRQFSKHYT---EEVISAGSSMSARLQTFISFVDEKEE  889

Query  200  TAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
              KSRS KR+QME  S RS  +D+S  N   R I +S
Sbjct  890  EVKSRS-KRRQMERMSNRSASEDESMYNSKRRHIDQS  925



>ref|XP_008241916.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241917.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
 ref|XP_008241918.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Prunus mume]
Length=937

 Score =   283 bits (725),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 4/217 (2%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  SRL  L +P+DY KALK+GP+ GGV AV+DERAY+ELFLS+ C+FSIVGQEF K
Sbjct  713  ELNVDESRLIPLIMPDDYAKALKDGPQRGGVAAVIDERAYIELFLSSRCDFSIVGQEFTK  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
             GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S+C SQ  KL+VDRL+LKSF
Sbjct  773  TGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSCASQGAKLQVDRLQLKSF  832

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEE  201
             GLF +C  ACFLAL++YFI + RQF+++ +   +   S GSS SARLQTF+SFVDEKEE
Sbjct  833  WGLFVLCGSACFLALIIYFINMLRQFSKHYT---EEVISAGSSMSARLQTFISFVDEKEE  889

Query  200  TAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
              KSRS KR+QME  S RS  +D+S  N   R I +S
Sbjct  890  EVKSRS-KRRQMERMSNRSASEDESMYNSKRRHIDQS  925



>ref|XP_008440927.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Cucumis melo]
Length=900

 Score =   281 bits (719),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 5/217 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L   E YVKAL +GP N GV A+VDERAY+ELFLST CE+SIVGQEF 
Sbjct  679  EELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVELFLSTRCEYSIVGQEFT  738

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAIL+LSENG+LQRIHDKWL++SACTSQ +K+EVDRL+L S
Sbjct  739  KNGWGFAFPRDSPLAVDMSTAILRLSENGDLQRIHDKWLMKSACTSQASKIEVDRLQLNS  798

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +Y   + RQ++ + +  E+  SS  +SRSA LQ FLSF DEKE
Sbjct  799  FWGLFLICGCACLLALSIYLYQMVRQYSEHYA--EELGSSEQTSRSASLQRFLSFADEKE  856

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGR  93
            E  KS+S KR++M+ DS RS+++++S   GS R +G 
Sbjct  857  EVFKSQS-KRRRMQEDSIRSVNEENS--TGSVRKVGH  890



>emb|CDP01776.1| unnamed protein product [Coffea canephora]
Length=940

 Score =   281 bits (720),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 195/230 (85%), Gaps = 4/230 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GIH SRL  LN+PEDYVKALK+GP+NGGV AV+DERAY+ELFLST CEFSIVGQEF 
Sbjct  713  EEVGIHESRLVPLNMPEDYVKALKDGPRNGGVAAVIDERAYIELFLSTQCEFSIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLA+DMSTAILKLSE+GELQ+IHDKWL RSAC+SQ+TKL VDRL+L S
Sbjct  773  KNGWGFAFPRDSPLALDMSTAILKLSESGELQQIHDKWLQRSACSSQSTKLVVDRLQLGS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C +AC LALLVYFIL+ RQF RY S+  ++ SSG SSRSAR+QTFLSFVDEKE
Sbjct  833  FSGLFFVCGLACLLALLVYFILIVRQFLRYHSE-PESESSGQSSRSARIQTFLSFVDEKE  891

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNRA*SLGN  54
            ++ ++RS KR+ +EG S  S + +++  NGSS+   R+++ SNR+ S G+
Sbjct  892  KSVRARS-KRRHLEGGSDLS-NYENTAENGSSKRY-RTEMLSNRSVSFGD  938



>ref|XP_008440920.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440921.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440922.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440924.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440925.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
 ref|XP_008440926.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Cucumis melo]
Length=938

 Score =   281 bits (719),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 5/217 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L   E YVKAL +GP N GV A+VDERAY+ELFLST CE+SIVGQEF 
Sbjct  717  EELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVELFLSTRCEYSIVGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAIL+LSENG+LQRIHDKWL++SACTSQ +K+EVDRL+L S
Sbjct  777  KNGWGFAFPRDSPLAVDMSTAILRLSENGDLQRIHDKWLMKSACTSQASKIEVDRLQLNS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +Y   + RQ++ + +  E+  SS  +SRSA LQ FLSF DEKE
Sbjct  837  FWGLFLICGCACLLALSIYLYQMVRQYSEHYA--EELGSSEQTSRSASLQRFLSFADEKE  894

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGR  93
            E  KS+S KR++M+ DS RS+++++S   GS R +G 
Sbjct  895  EVFKSQS-KRRRMQEDSIRSVNEENS--TGSVRKVGH  928



>ref|XP_007203996.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
 gb|EMJ05195.1| hypothetical protein PRUPE_ppa000995mg [Prunus persica]
Length=937

 Score =   280 bits (717),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 169/217 (78%), Gaps = 4/217 (2%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  SRL  L +P+DY KALK+GP+ GGV AV+DERAY+ELFLS+ C+FSIVGQEF K
Sbjct  713  ELNVDESRLVPLIMPDDYAKALKDGPQRGGVAAVIDERAYIELFLSSRCDFSIVGQEFTK  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
             GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S+C SQ  KL+VDRL+LKSF
Sbjct  773  TGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSSCASQGAKLQVDRLQLKSF  832

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEE  201
             GLF +C  ACFLAL++YFI + RQF+++ +   +   S GSS SARLQTF+SFVDEKEE
Sbjct  833  WGLFVLCGSACFLALIIYFINMLRQFSKHYT---EEVISAGSSTSARLQTFISFVDEKEE  889

Query  200  TAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
              KSRS KR+QME  S RS  +D+S      R I +S
Sbjct  890  EVKSRS-KRRQMERMSNRSASEDESMYYSKRRHIDQS  925



>gb|ABO28526.1| glutamate receptor [Malus hupehensis]
Length=946

 Score =   279 bits (714),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 166/215 (77%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +PEDY KALK GP  GGV AV+DERAY+ELFLS+ C+FS+VGQEF 
Sbjct  721  DELNVDESRLVPLIMPEDYAKALKAGPHKGGVAAVIDERAYIELFLSSRCDFSVVGQEFT  780

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA+LKLSENG+LQRIHDKWL+R+ C SQ  KL+VDRL+L+S
Sbjct  781  KTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPCASQGAKLQVDRLQLRS  840

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACFLAL +YF ++  QF++++++   T    GSSRS R+QTFL+FVDEKE
Sbjct  841  FWGLFVICGAACFLALAIYFCMMLHQFSKHNTEELVTT---GSSRSTRVQTFLTFVDEKE  897

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E  KSRS KR+QME  S RS  +D+S  N   R +
Sbjct  898  EEVKSRS-KRRQMERTSNRSASEDESMYNSKRRHL  931



>ref|XP_009359614.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359616.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359617.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
 ref|XP_009359618.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Pyrus x bretschneideri]
Length=937

 Score =   278 bits (712),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +P+DY KALK GP  GGV AV+DERAY+E+FLS+ C+FS+VGQEF 
Sbjct  721  DELNVDESRLVPLIMPDDYAKALKAGPHKGGVAAVIDERAYIEVFLSSRCDFSVVGQEFT  780

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA+LKLSENG+LQRIHDKWL+R+ C SQ  KL+VDRL+LKS
Sbjct  781  KTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPCASQGAKLQVDRLQLKS  840

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACFLAL +YF ++  QF++++++      S GSSRS R+QTFL+FVDEKE
Sbjct  841  FWGLFVICGAACFLALAIYFCMMLHQFSKHNTEEL---VSTGSSRSTRVQTFLTFVDEKE  897

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            E  KSRS KR+QME  S RS  +D+S  N   R + +S
Sbjct  898  EEVKSRS-KRRQMERTSNRSASEDESMYNSKRRHLDQS  934



>ref|XP_009359613.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Pyrus x bretschneideri]
Length=942

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +P+DY KALK GP  GGV AV+DERAY+E+FLS+ C+FS+VGQEF 
Sbjct  726  DELNVDESRLVPLIMPDDYAKALKAGPHKGGVAAVIDERAYIEVFLSSRCDFSVVGQEFT  785

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA+LKLSENG+LQRIHDKWL+R+ C SQ  KL+VDRL+LKS
Sbjct  786  KTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPCASQGAKLQVDRLQLKS  845

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACFLAL +YF ++  QF++++++      S GSSRS R+QTFL+FVDEKE
Sbjct  846  FWGLFVICGAACFLALAIYFCMMLHQFSKHNTEEL---VSTGSSRSTRVQTFLTFVDEKE  902

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            E  KSRS KR+QME  S RS  +D+S  N   R + +S
Sbjct  903  EEVKSRS-KRRQMERTSNRSASEDESMYNSKRRHLDQS  939



>ref|XP_007203104.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
 gb|EMJ04303.1| hypothetical protein PRUPE_ppa023817mg [Prunus persica]
Length=937

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 169/217 (78%), Gaps = 4/217 (2%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  SRL  L +P+DY KALK+GP+ GGV AV+DER Y+ELFLS+ C+FSIVGQEF K
Sbjct  713  ELNVDESRLVPLIMPDDYAKALKDGPQRGGVAAVIDERTYIELFLSSRCDFSIVGQEFTK  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
             GWGFAF +DSPL+VDMSTAILKLS+NG+L+RIHDKWL+ S+C SQ  KL+VDRL+LKSF
Sbjct  773  TGWGFAFARDSPLSVDMSTAILKLSDNGDLRRIHDKWLISSSCASQGAKLQVDRLQLKSF  832

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEE  201
             GLF +C  ACFLAL++YFI + RQF+++ +   +   S GSS SARLQTF+SFVDEKEE
Sbjct  833  WGLFVLCGSACFLALIIYFINMLRQFSKHYT---EEVISAGSSTSARLQTFISFVDEKEE  889

Query  200  TAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
              KSRS KR+QME  S RS  +D+S  N   R I +S
Sbjct  890  EVKSRS-KRRQMERISNRSASEDESMYNSKRRHIDQS  925



>ref|XP_009359612.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Pyrus x bretschneideri]
Length=946

 Score =   278 bits (712),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 168/218 (77%), Gaps = 4/218 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +P+DY KALK GP  GGV AV+DERAY+E+FLS+ C+FS+VGQEF 
Sbjct  730  DELNVDESRLVPLIMPDDYAKALKAGPHKGGVAAVIDERAYIEVFLSSRCDFSVVGQEFT  789

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA+LKLSENG+LQRIHDKWL+R+ C SQ  KL+VDRL+LKS
Sbjct  790  KTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPCASQGAKLQVDRLQLKS  849

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACFLAL +YF ++  QF++++++      S GSSRS R+QTFL+FVDEKE
Sbjct  850  FWGLFVICGAACFLALAIYFCMMLHQFSKHNTEEL---VSTGSSRSTRVQTFLTFVDEKE  906

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            E  KSRS KR+QME  S RS  +D+S  N   R + +S
Sbjct  907  EEVKSRS-KRRQMERTSNRSASEDESMYNSKRRHLDQS  943



>ref|XP_008337897.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
 ref|XP_008337898.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=946

 Score =   278 bits (711),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 165/215 (77%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +P+DY KALK GP  GGV AV+DERAY+ELFLS+ C+FS+VGQEF 
Sbjct  721  DELNVDXSRLVPLIMPDDYAKALKAGPHKGGVAAVIDERAYIELFLSSRCDFSVVGQEFT  780

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA+LKLSENG+LQRIHDKWL+R+ C SQ  KL+VDRL+LKS
Sbjct  781  KTGWGFAFARDSPLAVDLSTALLKLSENGDLQRIHDKWLMRTPCASQGAKLQVDRLQLKS  840

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACFLAL +YF ++  QF+++++    T    GSSRS R+QTFL+FVDEKE
Sbjct  841  FWGLFVICGXACFLALAIYFCMMLHQFSKHNTXELXTT---GSSRSTRVQTFLTFVDEKE  897

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E  KSRS KR+QME  S RS  +D+S  N   R +
Sbjct  898  EEVKSRS-KRRQMERTSNRSASEDESMYNSKRRHL  931



>ref|XP_007046473.1| Glutamate receptor 3.6 [Theobroma cacao]
 gb|EOX90630.1| Glutamate receptor 3.6 [Theobroma cacao]
Length=939

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 163/202 (81%), Gaps = 6/202 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN PE+  KAL++GP  GGV A+VD+RAY+ELFLST CEFSIVGQEF 
Sbjct  714  DELKIDESRLVPLNSPEESAKALEDGPHKGGVAAMVDDRAYIELFLSTRCEFSIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLA+DMSTAIL+LSENG+LQRIHDKWLLR AC+ Q  K+EVD L+LKS
Sbjct  774  KNGWGFAFPRDSPLAMDMSTAILRLSENGDLQRIHDKWLLRRACSYQGAKMEVDELQLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+ALL+YF+ + RQF+R++S+  +      S RSAR+QTFLSFVDEKE
Sbjct  834  FWGLFLICGLACFIALLIYFLKMVRQFSRHNSEELEL-----SGRSARVQTFLSFVDEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSID  138
            E  KSRS KR+QME  S RS D
Sbjct  889  EEVKSRS-KRRQMERASIRSED  909



>ref|XP_007203235.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
 gb|EMJ04434.1| hypothetical protein PRUPE_ppa001033mg [Prunus persica]
Length=927

 Score =   277 bits (708),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 136/218 (62%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L +P+DY KAL++GP+ GGV AV+DER Y+ELFLS+ C+FSIVGQEF 
Sbjct  713  DELNVDESRLVPLIMPDDYAKALRDGPQRGGVAAVIDERPYIELFLSSRCDFSIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAF +DSPL+VDMSTAILKLSENG+LQRIHDKWL+ S C SQ  KL+VDRL+LKS
Sbjct  773  KSGWGFAFARDSPLSVDMSTAILKLSENGDLQRIHDKWLISSGCASQGAKLQVDRLQLKS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C  ACFLAL+++FI + RQF+++ +   +   S GSS SARLQTF+SFVDEKE
Sbjct  833  FWGLFVLCGSACFLALIIFFINMLRQFSKHYT---EEVISAGSSTSARLQTFISFVDEKE  889

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            E  KSRS KR++ME  S RS  +D+S  N   R I +S
Sbjct  890  EEVKSRS-KRRKMERMSNRSASEDESMYNSKRRHIDQS  926



>gb|KGN48998.1| hypothetical protein Csa_6G509670 [Cucumis sativus]
Length=890

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 5/217 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L   E YVKAL +GP N GV A+VDERAY+ELFLST CE+SIVGQEF 
Sbjct  671  EELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVELFLSTRCEYSIVGQEFT  730

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKWL++SACTSQ +K+EVDRL+L S
Sbjct  731  KNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSACTSQASKIEVDRLQLNS  790

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VAC LAL +Y   + RQ++ + +  E+  SS   SRSA L  FLSF DEKE
Sbjct  791  FWGLFLICGVACVLALSIYLFQMVRQYSEHYT--EELGSSEQPSRSASLHRFLSFADEKE  848

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGR  93
            E  KS+S KR++M+  S RS+++++S   GSSR  G 
Sbjct  849  EVFKSQS-KRRRMQEASVRSVNEENS--TGSSRKNGH  882



>ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=932

 Score =   275 bits (703),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 167/217 (77%), Gaps = 5/217 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L   E YVKAL +GP N GV A+VDERAY+ELFLST CE+SIVGQEF 
Sbjct  713  EELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVELFLSTRCEYSIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKWL++SACTSQ +K+EVDRL+L S
Sbjct  773  KNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSACTSQASKIEVDRLQLNS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VAC LAL +Y   + RQ++ + +  E+  SS   SRSA L  FLSF DEKE
Sbjct  833  FWGLFLICGVACVLALSIYLFQMVRQYSEHYT--EELGSSEQPSRSASLHRFLSFADEKE  890

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGR  93
            E  KS+S KR++M+  S RS+++++S   GSSR  G 
Sbjct  891  EVFKSQS-KRRRMQEASVRSVNEENS--TGSSRKNGH  924



>ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=943

 Score =   275 bits (702),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 167/216 (77%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGIH SRL  L   E YVKAL +GP N GV A+VDERAY+ELFLST CE+SIVGQEF 
Sbjct  713  EELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVELFLSTRCEYSIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKWL++SACTSQ +K+EVDRL+L S
Sbjct  773  KNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSACTSQASKIEVDRLQLNS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VAC LAL +Y   + RQ++ + +  E+  SS   SRSA L  FLSF DEKE
Sbjct  833  FWGLFLICGVACVLALSIYLFQMVRQYSEHYT--EELGSSEQPSRSASLHRFLSFADEKE  890

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            E  KS+S KR++M+  S RS+++++S   GSSR + 
Sbjct  891  EVFKSQS-KRRRMQEASVRSVNEENS--TGSSRKMA  923



>ref|XP_008337223.1| PREDICTED: glutamate receptor 3.3-like [Malus domestica]
Length=634

 Score =   266 bits (680),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 161/204 (79%), Gaps = 4/204 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L  PEDY KALK+GP  GGV AV+DERA++ELFL++ CEFS+VGQEF 
Sbjct  410  DELNVDESRLVPLITPEDYAKALKDGPHKGGVTAVIDERAFIELFLASRCEFSVVGQEFT  469

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA LKLSENG+LQRI+DKWL+R+ C S   KL+VDRL+LKS
Sbjct  470  KTGWGFAFARDSPLAVDLSTAJLKLSENGDLQRIYDKWLMRTPCASNGGKLQVDRLQLKS  529

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +YF ++ RQF+R+    E+  S+GGS+ SAR+QTFL+FVDEKE
Sbjct  530  FXGLFIICGAACXLALAIYFCIMLRQFSRHYX--EELVSTGGST-SARVQTFLTFVDEKE  586

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            E  KSRS KR++ME  S RS DD+
Sbjct  587  EEVKSRS-KRRRMERLSNRSADDE  609



>ref|XP_009369789.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369790.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369791.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
 ref|XP_009369792.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=943

 Score =   271 bits (694),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 165/204 (81%), Gaps = 4/204 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L  P+DY KALK+GP  GGV AV+DERA++ELFLS+ CEFS+VGQEF 
Sbjct  719  DELNVDESRLVPLITPDDYAKALKDGPHRGGVTAVIDERAFIELFLSSRCEFSVVGQEFT  778

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLAVD+STA+LKLSENG+LQRI+DKWL+R+ C S   KL+VDRL+LKS
Sbjct  779  KTGWGFAFPRDSPLAVDLSTALLKLSENGDLQRIYDKWLMRTPCASNGGKLQVDRLQLKS  838

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VACFLAL +YF ++ RQF+++ +  E+  S+ GSS SAR+QTFL+FVDEKE
Sbjct  839  FGGLFIICGVACFLALAIYFCIMLRQFSKHYT--EELIST-GSSTSARVQTFLTFVDEKE  895

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            E  KSRS KR++ME  S RS +D+
Sbjct  896  EEVKSRS-KRRRMERLSNRSAEDE  918



>ref|XP_003608144.1| Glutamate receptor 3.3 [Medicago truncatula]
Length=473

 Score =   261 bits (668),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 4/224 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GIH SRL  +  PE+ +KAL+ G +NGG+ A VDERAY+ELFLS+ C+FSIVGQEF 
Sbjct  247  DEIGIHESRLVPMKTPEETMKALEKGHQNGGIAAYVDERAYIELFLSSRCDFSIVGQEFT  306

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP DSPLAVD+STAIL+L+E+G+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  307  RNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSACRSQGAKLEVDRLNLRS  366

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +ACFLALL+YFI   RQ+ ++S  P++  SSG  S S+RL+TFLSFVDEKE
Sbjct  367  FWGLYLVCGLACFLALLIYFIQTLRQYKKHS--PDEIDSSGQGSGSSRLRTFLSFVDEKE  424

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNR  72
               K+RS KR+QME  S RS  +  S +  S++   RS    NR
Sbjct  425  AIVKNRS-KRRQMERISYRSTSEVGSNIT-SNKDFSRSSTSLNR  466



>ref|XP_006425261.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
 gb|ESR38501.1| hypothetical protein CICLE_v10024825mg [Citrus clementina]
Length=926

 Score =   270 bits (691),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN  E+Y KAL +GPKNGGV AV+DERAYME+FLST CEFSI+GQEF 
Sbjct  692  DELNIDKSRLVPLNTAEEYEKALTDGPKNGGVSAVIDERAYMEVFLSTRCEFSIIGQEFT  751

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            + GWGFAFP+DSPLAVDMS AIL+LSENG+LQRIHDKWL RSAC+SQ  K E DRL LKS
Sbjct  752  RIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSACSSQGAKQEADRLHLKS  811

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LALL+Y I + RQF R+  D ++  S+G SS+S+RLQTF+SF  EKE
Sbjct  812  FWGLFVLCGVACLLALLIYLIQIVRQFARHYLDLQELESAGPSSQSSRLQTFISFAGEKE  871

Query  203  ETAKSRSIKRKQMEGDSARSIDDD---DSYVNGS  111
               K+ S KRK +E  S   ID D   D  +NGS
Sbjct  872  VVIKNLSKKRK-LERASTGDIDKDKSTDGDLNGS  904



>ref|XP_006467098.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Citrus sinensis]
Length=909

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN  E+Y KAL +GPKNGGV AV+DERAYME+FLST CEFSI+GQEF 
Sbjct  675  DELNIDKSRLVPLNTAEEYEKALTDGPKNGGVSAVIDERAYMEVFLSTRCEFSIIGQEFT  734

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            + GWGFAFP+DSPLAVDMS AIL+LSENG+LQRIHDKWL RSAC+SQ  K E D+L LKS
Sbjct  735  RIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSACSSQGAKQEADQLHLKS  794

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LALL+Y I + RQF R+  D ++  S+G SS+S+RLQTF+SF  EKE
Sbjct  795  FWGLFVLCGVACLLALLIYLIQIVRQFARHYLDLQELESAGPSSQSSRLQTFISFAGEKE  854

Query  203  ETAKSRSIKRKQMEGDSARSIDDD---DSYVNGS  111
               K+ S KRK +E  S   ID D   D  +NGS
Sbjct  855  VVIKNLSKKRK-LERASTGDIDKDKSTDGDLNGS  887



>ref|XP_006467097.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
Length=948

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN  E+Y KAL +GPKNGGV AV+DERAYME+FLST CEFSI+GQEF 
Sbjct  714  DELNIDKSRLVPLNTAEEYEKALTDGPKNGGVSAVIDERAYMEVFLSTRCEFSIIGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            + GWGFAFP+DSPLAVDMS AIL+LSENG+LQRIHDKWL RSAC+SQ  K E D+L LKS
Sbjct  774  RIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSACSSQGAKQEADQLHLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LALL+Y I + RQF R+  D ++  S+G SS+S+RLQTF+SF  EKE
Sbjct  834  FWGLFVLCGVACLLALLIYLIQIVRQFARHYLDLQELESAGPSSQSSRLQTFISFAGEKE  893

Query  203  ETAKSRSIKRKQMEGDSARSIDDD---DSYVNGS  111
               K+ S KRK +E  S   ID D   D  +NGS
Sbjct  894  VVIKNLSKKRK-LERASTGDIDKDKSTDGDLNGS  926



>gb|KHN38860.1| Glutamate receptor 3.6 [Glycine soja]
Length=938

 Score =   265 bits (678),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL  L  PE+  +ALK GP+ GGV A VDERAY+ELFLS+ C++SIVGQEF 
Sbjct  714  EEIGIDESRLVPLKTPEETTEALKKGPQKGGVAAYVDERAYIELFLSSRCDYSIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  774  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLRS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+YFI   RQ++++   PE+  SSG  S S+RL+TFL+FVDEKE
Sbjct  834  FWGLYLVCGLACVLALLIYFIQTMRQYSKHG--PEELESSGHGSGSSRLRTFLTFVDEKE  891

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVN  117
            E  KSRS KRK+MEG S RS  +  S + 
Sbjct  892  EIVKSRS-KRKKMEGISYRSTSEVGSSIT  919



>ref|XP_008337216.1| PREDICTED: glutamate receptor 3.3-like [Malus domestica]
Length=406

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 155/204 (76%), Gaps = 4/204 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L  P DY KALK+GP  GGV AV+DERA +ELFL++ CEFS+VGQEF 
Sbjct  182  DELNVDESRLVPLITPXDYAKALKDGPHKGGVXAVIDERAXIELFLASRCEFSVVGQEFT  241

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA LKLSENG+LQRI+DKWL R+ C S    L+VDRL  KS
Sbjct  242  KTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPCASNGGXLQVDRLXXKS  301

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +YF ++ RQF+R+ +  E+  S+G S+ SAR+QTFL+FVDEKE
Sbjct  302  FRGLFIICGAACXLALAIYFCIMLRQFSRHYT--EELVSTGXST-SARVQTFLTFVDEKE  358

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            E  KSRS KR++ME  S RS DD+
Sbjct  359  EEVKSRS-KRRRMERLSNRSADDE  381



>ref|XP_007158022.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30016.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=846

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 170/229 (74%), Gaps = 11/229 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+ I  SRL  L  PED  +AL+NGPKNGGV A +DERAY ++FLS+ C+F++VGQEF 
Sbjct  621  QEIHIEESRLVPLTTPEDIARALRNGPKNGGVAAYIDERAYTDIFLSSRCDFTVVGQEFT  680

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVDMSTAIL++ ++G+LQRIHDKWLL SAC SQ  KLEV+RL+LKS
Sbjct  681  RNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKLEVERLQLKS  740

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            F GL++IC +AC LAL +Y I + +Q+ + YS +PE       GSSRS+RL+TFLSF DE
Sbjct  741  FWGLYAICGLACLLALFMYLIQILKQYHKHYSKEPESPDGQNVGSSRSSRLKTFLSFADE  800

Query  209  KEETAKSRSIKRKQMEGDSAR------SIDDDDSYVNGSSRSIGRSQVF  81
            +EET KSRS KR++ME  S R      SID +  Y   S RS   S+V 
Sbjct  801  REETVKSRS-KRRKMERISYRTTEGSSSIDSNKGY--ASRRSEYASEVL  846



>ref|XP_003629105.1| Glutamate receptor 3.6 [Medicago truncatula]
Length=739

 Score =   262 bits (669),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 4/224 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GIH SRL  +  PE+ +KAL+ G +NGG+ A VDERAY+ELFLS+ C+FSIVGQEF 
Sbjct  513  DEIGIHESRLVPMKTPEETMKALEKGHQNGGIAAYVDERAYIELFLSSRCDFSIVGQEFT  572

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP DSPLAVD+STAIL+L+E+G+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  573  RNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSACRSQGAKLEVDRLNLRS  632

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +ACFLALL+YFI   RQ+ ++S  P++  SSG  S S+RL+TFLSFVDEKE
Sbjct  633  FWGLYLVCGLACFLALLIYFIQTLRQYKKHS--PDEIDSSGQGSGSSRLRTFLSFVDEKE  690

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNR  72
               K+RS KR+QME  S RS  +  S +  S++   RS    NR
Sbjct  691  AIVKNRS-KRRQMERISYRSTSEVGSNIT-SNKDFSRSSTSLNR  732



>ref|XP_008344238.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=406

 Score =   253 bits (647),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 154/204 (75%), Gaps = 4/204 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L  P DY KALK+GP  GGV AV+DERA +ELFL++ CEFS+VGQEF 
Sbjct  182  DELNVDESRLVPLITPXDYAKALKDGPHKGGVXAVIDERAXIELFLASRCEFSVVGQEFT  241

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA LKLSENG+LQRI+DKWL R+ C S    L+VDRL  KS
Sbjct  242  KTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPCASNGGXLQVDRLXXKS  301

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +YF ++ RQF+R+    E+  S+G S+ SAR+QTFL+FVDEKE
Sbjct  302  FXGLFIICGAACXLALAIYFCIMLRQFSRHYX--EELVSTGXST-SARVQTFLTFVDEKE  358

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            E  KSRS KR++ME  S RS DD+
Sbjct  359  EEVKSRS-KRRRMERLSNRSADDE  381



>ref|XP_006587552.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=845

 Score =   263 bits (673),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L  PE+  +ALK GP+ GGV A VDERAY+ELFLS+ C++SIVGQEF 
Sbjct  621  DEIGIDESRLVPLKTPEETTEALKKGPQKGGVAAYVDERAYIELFLSSRCDYSIVGQEFT  680

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  681  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLRS  740

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+YFI   RQ++++   PE+  SSG  S S+RL+TFL+FVDEKE
Sbjct  741  FWGLYLVCGLACVLALLIYFIQTMRQYSKHG--PEELESSGHGSGSSRLRTFLTFVDEKE  798

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVN  117
            E  KSRS KRK+MEG S RS  +  S + 
Sbjct  799  EIVKSRS-KRKKMEGISYRSTSEVGSSIT  826



>ref|XP_003533407.2| PREDICTED: glutamate receptor 3.6-like isoform X1 [Glycine max]
Length=947

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L  PE+  +ALK GP+ GGV A VDERAY+ELFLS+ C++SIVGQEF 
Sbjct  723  DEIGIDESRLVPLKTPEETTEALKKGPQKGGVAAYVDERAYIELFLSSRCDYSIVGQEFT  782

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  783  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLRS  842

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+YFI   RQ++++   PE+  SSG  S S+RL+TFL+FVDEKE
Sbjct  843  FWGLYLVCGLACVLALLIYFIQTMRQYSKHG--PEELESSGHGSGSSRLRTFLTFVDEKE  900

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVN  117
            E  KSRS KRK+MEG S RS  +  S + 
Sbjct  901  EIVKSRS-KRKKMEGISYRSTSEVGSSIT  928



>ref|XP_007158020.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30014.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=939

 Score =   264 bits (674),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 170/229 (74%), Gaps = 11/229 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+ I  SRL  L  PED  +AL+NGPKNGGV A +DERAY ++FLS+ C+F++VGQEF 
Sbjct  714  QEIHIEESRLVPLTTPEDIARALRNGPKNGGVAAYIDERAYTDIFLSSRCDFTVVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVDMSTAIL++ ++G+LQRIHDKWLL SAC SQ  KLEV+RL+LKS
Sbjct  774  RNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKLEVERLQLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            F GL++IC +AC LAL +Y I + +Q+ + YS +PE       GSSRS+RL+TFLSF DE
Sbjct  834  FWGLYAICGLACLLALFMYLIQILKQYHKHYSKEPESPDGQNVGSSRSSRLKTFLSFADE  893

Query  209  KEETAKSRSIKRKQMEGDSAR------SIDDDDSYVNGSSRSIGRSQVF  81
            +EET KSRS KR++ME  S R      SID +  Y   S RS   S+V 
Sbjct  894  REETVKSRS-KRRKMERISYRTTEGSSSIDSNKGY--ASRRSEYASEVL  939



>gb|KDO71524.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=848

 Score =   263 bits (671),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 171/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN PE+Y KALK+GP  GGV AVVD+RAY ELFLST CEFSIVGQ F 
Sbjct  619  DELNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQVFT  678

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWLLRSAC+SQ  KL+VDRL+LKS
Sbjct  679  KNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHDKWLLRSACSSQGAKLDVDRLQLKS  738

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GL+ +C +AC LAL +Y + +  QF+R+   P  T S+GGSSRSARLQTFLSFV+EKE
Sbjct  739  FSGLYLLCGLACLLALFIYLMQIVHQFSRHY--PGDTESNGGSSRSARLQTFLSFVNEKE  796

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            +  KSRS KR+ +E  S RS +D+ S  N + + I
Sbjct  797  DEVKSRS-KRRHVERTSYRS-EDEMSSCNSNRKHI  829



>ref|XP_007158021.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
 gb|ESW30015.1| hypothetical protein PHAVU_002G117500g [Phaseolus vulgaris]
Length=948

 Score =   264 bits (674),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 164/215 (76%), Gaps = 9/215 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+ I  SRL  L  PED  +AL+NGPKNGGV A +DERAY ++FLS+ C+F++VGQEF 
Sbjct  723  QEIHIEESRLVPLTTPEDIARALRNGPKNGGVAAYIDERAYTDIFLSSRCDFTVVGQEFT  782

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVDMSTAIL++ ++G+LQRIHDKWLL SAC SQ  KLEV+RL+LKS
Sbjct  783  RNGWGFAFPRDSPLAVDMSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKLEVERLQLKS  842

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            F GL++IC +AC LAL +Y I + +Q+ + YS +PE       GSSRS+RL+TFLSF DE
Sbjct  843  FWGLYAICGLACLLALFMYLIQILKQYHKHYSKEPESPDGQNVGSSRSSRLKTFLSFADE  902

Query  209  KEETAKSRSIKRKQMEGDSAR------SIDDDDSY  123
            +EET KSRS KR++ME  S R      SID +  Y
Sbjct  903  REETVKSRS-KRRKMERISYRTTEGSSSIDSNKGY  936



>gb|KDO71522.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=939

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 171/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN PE+Y KALK+GP  GGV AVVD+RAY ELFLST CEFSIVGQ F 
Sbjct  710  DELNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQVFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWLLRSAC+SQ  KL+VDRL+LKS
Sbjct  770  KNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHDKWLLRSACSSQGAKLDVDRLQLKS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GL+ +C +AC LAL +Y + +  QF+R+   P  T S+GGSSRSARLQTFLSFV+EKE
Sbjct  830  FSGLYLLCGLACLLALFIYLMQIVHQFSRHY--PGDTESNGGSSRSARLQTFLSFVNEKE  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            +  KSRS KR+ +E  S RS +D+ S  N + + I
Sbjct  888  DEVKSRS-KRRHVERTSYRS-EDEMSSCNSNRKHI  920



>gb|KDO71521.1| hypothetical protein CISIN_1g002301mg [Citrus sinensis]
Length=940

 Score =   263 bits (671),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 171/215 (80%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN PE+Y KALK+GP  GGV AVVD+RAY ELFLST CEFSIVGQ F 
Sbjct  711  DELNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQVFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWLLRSAC+SQ  KL+VDRL+LKS
Sbjct  771  KNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHDKWLLRSACSSQGAKLDVDRLQLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GL+ +C +AC LAL +Y + +  QF+R+   P  T S+GGSSRSARLQTFLSFV+EKE
Sbjct  831  FSGLYLLCGLACLLALFIYLMQIVHQFSRHY--PGDTESNGGSSRSARLQTFLSFVNEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            +  KSRS KR+ +E  S RS +D+ S  N + + I
Sbjct  889  DEVKSRS-KRRHVERTSYRS-EDEMSSCNSNRKHI  921



>ref|XP_008354606.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=446

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 154/204 (75%), Gaps = 4/204 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL +  SRL  L  P DY KALK+GP  GGV AV+DERA +ELFL++ CEFS+VGQEF 
Sbjct  222  DELNVDESRLVPLITPXDYAKALKDGPHKGGVXAVIDERAXIELFLASRCEFSVVGQEFT  281

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAF +DSPLAVD+STA LKLSENG+LQRI+DKWL R+ C S    L+VDRL  KS
Sbjct  282  KTGWGFAFXRDSPLAVDLSTAJLKLSENGDLQRIYDKWLXRTPCASNGGXLQVDRLXXKS  341

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  AC LAL +YF ++ RQF+R+    E+  S+G S+ SAR+QTFL+FVDEKE
Sbjct  342  FXGLFIICGAACXLALAIYFCIMLRQFSRHYX--EELVSTGXST-SARVQTFLTFVDEKE  398

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            E  KSRS KR++ME  S RS DD+
Sbjct  399  EEVKSRS-KRRRMERLSNRSADDE  421



>gb|AET03581.2| glutamate receptor 3.2 [Medicago truncatula]
Length=941

 Score =   262 bits (670),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 4/224 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GIH SRL  +  PE+ +KAL+ G +NGG+ A VDERAY+ELFLS+ C+FSIVGQEF 
Sbjct  715  DEIGIHESRLVPMKTPEETMKALEKGHQNGGIAAYVDERAYIELFLSSRCDFSIVGQEFT  774

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP DSPLAVD+STAIL+L+E+G+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  775  RNGWGFAFPPDSPLAVDLSTAILELAESGDLQRIHDKWLLSSACRSQGAKLEVDRLNLRS  834

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +ACFLALL+YFI   RQ+ ++S  P++  SSG  S S+RL+TFLSFVDEKE
Sbjct  835  FWGLYLVCGLACFLALLIYFIQTLRQYKKHS--PDEIDSSGQGSGSSRLRTFLSFVDEKE  892

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNR  72
               K+RS KR+QME  S RS  +  S +  S++   RS    NR
Sbjct  893  AIVKNRS-KRRQMERISYRSTSEVGSNIT-SNKDFSRSSTSLNR  934



>ref|XP_009791964.1| PREDICTED: glutamate receptor 3.6-like [Nicotiana sylvestris]
Length=184

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 7/190 (4%)
 Frame = -2

Query  620  MELFLSTHCEFSIVGQEFQKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLR  441
            MELFLST C+FSI+GQEF KNGWGFAFP+DSPLAVDMSTAILKLSENGELQRIHDKWL  
Sbjct  1    MELFLSTRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSG  60

Query  440  SACTSQNTKLEVDRLELKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG  261
             ACTSQNTKLEVDRL+LKSF+GLF IC +ACFLALL+YF+++T Q+  Y  + E +    
Sbjct  61   IACTSQNTKLEVDRLQLKSFSGLFFICGLACFLALLIYFVMITCQYCHYYPESESSGG--  118

Query  260  GSSRSARLQTFLSFVDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVF  81
             SSRS RLQTFLSF DEKEE+ +SRS KR+Q++  S RS+D D S VNGS   I RS+++
Sbjct  119  -SSRSGRLQTFLSFADEKEESVRSRS-KRRQLDATSVRSVDQDAS-VNGS--RIDRSEIY  173

Query  80   SNRA*SLGNS  51
            SNR  S G S
Sbjct  174  SNRVVSFGES  183



>ref|XP_007203997.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
 gb|EMJ05196.1| hypothetical protein PRUPE_ppa001054mg [Prunus persica]
Length=922

 Score =   262 bits (669),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/225 (59%), Positives = 165/225 (73%), Gaps = 12/225 (5%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL +  S L  L +P+DY KALK+GP+ GGV AV+DE A++ELFLS+ C+FSIVGQEF K
Sbjct  690  ELNVDESGLVPLIMPDDYAKALKDGPQRGGVAAVIDEHAFIELFLSSRCDFSIVGQEFTK  749

Query  560  NGWGF--------AFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEV  405
              WG         AF +DSPL+VDMSTAILKLSENG++QRIHDKWL+ S+C SQ  KL+V
Sbjct  750  TAWGIFVMFISNQAFARDSPLSVDMSTAILKLSENGDMQRIHDKWLISSSCASQGAKLQV  809

Query  404  DRLELKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFL  225
            DRL+LKSF GLF +C  ACFLAL++YFI +  QF+++ ++      S GSS SARLQTF+
Sbjct  810  DRLQLKSFWGLFVLCGSACFLALIIYFINMLHQFSKHYTEEV---ISAGSSTSARLQTFI  866

Query  224  SFVDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            SFVDEKEE  KSRS KR+QME  S RS  +D+S  N   R I +S
Sbjct  867  SFVDEKEEEVKSRS-KRRQMERMSNRSASEDESMYNSKRRHIDQS  910



>ref|XP_006467103.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Citrus sinensis]
 ref|XP_006467104.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Citrus sinensis]
Length=940

 Score =   262 bits (669),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 170/215 (79%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E  I  SRL  LN PE+Y KALK+GP  GGV AVVD+RAY ELFLST CEFSIVGQEF 
Sbjct  711  DEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWLLRSAC+SQ  KL+VDRL+LKS
Sbjct  771  KNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHDKWLLRSACSSQGAKLDVDRLQLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GL+ +C +AC LAL +Y + L  QF+R+   P  T S+GGSSRSARLQTFLSFV+EKE
Sbjct  831  FSGLYLLCGLACLLALFIYLMQLVHQFSRHY--PGDTESNGGSSRSARLQTFLSFVNEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            +  KS S KR+ +E  S RS +D+ S  N + + I
Sbjct  889  DEVKSWS-KRRHVERTSYRS-EDEMSSCNSNRKHI  921



>ref|XP_006425257.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
 gb|ESR38497.1| hypothetical protein CICLE_v10024813mg [Citrus clementina]
Length=940

 Score =   261 bits (668),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 170/215 (79%), Gaps = 4/215 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E  I  SRL  LN PE+Y KALK+GP  GGV AVVD+RAY ELFLST CEFSIVGQEF 
Sbjct  711  DEFNIDESRLVPLNSPEEYAKALKDGPHKGGVAAVVDDRAYAELFLSTRCEFSIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAILKLSENG+LQRIHDKWLLRSAC+SQ  KL+VDRL+LKS
Sbjct  771  KNGWGFAFPRDSPLAVDISTAILKLSENGDLQRIHDKWLLRSACSSQGAKLDVDRLQLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GL+ +C +AC LAL +Y + L  QF+R+   P  T S+GGSSRSARLQTFLSFV+EKE
Sbjct  831  FSGLYLLCGLACLLALFIYLMQLVHQFSRHY--PGDTESNGGSSRSARLQTFLSFVNEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            +  KS S KR+ +E  S RS +D+ S  N + + I
Sbjct  889  DEVKSWS-KRRHVERTSYRS-EDEMSSCNSNRKHI  921



>gb|KDO71514.1| hypothetical protein CISIN_1g002505mg [Citrus sinensis]
Length=914

 Score =   261 bits (666),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/199 (64%), Positives = 152/199 (76%), Gaps = 0/199 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  LN  E+Y KAL +GPKNGGV AV+DERAYME+FLST CEFSI+GQEF 
Sbjct  714  DELNIDKSRLVPLNTAEEYEKALTDGPKNGGVSAVIDERAYMEVFLSTRCEFSIIGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            + GWGFAFP+DSPLAVDMS AIL+LSENG+LQRIHDKWL RSAC+SQ  K E D+L LKS
Sbjct  774  RIGWGFAFPRDSPLAVDMSIAILELSENGDLQRIHDKWLTRSACSSQGAKQEADQLHLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LALL+Y I + RQF R+  D ++  S+G SS+S+RLQTF+SF  EKE
Sbjct  834  FWGLFVLCGVACLLALLIYLIQIVRQFARHYLDLQELESAGPSSQSSRLQTFISFAGEKE  893

Query  203  ETAKSRSIKRKQMEGDSAR  147
               K    ++K  EG + R
Sbjct  894  VVIKKSLQEKKIGEGVNWR  912



>ref|XP_007046474.1| Glutamate receptor isoform 1 [Theobroma cacao]
 gb|EOX90631.1| Glutamate receptor isoform 1 [Theobroma cacao]
Length=932

 Score =   261 bits (666),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 155/210 (74%), Gaps = 2/210 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  LN  +DY KALK+GPK GGV AV+DE AYMELFLST CEFSIVG EF 
Sbjct  715  EELSIPKSRLVPLNSADDYAKALKDGPKKGGVAAVIDEHAYMELFLSTQCEFSIVGSEFS  774

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DS LAVDMSTAILKLSENG+LQRIH+KWL   AC SQ TK EVDRL+L S
Sbjct  775  KMGWGFAFPRDSQLAVDMSTAILKLSENGDLQRIHNKWLKGIACRSQGTKEEVDRLQLNS  834

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQ-TPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +C  AC LALLVY + +  QF R+  D E+   SS GSSR AR+QTFLSFV EK
Sbjct  835  FWGLFVLCGFACLLALLVYLVQIVVQFARHYPDSEELASSSSGSSRPARIQTFLSFVGEK  894

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSYVN  117
            EE   SRS KR+QME  S R   DD S  N
Sbjct  895  EEVVVSRS-KRRQMERASKRHRSDDGSLSN  923



>gb|KHN12498.1| Glutamate receptor 3.6 [Glycine soja]
Length=916

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 159/197 (81%), Gaps = 3/197 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L  PE+  +ALK GP+ GGV A VDERAY+ELFLS+ C++SIVGQEF 
Sbjct  723  DEIGIDESRLVPLKTPEETAEALKKGPQKGGVAAYVDERAYIELFLSSRCDYSIVGQEFT  782

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  783  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLRS  842

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+YFI   RQ++++   PE+  SSG  S S+RL+TFL+FVDEKE
Sbjct  843  FWGLYLVCGLACVLALLIYFIQTMRQYSKHG--PEELESSGHGSGSSRLRTFLTFVDEKE  900

Query  203  ETAKSRSIKRKQMEGDS  153
            E  KSRS KRK+MEG S
Sbjct  901  EIVKSRS-KRKKMEGIS  916



>ref|XP_007156253.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 ref|XP_007156254.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 gb|ESW28247.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
 gb|ESW28248.1| hypothetical protein PHAVU_003G270900g [Phaseolus vulgaris]
Length=939

 Score =   259 bits (661),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 168/224 (75%), Gaps = 6/224 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL  L   E+  KAL NGP+ GGV A VDERAY+ELFLS+ CEFSIVGQEF 
Sbjct  715  EEIGIDESRLVPLKTQEETSKALNNGPQKGGVAAYVDERAYIELFLSSRCEFSIVGQEFT  774

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL+L+S
Sbjct  775  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLKLRS  834

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+Y +   RQ++++    E+  SSG  S S+RL+TFLSFVDEKE
Sbjct  835  FWGLYLVCGLACILALLIYLVQTMRQYSKHGR--EELESSGHGSGSSRLRTFLSFVDEKE  892

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRSQVFSNR  72
            E  KSR +KRK++EG S RS  +  S +  +      SQ  SNR
Sbjct  893  EIVKSR-VKRKKIEGMSYRSTSEVGSSIISNK---DYSQASSNR  932



>ref|XP_010266354.1| PREDICTED: glutamate receptor 3.3-like [Nelumbo nucifera]
Length=758

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 161/216 (75%), Gaps = 7/216 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L+ PE+Y +AL+ GPKNGGV AVVDERAY+ELFLS+ C+F+IVGQEF 
Sbjct  536  EELXIPKSRLVPLDSPEEYARALQAGPKNGGVAAVVDERAYVELFLSSRCKFTIVGQEFT  595

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAF +DSPLAVDMSTAIL LSENGEL+RI +KWL RSAC SQ   +  D+L L+S
Sbjct  596  RNGWGFAFQRDSPLAVDMSTAILALSENGELRRIREKWLRRSACNSQGDGIGSDQLHLES  655

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC ++LLVYFI   RQF+++SS+  +  S GGSSR  R+QTFLSF+DEKE
Sbjct  656  FRGLFLICGLACIVSLLVYFISTVRQFSQHSSEEPECSSRGGSSRYGRIQTFLSFIDEKE  715

Query  203  ETAKSRSIKRKQMEGDSARSI---DDDDSYVNGSSR  105
            E    +  KR+Q    S RS+   +++D   N S +
Sbjct  716  EEIIKKRSKRRQ----SIRSLSCSENNDGSTNASRK  747



>ref|NP_190716.3| glutamate receptor 3.6 [Arabidopsis thaliana]
 sp|Q84W41.1|GLR36_ARATH RecName: Full=Glutamate receptor 3.6; AltName: Full=Ligand-gated 
ion channel 3.6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42266.1| putative glutamate receptor [Arabidopsis thaliana]
 gb|AEE78797.1| glutamate receptor 3.6 [Arabidopsis thaliana]
Length=903

 Score =   257 bits (657),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 155/213 (73%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  699  HELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF +   +  +      SS SAR+ +FLSFV EKE
Sbjct  819  FWGLFVVCGVACVLALAVYTVLMIRQFGQQCPEEAEGSIRRRSSPSARIHSFLSFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E AK+RS + +Q+E  SA          NGSSR
Sbjct  879  EDAKARSSRERQLEDISA----------NGSSR  901



>ref|XP_002876089.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52348.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
Length=903

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  699  NELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF R   +  +      SS S R+ +FLSFV EKE
Sbjct  819  FWGLFVVCGVACVLALAVYTVLMIRQFRRQCPEEAEGSIRRRSSPSTRIHSFLSFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E AK+RS + +Q+E  SA          NGSSR
Sbjct  879  EDAKARSSRERQLEDISA----------NGSSR  901



>ref|XP_006292183.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
 gb|EOA25081.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
Length=903

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 155/213 (73%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  699  HELNIHESRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF +   +  +      SS SAR+ +F+SFV EKE
Sbjct  819  FWGLFVVCGVACILALAVYTVLMIRQFGQQYPEEAEGSIRRRSSPSARIHSFISFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E AK+RS + +Q+E          D  VNGSSR
Sbjct  879  EDAKTRSSRGRQLE----------DISVNGSSR  901



>emb|CDX80728.1| BnaC08g05620D [Brassica napus]
Length=242

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE Y KALK+GP+ GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  19   DELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  78

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  79   KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  138

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG------GSSRSARLQTFLS  222
            F GLF IC VAC LAL +YF+ + RQ        E+  + G       S RS RLQ FLS
Sbjct  139  FWGLFLICGVACVLALFLYFVQIIRQLYNGKPSEEEEDAIGRENHDSSSLRSTRLQRFLS  198

Query  221  FVDEKEETAKSRSIKRK  171
             +DEKE+ +K+ S KRK
Sbjct  199  LMDEKEDVSKAGSKKRK  215



>ref|XP_006403911.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
 gb|ESQ45364.1| hypothetical protein EUTSA_v10010111mg [Eutrema salsugineum]
Length=896

 Score =   256 bits (654),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 152/198 (77%), Gaps = 2/198 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  699  NELRIHESRLVPLRSPEEYEKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+STAIL+LSENG+LQRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSS--GGSSRSARLQTFLSFVDE  210
            F GLF +C +AC LAL VY +L+ RQF  +S D ++   S    SS SAR+ +FLSFV E
Sbjct  819  FWGLFVVCGLACVLALAVYTVLMIRQFRHHSPDHQEPEGSIRRRSSPSARIHSFLSFVKE  878

Query  209  KEETAKSRSIKRKQMEGD  156
            KEE  K+RS + +Q+E +
Sbjct  879  KEEDIKARSSRERQLEDN  896



>emb|CAB63012.1| putative glutamate receptor [Arabidopsis thaliana]
Length=1039

 Score =   257 bits (657),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 155/213 (73%), Gaps = 10/213 (5%)
 Frame = -2

Query  743   EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
              EL IH SRL  L  PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  835   HELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  894

Query  563   KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
             KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  895   KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  954

Query  383   FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
             F GLF +C VAC LAL VY +L+ RQF +   +  +      SS SAR+ +FLSFV EKE
Sbjct  955   FWGLFVVCGVACVLALAVYTVLMIRQFGQQCPEEAEGSIRRRSSPSARIHSFLSFVKEKE  1014

Query  203   ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
             E AK+RS + +Q+E  SA          NGSSR
Sbjct  1015  EDAKARSSRERQLEDISA----------NGSSR  1037



>ref|XP_004289031.1| PREDICTED: glutamate receptor 3.3-like [Fragaria vesca subsp. 
vesca]
Length=528

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 156/206 (76%), Gaps = 7/206 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PEDY KALKNGP  GGV AV+DERAYMELFLS+ C +SIVGQEF 
Sbjct  318  DELNIHHSRLFPLNSPEDYEKALKNGPSAGGVAAVIDERAYMELFLSSRCGYSIVGQEFT  377

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG LQ+IHDKWL++SAC+++  K  VDRL+LKS
Sbjct  378  KIGWGFAFPRDSPLAIDMSTAILKLSENGNLQKIHDKWLMKSACSAEGAKQAVDRLQLKS  437

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRY-SSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +  +ACFLAL+++ + + RQ+ R+  SD E + S      + RL++F+SFV+++
Sbjct  438  FWGLFLLSGIACFLALILHVLRMVRQYYRHVDSDIESSQS------TRRLKSFVSFVNKR  491

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD  129
            E   KSRS +R+     S++ + D +
Sbjct  492  EREVKSRSKRRRTENKASSKIVHDQE  517



>ref|XP_010550509.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Tarenaya hassleriana]
Length=889

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 151/213 (71%), Gaps = 12/213 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L   E+Y KAL+ GP  GGV AVVDE AY+ELFLS  CEF IVG EF 
Sbjct  688  NELRIHESRLVPLRSQEEYDKALREGPGKGGVAAVVDEHAYIELFLSNRCEFGIVGHEFT  747

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD STAIL+LSENG+LQRIHDKWLLR AC+ Q  ++EVDRLELKS
Sbjct  748  KNGWGFAFPRNSPLAVDFSTAILQLSENGDLQRIHDKWLLRKACSLQGAEIEVDRLELKS  807

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +AC   LL+Y +L+ RQF RY    E   S+  SS SAR+ TFLSFV+EKE
Sbjct  808  FWGLFVVCGMACLFTLLIYSVLVIRQFCRYFPQ-EAEASTRRSSPSARIHTFLSFVNEKE  866

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  K RS KR+Q E          D  VNG+S 
Sbjct  867  EDVKGRS-KRRQFE----------DITVNGTSH  888



>ref|XP_010550505.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550506.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550507.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550508.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Tarenaya hassleriana]
Length=896

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 151/213 (71%), Gaps = 12/213 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L   E+Y KAL+ GP  GGV AVVDE AY+ELFLS  CEF IVG EF 
Sbjct  695  NELRIHESRLVPLRSQEEYDKALREGPGKGGVAAVVDEHAYIELFLSNRCEFGIVGHEFT  754

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD STAIL+LSENG+LQRIHDKWLLR AC+ Q  ++EVDRLELKS
Sbjct  755  KNGWGFAFPRNSPLAVDFSTAILQLSENGDLQRIHDKWLLRKACSLQGAEIEVDRLELKS  814

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +AC   LL+Y +L+ RQF RY    E   S+  SS SAR+ TFLSFV+EKE
Sbjct  815  FWGLFVVCGMACLFTLLIYSVLVIRQFCRYFPQ-EAEASTRRSSPSARIHTFLSFVNEKE  873

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  K RS KR+Q E          D  VNG+S 
Sbjct  874  EDVKGRS-KRRQFE----------DITVNGTSH  895



>ref|XP_009418664.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418665.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418666.1| PREDICTED: glutamate receptor 3.3-like [Musa acuminata subsp. 
malaccensis]
Length=918

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y +AL+ GP+NGGV A+VDERAY+ELFLST+C+F+I+G EF 
Sbjct  710  EELSIPRSRLKALGSPEEYAEALELGPENGGVAAIVDERAYVELFLSTNCKFAIIGSEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKW  R+AC S+  +++ +RL L S
Sbjct  770  KSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWFTRAACISETDEIDSERLHLSS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSS--RSARLQTFLSFVDE  210
            F GLF IC ++CFLALL+YFI++ RQF +     +Q PSS   +   S RLQ FLSFVD+
Sbjct  830  FWGLFLICGMSCFLALLIYFIIMIRQFVQLPPPDDQGPSSDQQTPRSSRRLQKFLSFVDD  889

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSY  123
            K E AK+RS KR QME  +     D +SY
Sbjct  890  KVEDAKNRS-KRGQMEKPTNNVNADIESY  917



>ref|XP_010680623.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=960

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 160/204 (78%), Gaps = 7/204 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E+L I  S L  L+  E Y +AL+ GP NGGV A+VDERAYMELFLS+ CE++IVGQEF 
Sbjct  719  EQLNIPKSLLIPLHSEEGYDEALRKGPSNGGVAAIVDERAYMELFLSSRCEYTIVGQEFT  778

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVDMSTA+L+++ENG+LQRIHDKWL+R AC+SQ+TKL+V+RLELKS
Sbjct  779  KNGWGFAFPRDSPLAVDMSTALLQIAENGDLQRIHDKWLMRKACSSQDTKLDVNRLELKS  838

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-----LQTFLSF  219
            F GLF +C +ACF+AL++YF L  +Q+ R+ + PE   S G SS S       +QTFLSF
Sbjct  839  FWGLFLVCGIACFVALILYFGLTVKQYFRHYT-PEDEESIGQSSSSRSKSSRGVQTFLSF  897

Query  218  VDEKEETAKSRSIKRKQMEGDSAR  147
            VDEKEE  K RS K++QME  S+R
Sbjct  898  VDEKEEEVKKRS-KKRQMEKGSSR  920



>ref|XP_004287716.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461501.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461505.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461509.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
 ref|XP_011461513.1| PREDICTED: glutamate receptor 3.6 [Fragaria vesca subsp. vesca]
Length=940

 Score =   253 bits (647),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 169/226 (75%), Gaps = 15/226 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            +EL I  SRL  L +PEDY +ALK GP K GGV AV+DERAYMELFLS+ C+FSIVGQEF
Sbjct  715  DELHIEESRLVPLVMPEDYERALKAGPHKEGGVAAVIDERAYMELFLSSRCDFSIVGQEF  774

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             + GWGFAF +DSPL+VDMSTA+LKLS+NG+LQRIHDKWLL+S CTS+   LEVD+LELK
Sbjct  775  TRTGWGFAFARDSPLSVDMSTALLKLSDNGDLQRIHDKWLLKSPCTSKGANLEVDKLELK  834

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF+ LF++C  AC +AL++YF ++  QFT+  +D   +     SS S RLQTFL+FVDEK
Sbjct  835  SFSALFALCGAACVIALIIYFSMMCYQFTKKYTDRLSSSG---SSTSRRLQTFLTFVDEK  891

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSY---------VNGSSRSIG  96
            EE  +SRS KR+ ME  S RS+ +DDS           +GSSRS+G
Sbjct  892  EE-VESRS-KRRSMERMSNRSVGEDDSTNSSKRRHIDPSGSSRSLG  935



>ref|XP_010426704.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
 ref|XP_010426705.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
Length=903

 Score =   253 bits (646),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 153/213 (72%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L+ PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVGQEF 
Sbjct  699  HELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF +   +          S SAR+ +FLSFV EKE
Sbjct  819  FWGLFVVCGVACVLALAVYTVLMIRQFGKQYPEEADGSIRRRISPSARIHSFLSFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  K+RS + +Q+E          D  VNGSSR
Sbjct  879  EDPKARSSRGRQLE----------DISVNGSSR  901



>ref|XP_010503841.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503842.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503843.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   253 bits (645),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L+ PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVG+EF 
Sbjct  699  HELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGKEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF +   +  +       S SAR+ +FLSFV EKE
Sbjct  819  FWGLFVVCGVACILALAVYTVLMIRQFGQQYPEEAEGSIRRRISPSARIHSFLSFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E A+ RS + +Q+E          D  VNGSSR
Sbjct  879  EDARGRSSRGRQLE----------DISVNGSSR  901



>ref|XP_008804484.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Phoenix dactylifera]
Length=916

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y +AL+ GP NGGV AVVDER Y+E+FL  +C+FSI+G EF 
Sbjct  711  EELNISRSRLKALGSPEEYARALELGPDNGGVAAVVDERPYIEMFLEANCKFSIIGSEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVD+STAIL LSENG+LQRIHDKWL    C++   +L+ DRL L S
Sbjct  771  KSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTCSTATDELDSDRLHLNS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDEK  207
            F GLF IC VACFLAL ++F+L+ RQ+ +++S+ E  PSS G+SRS R L  FLSFVD+K
Sbjct  831  FWGLFLICGVACFLALFIFFMLMLRQYLQHASEGEAEPSSQGNSRSGRSLHRFLSFVDDK  890

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDS  126
            EE  K+RS KR+QM+  +     D +S
Sbjct  891  EEDVKNRS-KRRQMQKTTDNGTADIES  916



>ref|XP_008804475.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Phoenix dactylifera]
Length=932

 Score =   253 bits (645),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 155/207 (75%), Gaps = 2/207 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y +AL+ GP NGGV AVVDER Y+E+FL  +C+FSI+G EF 
Sbjct  727  EELNISRSRLKALGSPEEYARALELGPDNGGVAAVVDERPYIEMFLEANCKFSIIGSEFT  786

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVD+STAIL LSENG+LQRIHDKWL    C++   +L+ DRL L S
Sbjct  787  KSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTCSTATDELDSDRLHLNS  846

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDEK  207
            F GLF IC VACFLAL ++F+L+ RQ+ +++S+ E  PSS G+SRS R L  FLSFVD+K
Sbjct  847  FWGLFLICGVACFLALFIFFMLMLRQYLQHASEGEAEPSSQGNSRSGRSLHRFLSFVDDK  906

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDS  126
            EE  K+RS KR+QM+  +     D +S
Sbjct  907  EEDVKNRS-KRRQMQKTTDNGTADIES  932



>ref|XP_010515556.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515557.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   253 bits (645),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L+ PE+Y KAL++GP  GGV AVVDERAY+ELFLS  CEF IVG+EF 
Sbjct  699  HELSIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERAYIELFLSNRCEFGIVGKEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+S AIL+LSENG++QRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  759  KNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSLQGAEIEVDRLELKS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LAL VY +L+ RQF +   +  +       S SAR+ +FLSFV EKE
Sbjct  819  FWGLFVVCGVACVLALAVYTVLMIRQFGKQYPEEAEGSIRRRISPSARIHSFLSFVKEKE  878

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            E  K+RS + +Q+E          D  VNGSSR
Sbjct  879  EDPKARSSRGRQLE----------DISVNGSSR  901



>ref|XP_008786666.1| PREDICTED: glutamate receptor 3.1 [Phoenix dactylifera]
Length=921

 Score =   252 bits (644),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 158/211 (75%), Gaps = 3/211 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL  L  PE Y +AL+ GP NGGV AV+DER Y+E FLST C F+IVG EF 
Sbjct  711  EELGISRSRLKVLGTPEQYARALELGPSNGGVAAVIDERPYVEAFLSTQCRFAIVGSEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAI+ LSENG+LQRIHDKWL RSAC SQN+ LE D+L+L S
Sbjct  771  RSGWGFAFPRDSPLAVDLSTAIVALSENGDLQRIHDKWLTRSACISQNSDLESDQLDLGS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC +AL++YF+L+ RQF R+    E   S  GSSRS  L +F SFVDEKE
Sbjct  831  FWGLFLICGMACTVALIIYFLLMVRQFIRHYPLEETDSSGQGSSRSRSLHSFFSFVDEKE  890

Query  203  ETAKSRSIKRKQME--GDSARSIDDDDSYVN  117
            E  K+RS KRKQM+  G +   I+ +D +V+
Sbjct  891  EDVKNRS-KRKQMQKAGSNGADIESEDKFVS  920



>ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
Length=945

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 152/205 (74%), Gaps = 8/205 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL  L  PE+Y  AL+ GP NGGV AVVDER Y+ELFLS  C+F IVGQEF 
Sbjct  726  EEIGIPKSRLVPLGSPEEYATALQRGPANGGVAAVVDERPYVELFLSNQCKFRIVGQEFT  785

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL RSAC+  N +LE DRL L+S
Sbjct  786  KSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLDNAELESDRLHLRS  845

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF IC +ACF+ALL+YFI + R+F R S+    +     +SRS RLQT LS +DEK 
Sbjct  846  FSGLFLICGIACFIALLIYFIQILRKFCRTSNAAVDSDGQNTTSRSKRLQTLLSIIDEKS  905

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
                +R  KR++++    RS+ DD+
Sbjct  906  ----NRGSKRRKID----RSVSDDN  922



>ref|XP_003547880.2| PREDICTED: glutamate receptor 3.6-like [Glycine max]
Length=916

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 157/197 (80%), Gaps = 3/197 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L  PE+  +ALK GP+ GGV A VDERAY+ELFLS+ C++SIVGQEF 
Sbjct  723  DEIGIDESRLVPLKTPEETAEALKKGPQKGGVAAYVDERAYIELFLSSRCDYSIVGQEFT  782

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL L+S
Sbjct  783  RNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLRS  842

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+Y I   RQ++++   PE+  SSG  S S+ L+TFL+F+DEKE
Sbjct  843  FWGLYLVCGLACVLALLIYCIQTMRQYSKHR--PEELESSGHGSGSSCLRTFLTFIDEKE  900

Query  203  ETAKSRSIKRKQMEGDS  153
            E  KSRS KRK+MEG S
Sbjct  901  EIVKSRS-KRKKMEGIS  916



>ref|XP_006435401.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
 gb|ESR48641.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
Length=930

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PEDY KALK+GP  GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  709  QELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELFLSSQCSFRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+S+AIL+L+ENG+LQRIHDKWL++S+C+ +N +LE DRL L S
Sbjct  769  KSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCSLENAELESDRLHLSS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VACF+AL+VYF+ + +Q  + S+  +   S  GS+RS RLQ FLS +D KE
Sbjct  829  FWGLFLICGVACFIALVVYFLQIMQQLCK-SAPSDSISSEPGSTRSRRLQRFLSLMDGKE  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            +  K++S KR ++EG S     D+D
Sbjct  888  DITKNKS-KRTKVEGPSFHGDGDED  911



>ref|XP_003612376.1| Glutamate receptor 3.6 [Medicago truncatula]
 gb|AES95334.1| glutamate receptor 3.2 [Medicago truncatula]
Length=983

 Score =   252 bits (643),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 156/203 (77%), Gaps = 9/203 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL AL  PE+  +AL+ GP+NGGV A +D+RAY+++FL++ C+F+IVGQEF 
Sbjct  746  QEIGIDESRLIALKTPEEAARALEKGPQNGGVAAYIDQRAYIDIFLASRCKFTIVGQEFT  805

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGF FP+DSPLA+D+STAIL++ +NG+LQRIHDKWLL  AC +Q  KLEV RL+LKS
Sbjct  806  RNGWGFGFPRDSPLAIDLSTAILQMVDNGDLQRIHDKWLLSRACLTQGAKLEVQRLKLKS  865

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD----PEQTPSSGGSSRSARLQTFLSFV  216
            F GL+ IC  AC +ALL+YFI + RQ+T++ S+    P+Q PSSG S      + F+SF 
Sbjct  866  FWGLYVICGSACLVALLIYFIRIIRQYTKHRSEELDSPDQNPSSGSSG----FKKFMSFA  921

Query  215  DEKEETAKSRSIKRKQMEGDSAR  147
            DEKEET K+RS KRK+ME  S R
Sbjct  922  DEKEETVKNRS-KRKKMERISYR  943



>gb|KEH27628.1| glutamate receptor 3.2 [Medicago truncatula]
Length=951

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/203 (58%), Positives = 156/203 (77%), Gaps = 9/203 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL AL  PE+  +AL+ GP+NGGV A +D+RAY+++FL++ C+F+IVGQEF 
Sbjct  714  QEIGIDESRLIALKTPEEAARALEKGPQNGGVAAYIDQRAYIDIFLASRCKFTIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGF FP+DSPLA+D+STAIL++ +NG+LQRIHDKWLL  AC +Q  KLEV RL+LKS
Sbjct  774  RNGWGFGFPRDSPLAIDLSTAILQMVDNGDLQRIHDKWLLSRACLTQGAKLEVQRLKLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD----PEQTPSSGGSSRSARLQTFLSFV  216
            F GL+ IC  AC +ALL+YFI + RQ+T++ S+    P+Q PSSG S      + F+SF 
Sbjct  834  FWGLYVICGSACLVALLIYFIRIIRQYTKHRSEELDSPDQNPSSGSSG----FKKFMSFA  889

Query  215  DEKEETAKSRSIKRKQMEGDSAR  147
            DEKEET K+RS KRK+ME  S R
Sbjct  890  DEKEETVKNRS-KRKKMERISYR  911



>gb|KDO85160.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=938

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PEDY KALK+GP  GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  717  QELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELFLSSQCSFRIVGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+S+AIL+L+ENG+LQRIHDKWL++S+C+ +N +LE DRL L S
Sbjct  777  KSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCSLENAELESDRLHLSS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VACF+AL++YF+ + +Q  + S+  +   S  GS+RS RLQ FLS +D KE
Sbjct  837  FWGLFLICGVACFIALVIYFLQIMQQLCK-SAPSDSISSEPGSTRSRRLQRFLSLMDGKE  895

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            +  K++S KR ++EG S     D+D
Sbjct  896  DITKNKS-KRTKVEGPSFHGDGDED  919



>gb|KDO85161.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
 gb|KDO85162.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=930

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PEDY KALK+GP  GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  709  QELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELFLSSQCSFRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+S+AIL+L+ENG+LQRIHDKWL++S+C+ +N +LE DRL L S
Sbjct  769  KSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCSLENAELESDRLHLSS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VACF+AL++YF+ + +Q  + S+  +   S  GS+RS RLQ FLS +D KE
Sbjct  829  FWGLFLICGVACFIALVIYFLQIMQQLCK-SAPSDSISSEPGSTRSRRLQRFLSLMDGKE  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            +  K++S KR ++EG S     D+D
Sbjct  888  DITKNKS-KRTKVEGPSFHGDGDED  911



>ref|XP_010110512.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXC26730.1| Glutamate receptor 3.6 [Morus notabilis]
Length=961

 Score =   251 bits (642),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 152/210 (72%), Gaps = 20/210 (10%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  LN  ED+ KAL++GP  GGV AVVDERAY+ELFLS HCEFSI+GQEF 
Sbjct  752  DEIGIQESRLVPLNSAEDHAKALRDGPHGGGVAAVVDERAYIELFLSAHCEFSIIGQEFT  811

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLAVDMSTAILKLSENG+LQRIHDKWL+RSAC SQ TKLEVDRL+LKS
Sbjct  812  KAGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLMRSACISQGTKLEVDRLQLKS  871

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF                ++ RQF+R     E+   SG S  S RLQTFLSF DEKE
Sbjct  872  FWGLF----------------VMVRQFSRLHK--EEAQPSGRSLHSGRLQTFLSFADEKE  913

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNG  114
            +  KSRS K +Q E  S RS   D+S +NG
Sbjct  914  DEVKSRS-KTRQSESASNRSTGQDES-MNG  941



>ref|XP_006473826.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Citrus sinensis]
 ref|XP_006473827.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Citrus sinensis]
Length=930

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 156/205 (76%), Gaps = 2/205 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PEDY KALK+GP  GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  709  QELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELFLSSQCSFRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+S+AIL+L+ENG+LQRIHDKWL++S+C+ +N +LE DRL L S
Sbjct  769  KSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCSLENAELESDRLHLSS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VACF+AL++YF+ + +Q  + S+  +   S  GS+RS RLQ FLS +D KE
Sbjct  829  FWGLFLICGVACFIALVIYFLQIMQQLCK-SAPSDSISSEPGSTRSRRLQRFLSLMDGKE  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            +  K++S KR ++EG S     D+D
Sbjct  888  DITKNKS-KRTKVEGPSFHGDRDED  911



>gb|KDP36767.1| hypothetical protein JCGZ_08058 [Jatropha curcas]
Length=926

 Score =   251 bits (640),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 158/207 (76%), Gaps = 9/207 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EELGI+ SRL  L  PE Y  AL+ GP K GGV AVVDER Y+ELFLST C F IVGQEF
Sbjct  710  EELGINKSRLVPLGSPEAYATALQRGPNKEGGVAAVVDERPYVELFLSTQCTFRIVGQEF  769

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVDMSTAIL+L+ENG+LQRIHDKWL+ S C+S  ++LE DRLELK
Sbjct  770  TKSGWGFAFPRDSPLAVDMSTAILELTENGDLQRIHDKWLMHSGCSSDASELESDRLELK  829

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            SF GLF IC +ACFL+L VYF  +TRQ   YS+ PE++ S G GSSRS  +   LS +DE
Sbjct  830  SFWGLFLICGIACFLSLFVYFWQITRQL--YSAHPEESASPGQGSSRSGGIHRLLSLMDE  887

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDD  129
            KE+ ++ ++ KR+++E    RS+ ++D
Sbjct  888  KEDQSRGKN-KRRKLE----RSLSEND  909



>emb|CDX73718.1| BnaC08g22850D [Brassica napus]
Length=891

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 147/194 (76%), Gaps = 0/194 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV A+VDERAY+ELFLS  CEF IVGQEF 
Sbjct  696  NELRIHESRLVPLRSPEEYEKALRDGPGKGGVAAIVDERAYIELFLSNRCEFGIVGQEFT  755

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP++SPLAVD+STAIL+LSENG+LQRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  756  KNGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKACSLQGAEIEVDRLELKS  815

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +AC +AL VY +L+ R+F R+     +      SS SA + +FLSFV EKE
Sbjct  816  FWGLFVVCGLACVVALAVYIVLMIRKFGRHCPVEAEGSIRRRSSPSASIHSFLSFVKEKE  875

Query  203  ETAKSRSIKRKQME  162
            E  K+RS + +Q+E
Sbjct  876  EDVKARSSRERQLE  889



>ref|XP_010463180.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=892

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 156/221 (71%), Gaps = 14/221 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL AL  PE Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  667  NELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  726

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  727  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  786

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LALL+YF+ + RQ  +  SD      +Q      S RS RLQ FLS 
Sbjct  787  FWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIARDQQQNHDSSSMRSTRLQRFLSL  846

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKE+ +KS         G+  R ID   +  +GS+RS G
Sbjct  847  MDEKEDVSKS---------GNKKRKIDGSVNDTSGSTRSRG  878



>ref|XP_010478979.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
 ref|XP_010478980.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=936

 Score =   250 bits (638),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 156/221 (71%), Gaps = 14/221 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL AL  PE Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  711  NELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  771  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LALL+YF+ + RQ  +  SD      +Q      S RS RLQ FLS 
Sbjct  831  FWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIARDQQQNHDSSSMRSTRLQRFLSL  890

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKE+ +KS         G+  R ID   +  +GS+RS G
Sbjct  891  MDEKEDVSKS---------GNKKRKIDGSVNDTSGSTRSRG  922



>ref|XP_010500221.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
 ref|XP_010500222.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
Length=936

 Score =   250 bits (638),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 156/221 (71%), Gaps = 14/221 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL AL  PE Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  711  NELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  771  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LALL+YF+ + RQ  +  SD      +Q      S RS RLQ FLS 
Sbjct  831  FWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIARDQQQNHDSSSMRSTRLQRFLSL  890

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKE+ +KS         G+  R ID   +  +GS+RS G
Sbjct  891  MDEKEDVSKS---------GNKKRKIDGSVNDTSGSTRSRG  922



>ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006342153.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Solanum tuberosum]
Length=946

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL  L  PE+Y  AL+ GP  GGV AVVDER Y+ELFLS  C+F IVGQEF 
Sbjct  724  EEIGIPKSRLVPLGSPEEYATALQRGPAKGGVSAVVDERPYVELFLSNQCKFRIVGQEFT  783

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL RSAC+  N +LE DRL L+S
Sbjct  784  KSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLDNAELESDRLHLRS  843

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF IC +ACF+ALL+YFI + R+F + S+          +SRS RLQT LS +DEK 
Sbjct  844  FSGLFLICGIACFIALLIYFIQILRKFCQTSNAAVDMDGQSTTSRSKRLQTLLSIIDEKS  903

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            + +   S +RK     SA +I++D
Sbjct  904  DKSNRGSKRRKIDRSVSADNIEND  927



>ref|XP_009401867.1| PREDICTED: glutamate receptor 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/197 (62%), Positives = 145/197 (74%), Gaps = 2/197 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL AL  P DYV+AL+ GPK GGV AVVDER Y+ELFLS  CEF+IVG EF 
Sbjct  716  EELGISRSRLKALGTPNDYVRALELGPKKGGVAAVVDERPYIELFLSIQCEFAIVGSEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLL-RSACTSQNTKLEVDRLELK  387
            KNGWGFAFP+DSPLAVD+ST IL LSENG+LQRIHDKWL  RS C+SQ ++LE DRL+L 
Sbjct  776  KNGWGFAFPRDSPLAVDLSTNILTLSENGDLQRIHDKWLTGRSLCSSQTSELESDRLQLN  835

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSA-RLQTFLSFVDE  210
            SF GLF +C + C +A+ VYF ++  Q+ R+    E   S  GSS+S   LQ F SF+DE
Sbjct  836  SFWGLFLVCGMTCTVAMFVYFAIMVHQYIRHYPLEESDSSDHGSSKSGCSLQRFFSFIDE  895

Query  209  KEETAKSRSIKRKQMEG  159
            KEE  KSRS  RK ++ 
Sbjct  896  KEEDVKSRSKSRKMLQA  912



>ref|XP_003533409.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006587553.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006587554.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
 ref|XP_006587555.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Glycine max]
 gb|KHN38862.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   249 bits (635),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/218 (59%), Positives = 163/218 (75%), Gaps = 8/218 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL IH SRL  LN P +Y KALK+GP NGGV A++DERAYMELFL+T CE+ IVGQEF 
Sbjct  709  EELNIHRSRLVPLNSPSEYEKALKDGPANGGVTAIIDERAYMELFLATRCEYGIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG+LQRIHDKWL RSAC+S+  K  +DRLEL+S
Sbjct  769  KMGWGFAFPRDSPLAIDMSTAILKLSENGDLQRIHDKWLTRSACSSEGAKQGIDRLELES  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRY-SSDPEQTPSSGGSSRSARLQTFLSFVD-E  210
            F GLF +  +ACF+ALL Y I +  +F+R+ +S+PE     G SS   RL++F +FV+  
Sbjct  829  FWGLFLLSGIACFIALLCYVIRMAYRFSRHPNSNPE-----GCSSYYTRLRSFFTFVNER  883

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSYV-NGSSRSI  99
            +EE  K+   KRK+ E  S+R +  +D  + +GSS S+
Sbjct  884  EEEEEKNIMSKRKRTEKGSSRRVAHEDGLIMDGSSVSV  921



>gb|AFK41266.1| unknown [Lotus japonicus]
Length=225

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 156/206 (76%), Gaps = 1/206 (0%)
 Frame = -2

Query  737  LGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQKN  558
            +GI  SRL  L  PE+  KAL+ GP  GG+ A VDERAY+ELFLST C+FS++GQEF +N
Sbjct  1    MGIDESRLVPLKDPEETTKALEKGPHKGGIAAYVDERAYIELFLSTRCDFSVIGQEFTRN  60

Query  557  GWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSFA  378
            GWGFAFP+DSPLA+DMSTAIL+L+ENG+LQRIHDKWLLR AC SQ  KLEVDRL L+SF 
Sbjct  61   GWGFAFPRDSPLALDMSTAILELAENGDLQRIHDKWLLRRACLSQGAKLEVDRLNLRSFW  120

Query  377  GLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKEET  198
            GL+ +C +AC LALL+Y     RQ+ ++  +  ++ S  G+S S RLQTFLSFVDEKEE 
Sbjct  121  GLYLVCGLACLLALLIYLFQTLRQYKKHDPEELESSSGQGASGSTRLQTFLSFVDEKEEI  180

Query  197  AKSRSIKRKQMEGDSARSIDDDDSYV  120
             K+RS KR+QME  S RS  +  S V
Sbjct  181  VKTRS-KRRQMERISYRSTSEVGSSV  205



>ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=927

 Score =   247 bits (630),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 121/195 (62%), Positives = 147/195 (75%), Gaps = 3/195 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKN-GGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EELGI  SRL AL  PE Y  AL+ GPK  GGV A+VDE  Y+ELFLS+ C F IVGQEF
Sbjct  710  EELGISKSRLVALGSPEAYATALQRGPKKAGGVAAIVDELPYVELFLSSQCSFRIVGQEF  769

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVDMSTAIL+LSENG+LQRIHDKWL+ S C+S  T++E DRLELK
Sbjct  770  TKSGWGFAFPRDSPLAVDMSTAILELSENGDLQRIHDKWLMHSGCSSDTTEIESDRLELK  829

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF+ + RQ          +PS  GSSRS RL   LS +DEK
Sbjct  830  SFWGLFLICGIACFIALFIYFLQIMRQLDHVPPSESDSPSQ-GSSRSGRLHRLLSLMDEK  888

Query  206  EETAKSRSIKRKQME  162
            E+ +KS++ KR+++E
Sbjct  889  EDPSKSKN-KRRKLE  902



>ref|XP_011100274.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100281.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100289.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100297.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
Length=935

 Score =   246 bits (629),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 119/205 (58%), Positives = 153/205 (75%), Gaps = 5/205 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E +GI  SRL AL  PE+Y  AL+ GP NGGV AVVDER Y+ELFL++ C F I+GQEF 
Sbjct  711  EGIGISKSRLKALGSPEEYATALQKGPHNGGVAAVVDERPYIELFLASQCRFRIIGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL LSENG+LQRIHDKWL  S+C+S NT+LE DRL LKS
Sbjct  771  KSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLTTSSCSSDNTELESDRLHLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDEK  207
            F GL+ +C +ACF+ALL+YF+ +  +F +  + PE+    G GSSRS RL T LS +DEK
Sbjct  831  FWGLYLLCGIACFIALLIYFLQIVHKFRK--AAPEEYVIDGQGSSRSKRLHTLLSLIDEK  888

Query  206  EETAKSRSIKRK--QMEGDSARSID  138
            E+ ++S   +RK  QM  ++   +D
Sbjct  889  EDQSRSDRKRRKLEQMLSENNGEVD  913



>ref|XP_010103244.1| Glutamate receptor 3.6 [Morus notabilis]
 gb|EXB95115.1| Glutamate receptor 3.6 [Morus notabilis]
Length=1034

 Score =   247 bits (631),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 154/204 (75%), Gaps = 10/204 (5%)
 Frame = -2

Query  743   EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             +EL IH SRL  LN  E+Y KALK+GP  GGV AVVDERAYMELFLST CEFSIVGQEF 
Sbjct  814   DELNIHRSRLVPLNSQEEYEKALKDGPSGGGVAAVVDERAYMELFLSTRCEFSIVGQEFT  873

Query  563   KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
             K GWGFAFP+DSPLA+DMSTAILKLSENG LQRIHDKWL+R AC+S+  K +VDRL++KS
Sbjct  874   KMGWGFAFPRDSPLAIDMSTAILKLSENGILQRIHDKWLMRGACSSEGAKQDVDRLQIKS  933

Query  383   FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
             F GLF +  +ACF+ALL+Y I + RQF+++            +++SA L++FL F++EKE
Sbjct  934   FWGLFLLSGLACFIALLLYLIKMLRQFSKHCVR---------NAKSAGLRSFLVFLNEKE  984

Query  203   ETAKSRSIKRKQMEGDSARSIDDD  132
             E + S+S KR++ E  S R    D
Sbjct  985   EVSSSQS-KRRRTERASNRIAHQD  1007



>ref|XP_010094542.1| Glutamate receptor 3.3 [Morus notabilis]
 gb|EXB56296.1| Glutamate receptor 3.3 [Morus notabilis]
Length=932

 Score =   246 bits (628),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 158/215 (73%), Gaps = 10/215 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE Y KAL++GP  GGV AVVDERAY+ELFLST C+F +VGQEF 
Sbjct  710  EEIGISKSRLIALGSPEAYAKALQDGPSKGGVAAVVDERAYIELFLSTQCKFRVVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL++SENG+LQRIHDKWL+RSAC+ +  +LE D+L LKS
Sbjct  770  KSGWGFAFPRDSPLAVDMSTAILQMSENGDLQRIHDKWLMRSACSMEGAELESDQLHLKS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSGGS-SRSARLQTFLSFVDE  210
            FAGLF +C VACF+A+L+YF+   R F R Y + P  + S   S SRS RL+ FLS +DE
Sbjct  830  FAGLFLMCGVACFVAILIYFL---RIFKRLYYAAPLDSVSGAQSESRSGRLRRFLSLIDE  886

Query  209  KEE--TAKSRSIKRKQMEGDSARSIDDDDSYVNGS  111
            K++  + K R + R   E D    +DD +    GS
Sbjct  887  KKQDNSNKRRKVDRSLSEND---KLDDLERKAEGS  918



>ref|XP_010918356.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010918357.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=922

 Score =   246 bits (627),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 158/212 (75%), Gaps = 4/212 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE GI  SRL  L  PE+Y +AL+ GP N GV AV+DE+ Y+E+FLS  C F+IVG +F 
Sbjct  711  EEFGIARSRLKVLGTPEEYARALELGPSNDGVAAVIDEQPYIEIFLSMQCRFAIVGSQFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DS LAVD+STAIL LSENG+LQRIH+KWL RSAC+SQ+  LE D+L+L S
Sbjct  771  RNGWGFAFPRDSALAVDLSTAILTLSENGDLQRIHNKWLTRSACSSQSIDLESDQLDLGS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDEK  207
            F GLF IC +AC ++L++YF L+ RQF R+    E   S  GSSRSAR   +F SFVDEK
Sbjct  831  FWGLFLICGMACTVSLIIYFFLMLRQFIRHYPLEETDSSGQGSSRSARSFYSFFSFVDEK  890

Query  206  EETAKSRSIKRKQME--GDSARSIDDDDSYVN  117
            EE  K++S KRKQM+  G+++  I+++  +V+
Sbjct  891  EEDVKNKS-KRKQMQQAGNNSTDIENEHRFVS  921



>ref|XP_006306244.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
 gb|EOA39142.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
Length=941

 Score =   245 bits (626),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 155/221 (70%), Gaps = 14/221 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL  L  P+ Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  716  NELNISESRLVPLGTPDAYAKALKDGPNKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  776  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC  ALL+YFI + RQ  +  +D      +Q      S RS RLQ FLS 
Sbjct  836  FWGLFLICGVACIFALLLYFIQILRQLYKKPNDDAIARDQQQSHDSSSIRSTRLQRFLSL  895

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKE+ +KS S KRK         ID   +  +GS+RS G
Sbjct  896  MDEKEDVSKSVSKKRK---------IDGSVNDTSGSTRSRG  927



>gb|KHN35947.1| Glutamate receptor 3.6 [Glycine soja]
Length=938

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE+  KAL+ GP+NGGV A +DERAY ++FLS+ C+ +++GQEF 
Sbjct  714  QELNIDESRLVPLTTPEEAAKALRKGPENGGVAAYIDERAYTDIFLSSRCDLTVIGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ ++G+LQRIHDKWLL SAC SQ  K EV+RL+LKS
Sbjct  774  RNGWGFAFPRDSPLAVDLSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKFEVERLQLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GL+ IC +AC LAL +Y I + RQ+ ++    E   + G +  S+S+ L+TFLSFVDE
Sbjct  834  FWGLYMICGLACLLALFIYLIQIWRQYHKHYVSEELHSTDGQNIGSKSSHLKTFLSFVDE  893

Query  209  KEETAKSRSIKRKQMEGDSARS  144
            KEET KSRS KR++ME  S R+
Sbjct  894  KEETFKSRS-KRRKMERISYRN  914



>ref|XP_003517130.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Glycine max]
 ref|XP_006573518.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=938

 Score =   245 bits (625),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE+  KAL+ GP+NGGV A +DERAY ++FLS+ C+ +++GQEF 
Sbjct  714  QELNIDESRLVPLTTPEEAAKALRKGPENGGVAAYIDERAYTDIFLSSRCDLTVIGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ ++G+LQRIHDKWLL SAC SQ  K EV+RL+LKS
Sbjct  774  RNGWGFAFPRDSPLAVDLSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKFEVERLQLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GL+ IC +AC LAL +Y I + RQ+ ++    E   + G +  S+S+ L+TFLSFVDE
Sbjct  834  FWGLYMICGLACLLALFIYLIQIWRQYHKHYVSEELHSTDGQNIGSKSSHLKTFLSFVDE  893

Query  209  KEETAKSRSIKRKQMEGDSARS  144
            KEET KSRS KR++ME  S R+
Sbjct  894  KEETFKSRS-KRRKMERISYRN  914



>ref|XP_011461520.1| PREDICTED: glutamate receptor 3.6-like [Fragaria vesca subsp. 
vesca]
Length=635

 Score =   240 bits (613),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 155/206 (75%), Gaps = 7/206 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH +RL  LN PE+Y KALKNGP  GGV AV+DERAYMELFLS+ C +SIVGQEF 
Sbjct  422  DELNIHHNRLFPLNSPEEYEKALKNGPSAGGVAAVIDERAYMELFLSSRCGYSIVGQEFT  481

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG LQ+IHDKWL++SAC+++  K  VDRL+LKS
Sbjct  482  KMGWGFAFPRDSPLAIDMSTAILKLSENGILQKIHDKWLMKSACSAEGAKQAVDRLQLKS  541

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRY-SSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +  +ACFLAL+++ + + +Q+ R+   D E + S      + RL++F+SFV+++
Sbjct  542  FWGLFLLSGIACFLALILHVLRMVQQYYRHVDCDIESSQS------TRRLKSFVSFVNKR  595

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD  129
            E   KSRS +R+     S++ + D +
Sbjct  596  EREVKSRSKRRRTENKASSKVVHDQE  621



>ref|XP_008241924.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like [Prunus 
mume]
Length=922

 Score =   244 bits (622),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 164/216 (76%), Gaps = 10/216 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KAL++GP+ GGV AV+DERAYMELFLS+ C +SIVGQEF 
Sbjct  716  DELNIHRSRLVPLNSPEEYEKALQDGPRAGGVAAVIDERAYMELFLSSRCGYSIVGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL++KS
Sbjct  776  KMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSACSAEGAKQAVDRLQIKS  835

Query  383  FAGLFSICAVACFLALLVYFI-LLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +  +ACFLAL+++ I ++ + + R  SD E       SS+S RLQ+F+SFV+++
Sbjct  836  FWGLFLLSGIACFLALVLHVIRMVHKYYKRPDSDCE-------SSQSRRLQSFVSFVNKR  888

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E+  KSR  KR + E  S++ + +D S +NG   S+
Sbjct  889  EQEVKSRP-KRMRTENASSKIVHEDSS-INGLDESV  922



>ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris]
Length=930

 Score =   244 bits (622),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE Y  AL+ GP  GGV AVVDER Y+ELFLS  C+F IVGQEF 
Sbjct  709  EEIGIPKSRLVALGSPEQYATALQRGPGKGGVAAVVDERPYIELFLSNQCKFRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL RSAC+ +N +LE DRL L+S
Sbjct  769  KSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLENAELESDRLHLRS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF IC +ACF+ALL+YF+ +  ++ R ++  E        SRS RLQT LS +DEK 
Sbjct  829  FSGLFLICGIACFIALLIYFLQIMHKY-RQAAKAEAISDGSTGSRSKRLQTLLSLIDEKA  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + + SR  KR++++    RS+ D++
Sbjct  888  DKS-SRDSKRRKVD----RSVSDEN  907



>ref|XP_004509457.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Cicer arietinum]
Length=845

 Score =   243 bits (620),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 160/208 (77%), Gaps = 3/208 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GIH SRL  L  PE+ ++AL+ GPK GGV A VDERAY+ELFLS+ CEF+IVGQEF 
Sbjct  621  DEIGIHESRLVPLKTPEETMEALEKGPKKGGVAAYVDERAYIELFLSSRCEFTIVGQEFT  680

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL LKS
Sbjct  681  RNGWGFAFPPDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLKS  740

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+Y I   RQ+ ++   PE+  S G    S+RL+TF+SFVDEKE
Sbjct  741  FWGLYLVCGLACLLALLIYLIQTLRQYKKHG--PEELESPGQGLGSSRLRTFISFVDEKE  798

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYV  120
            +  KSRS KR+QME  S RS  +  S +
Sbjct  799  DIVKSRS-KRRQMERISYRSTSEVGSTI  825



>ref|XP_004509455.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
 ref|XP_004509456.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=940

 Score =   244 bits (622),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 160/208 (77%), Gaps = 3/208 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GIH SRL  L  PE+ ++AL+ GPK GGV A VDERAY+ELFLS+ CEF+IVGQEF 
Sbjct  716  DEIGIHESRLVPLKTPEETMEALEKGPKKGGVAAYVDERAYIELFLSSRCEFTIVGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP DSPLAVD+STAIL+L+ENG+LQRIHDKWLL SAC SQ  KLEVDRL LKS
Sbjct  776  RNGWGFAFPPDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACLSQGAKLEVDRLNLKS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL+ +C +AC LALL+Y I   RQ+ ++   PE+  S G    S+RL+TF+SFVDEKE
Sbjct  836  FWGLYLVCGLACLLALLIYLIQTLRQYKKHG--PEELESPGQGLGSSRLRTFISFVDEKE  893

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYV  120
            +  KSRS KR+QME  S RS  +  S +
Sbjct  894  DIVKSRS-KRRQMERISYRSTSEVGSTI  920



>ref|XP_009115836.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Brassica rapa]
 emb|CDX78008.1| BnaA09g32030D [Brassica napus]
Length=891

 Score =   243 bits (621),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 145/194 (75%), Gaps = 0/194 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV A+V ERAY+ELFLS  CEF IVGQEF 
Sbjct  696  NELRIHESRLVPLWSPEEYEKALRDGPGKGGVAAIVGERAYIELFLSNRCEFGIVGQEFT  755

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP++SPLAVD+STAIL+LSENG+LQRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  756  KTGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKACSLQGAEIEVDRLELKS  815

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +AC +AL VY +++ R+F R+     +      SS SA + +FLSFV EKE
Sbjct  816  FWGLFVVCGLACVVALAVYIVMMIRKFGRHCPVEAEGSIRRRSSPSASIHSFLSFVKEKE  875

Query  203  ETAKSRSIKRKQME  162
            E  K+RS + +Q+E
Sbjct  876  EDVKARSSRERQLE  889



>ref|XP_003533408.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
 gb|KHN38861.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   243 bits (621),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/213 (57%), Positives = 155/213 (73%), Gaps = 4/213 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL IH SRL  LN P +Y KALK+GP NGGV A++DERAYMELFL+T CEF IVGQEF 
Sbjct  711  EELNIHRSRLVPLNSPSEYEKALKDGPANGGVAAIIDERAYMELFLATRCEFGIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGF FP++SPLA+DMSTAILKLSENG+LQRIHDKWL RSAC+S+  K  +DRLELKS
Sbjct  771  KMGWGFGFPRESPLAIDMSTAILKLSENGDLQRIHDKWLTRSACSSEGAKQGIDRLELKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +  +ACF+ALL Y I +  +F+R S+    + +   SS SARL++FLSFV+E+E
Sbjct  831  FWGLFLLSGIACFIALLCYVIRMAYRFSRDSN----SNNIECSSLSARLRSFLSFVNERE  886

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
               K     R++ +    + + +D S  + + R
Sbjct  887  GEDKCWPKTRRKEKCSCRKVVHEDGSLDDSTVR  919



>ref|XP_009115834.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
 ref|XP_009115835.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
Length=940

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 145/194 (75%), Gaps = 0/194 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL IH SRL  L  PE+Y KAL++GP  GGV A+V ERAY+ELFLS  CEF IVGQEF 
Sbjct  745  NELRIHESRLVPLWSPEEYEKALRDGPGKGGVAAIVGERAYIELFLSNRCEFGIVGQEFT  804

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP++SPLAVD+STAIL+LSENG+LQRI DKWLLR AC+ Q  ++EVDRLELKS
Sbjct  805  KTGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKACSLQGAEIEVDRLELKS  864

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +AC +AL VY +++ R+F R+     +      SS SA + +FLSFV EKE
Sbjct  865  FWGLFVVCGLACVVALAVYIVMMIRKFGRHCPVEAEGSIRRRSSPSASIHSFLSFVKEKE  924

Query  203  ETAKSRSIKRKQME  162
            E  K+RS + +Q+E
Sbjct  925  EDVKARSSRERQLE  938



>ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
 ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
Length=930

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 153/205 (75%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL +L  PE Y  AL+ GP  GGV AVVDER Y+ELFLS  C+F IVGQEF 
Sbjct  709  EEIGIPKSRLVSLGSPEQYATALQRGPGKGGVAAVVDERPYVELFLSNQCKFRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL RSAC+ +N +LE DRL L+S
Sbjct  769  KSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLENAELESDRLHLRS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF IC +ACF+ALL+YF+ +  ++ R ++  E       +SRS RLQT LS +DEK 
Sbjct  829  FSGLFLICGIACFIALLIYFLQIMHKY-RQAAKAEAVSDGPTTSRSKRLQTLLSLIDEKA  887

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + ++ R  KR++++    RS+ D++
Sbjct  888  DKSR-RDSKRRKID----RSVSDEN  907



>emb|CAN72607.1| hypothetical protein VITISV_021339 [Vitis vinifera]
Length=916

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y KAL+NGP  GGV AVVDER Y+ELFLST C+F IVGQEF 
Sbjct  692  EELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELFLSTQCKFRIVGQEFT  751

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKWL  SAC+S++T+LE DRL LKS
Sbjct  752  KSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACSSESTELESDRLHLKS  811

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL++YF  + R+F R ++      +  GSSRS  LQT  S +D++ 
Sbjct  812  FWGLFLICGLACFVALVIYFFQILRKF-RNAAAVGANSTGTGSSRSGHLQTLFSLMDDRS  870

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               K+   K++++E    RS+ ++D
Sbjct  871  GHTKTGH-KKRRIE----RSLSEND  890



>emb|CBI40741.3| unnamed protein product [Vitis vinifera]
Length=934

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y KAL+NGP  GGV AVVDER Y+ELFLST C+F IVGQEF 
Sbjct  710  EELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELFLSTQCKFRIVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKWL  SAC+S++T+LE DRL LKS
Sbjct  770  KSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACSSESTELESDRLHLKS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL++YF  + R+F R ++      +  GSSRS  LQT  S +D++ 
Sbjct  830  FWGLFLICGLACFVALVIYFFQILRKF-RNAAAVGANSTGTGSSRSGHLQTLFSLMDDRS  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               K+   K++++E    RS+ ++D
Sbjct  889  GHTKTGH-KKRRIE----RSLSEND  908



>ref|XP_011465033.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Fragaria 
vesca subsp. vesca]
Length=942

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 156/205 (76%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL AL  P  Y +AL+ GPK GGV AVVDER Y+ELFLST C+F +VGQEF 
Sbjct  716  EELGISKSRLIALGSPLAYAEALQLGPKKGGVAAVVDERPYVELFLSTQCKFRVVGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL+LSENG+LQRIHDKWL++S+C+ ++T++E D+L+L+S
Sbjct  776  KSGWGFAFPRDSPLAVDISTAILQLSENGDLQRIHDKWLMQSSCSFESTEIESDQLQLRS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+ALLVYF+ +  +  R++  P+   +S G S+S RL+ FLS +D+K 
Sbjct  836  FWGLFLICGIACFIALLVYFLQIMNKL-RHADPPQSVLTSPGVSQSGRLRRFLSIIDKKA  894

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + + S S K     G   RS+ D+D
Sbjct  895  DQSNSGSKK-----GKLXRSLSDND  914



>ref|XP_002272859.2| PREDICTED: glutamate receptor 3.3 [Vitis vinifera]
Length=964

 Score =   242 bits (618),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 152/205 (74%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y KAL+NGP  GGV AVVDER Y+ELFLST C+F IVGQEF 
Sbjct  740  EELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELFLSTQCKFRIVGQEFT  799

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKWL  SAC+S++T+LE DRL LKS
Sbjct  800  KSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACSSESTELESDRLHLKS  859

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL++YF  + R+F R ++      +  GSSRS  LQT  S +D++ 
Sbjct  860  FWGLFLICGLACFVALVIYFFQILRKF-RNAAAVGANSTGTGSSRSGHLQTLFSLMDDRS  918

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
               K+   K++++E    RS+ ++D
Sbjct  919  GHTKTGH-KKRRIE----RSLSEND  938



>ref|NP_174978.1| glutamate receptor 3.3 [Arabidopsis thaliana]
 sp|Q9C8E7.1|GLR33_ARATH RecName: Full=Glutamate receptor 3.3; AltName: Full=Ligand-gated 
ion channel 3.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51316.1|AC025815_3 ligand-gated ion channel, putative [Arabidopsis thaliana]
 gb|AEE31925.1| glutamate receptor 3.3 [Arabidopsis thaliana]
Length=933

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 154/221 (70%), Gaps = 15/221 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL  L  PE Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  709  NELNISESRLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  769  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LAL +YF+ + RQ  +  +D      +Q      S RS RLQ FLS 
Sbjct  829  FWGLFLICGVACLLALFLYFVQIIRQLYKKPTDDAIARDQQQNHDSSSMRSTRLQRFLSL  888

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKEE+ K  S KRK         ID   +  +GS+RS G
Sbjct  889  MDEKEES-KHESKKRK---------IDGSMNDTSGSTRSRG  919



>ref|XP_008241922.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
 ref|XP_008241923.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=924

 Score =   242 bits (617),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 162/216 (75%), Gaps = 10/216 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KAL++GP  GGV AV+DERAYMELFLS+ C +SIVGQEF 
Sbjct  718  DELNIHRSRLVPLNSPEEYEKALQDGPSAGGVAAVIDERAYMELFLSSQCRYSIVGQEFT  777

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL++KS
Sbjct  778  KMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSACSAEGAKQAVDRLQIKS  837

Query  383  FAGLFSICAVACFLALLVYFI-LLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +  +ACFLAL+++ I ++ + + R  SD E       SS+S RLQ+F+SFV++ 
Sbjct  838  FWGLFLLSGIACFLALVLHVIRMVHKYYKRPDSDCE-------SSQSRRLQSFVSFVNKT  890

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
            E+  KSR  KR + E  S++ + +D S +NG   S+
Sbjct  891  EQEVKSRP-KRMRTEKASSKIVHEDSS-INGLDESV  924



>ref|XP_002891241.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=937

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 157/221 (71%), Gaps = 14/221 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL  L  PE Y KALK+GP  GGV A+VDER Y+ELFLST+C + IVGQEF 
Sbjct  712  NELNISESRLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSTNCAYRIVGQEFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  772  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  831

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LAL +YF+ + RQ  +  S+      +Q      S RS RLQ FLS 
Sbjct  832  FWGLFLICGVACLLALFLYFVQIIRQLYKKPSNDAIARDQQQNHDSSSMRSTRLQRFLSL  891

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKEE+      K+++++G    S++D  +   GS+RS G
Sbjct  892  MDEKEESKPGS--KKRKIDG----SMNDTSA---GSTRSRG  923



>ref|XP_006396004.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
 gb|ESQ33290.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
Length=937

 Score =   241 bits (616),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 149/198 (75%), Gaps = 9/198 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE Y KALK+GP+ GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  712  DELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  772  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  831

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGG-------SSRSARLQTFL  225
            F GLF IC VAC LAL +YF+ + RQ   Y++ P +   + G       S RS RLQ FL
Sbjct  832  FWGLFLICGVACVLALFLYFVQIIRQL--YNAKPSEENDAIGRENYDSSSLRSTRLQRFL  889

Query  224  SFVDEKEETAKSRSIKRK  171
            S +DE+E+ +K+ S KRK
Sbjct  890  SLMDEREDVSKAGSKKRK  907



>emb|CDY35797.1| BnaA08g04580D [Brassica napus]
Length=822

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 117/197 (59%), Positives = 146/197 (74%), Gaps = 6/197 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE Y KALK+GP+ GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  599  DELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  658

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  659  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  718

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG------GSSRSARLQTFLS  222
            F GLF IC VAC LAL +YF+ + RQ        E+  + G       S RS RLQ FLS
Sbjct  719  FWGLFLICGVACVLALFLYFVQIIRQLYNGKPSEEEEDAIGRENHDSSSLRSTRLQRFLS  778

Query  221  FVDEKEETAKSRSIKRK  171
             +DEKE+ +K+ S KRK
Sbjct  779  LMDEKEDVSKAGSKKRK  795



>ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=928

 Score =   241 bits (615),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 150/205 (73%), Gaps = 14/205 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            +ELGI  SRL AL  PE+Y KAL+ GP K GGV AVVDER Y++LFLST C F +VGQEF
Sbjct  714  QELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDLFLSTQCNFRVVGQEF  773

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSP+AVDMSTAIL LSENG+LQRIHDKWL RSAC+  + +LE ++L LK
Sbjct  774  TKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLDDNELESNQLHLK  833

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF L+ R+FTRY                  ++TFLSFVDEK
Sbjct  834  SFWGLFLICGLACFVALFIYFFLMIRKFTRYFPGARH------------IKTFLSFVDEK  881

Query  206  EETAKSRSIKRKQMEGDSARSIDDD  132
            EE +K+RS +R+Q +  S  S  +D
Sbjct  882  EEHSKTRS-ERRQSDTTSNGSDKED  905



>ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=944

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 150/205 (73%), Gaps = 14/205 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            +ELGI  SRL AL  PE+Y KAL+ GP K GGV AVVDER Y++LFLST C F +VGQEF
Sbjct  730  QELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDLFLSTQCNFRVVGQEF  789

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSP+AVDMSTAIL LSENG+LQRIHDKWL RSAC+  + +LE ++L LK
Sbjct  790  TKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLDDNELESNQLHLK  849

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF L+ R+FTRY                  ++TFLSFVDEK
Sbjct  850  SFWGLFLICGLACFVALFIYFFLMIRKFTRYFPGARH------------IKTFLSFVDEK  897

Query  206  EETAKSRSIKRKQMEGDSARSIDDD  132
            EE +K+RS +R+Q +  S  S  +D
Sbjct  898  EEHSKTRS-ERRQSDTTSNGSDKED  921



>ref|XP_010266235.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=916

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 150/205 (73%), Gaps = 14/205 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            +ELGI  SRL AL  PE+Y KAL+ GP K GGV AVVDER Y++LFLST C F +VGQEF
Sbjct  702  QELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDLFLSTQCNFRVVGQEF  761

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSP+AVDMSTAIL LSENG+LQRIHDKWL RSAC+  + +LE ++L LK
Sbjct  762  TKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLDDNELESNQLHLK  821

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF L+ R+FTRY                  ++TFLSFVDEK
Sbjct  822  SFWGLFLICGLACFVALFIYFFLMIRKFTRYFPGARH------------IKTFLSFVDEK  869

Query  206  EETAKSRSIKRKQMEGDSARSIDDD  132
            EE +K+RS +R+Q +  S  S  +D
Sbjct  870  EEHSKTRS-ERRQSDTTSNGSDKED  893



>ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
 ref|XP_010266231.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=947

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 150/205 (73%), Gaps = 14/205 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            +ELGI  SRL AL  PE+Y KAL+ GP K GGV AVVDER Y++LFLST C F +VGQEF
Sbjct  733  QELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDLFLSTQCNFRVVGQEF  792

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSP+AVDMSTAIL LSENG+LQRIHDKWL RSAC+  + +LE ++L LK
Sbjct  793  TKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLDDNELESNQLHLK  852

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF L+ R+FTRY                  ++TFLSFVDEK
Sbjct  853  SFWGLFLICGLACFVALFIYFFLMIRKFTRYFPGARH------------IKTFLSFVDEK  900

Query  206  EETAKSRSIKRKQMEGDSARSIDDD  132
            EE +K+RS +R+Q +  S  S  +D
Sbjct  901  EEHSKTRS-ERRQSDTTSNGSDKED  924



>gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana]
Length=933

 Score =   241 bits (614),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 153/221 (69%), Gaps = 15/221 (7%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             EL I  SRL  L  PE Y KALK+GP  GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  709  NELNISESRLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  769  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD-----PEQTPSSGGSSRSARLQTFLSF  219
            F GLF IC VAC LAL +YF+ + RQ  +  +D      +Q      S RS RLQ FLS 
Sbjct  829  FWGLFLICGVACLLALFLYFVQIIRQLYKKPTDDAIARDQQQNHDSSSMRSTRLQRFLSL  888

Query  218  VDEKEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            +DEKEE+ K  S KRK         ID   +  +GS RS G
Sbjct  889  MDEKEES-KHESKKRK---------IDGSMNDTSGSRRSRG  919



>ref|XP_009359611.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=923

 Score =   240 bits (613),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 160/217 (74%), Gaps = 10/217 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KALK+GP  GGV AV+DERAYMELFLS  C +SIVGQEF 
Sbjct  715  DELNIHKSRLVPLNSPEEYEKALKDGPNAGGVAAVIDERAYMELFLSVRCGYSIVGQEFT  774

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL + S
Sbjct  775  KMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSACSAEGAKQAVDRLPMSS  834

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +   ACFLAL+++ + +  Q+ + Y SD E       SS++ RL++F+SFV+++
Sbjct  835  FWGLFLLSGTACFLALVLHVLHMAHQYYKHYDSDCE-------SSQAKRLRSFVSFVNKR  887

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD-SYVNGSSRSI  99
            EE  KSR+ KR++ E  S + + D D S ++G   S+
Sbjct  888  EEEVKSRT-KRRRTEKASNKVVHDQDCSCIDGLDESV  923



>ref|XP_008337900.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=929

 Score =   239 bits (611),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 158/217 (73%), Gaps = 10/217 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KALK+GP  GGV AV+DERAYMELFLS  C +SIVGQEF 
Sbjct  721  DELNIHKSRLVPLNSPEEYEKALKDGPNAGGVAAVIDERAYMELFLSVRCGYSIVGQEFT  780

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL + S
Sbjct  781  KMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSACSAEGAKQAVDRLPMSS  840

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +   ACFLAL+++   +  Q+ + Y SD E       SS++ RL++F+SFV+++
Sbjct  841  FWGLFLLSGTACFLALVLHVXRMAHQYYKHYDSDCE-------SSQAKRLRSFVSFVNKR  893

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD-SYVNGSSRSI  99
            EE  KSR+ KRK+ E  S   + D D S ++G   S+
Sbjct  894  EEEVKSRT-KRKRTEKASNXVVHDQDCSSIDGLDESV  929



>ref|XP_002306435.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
 gb|EEE93431.2| hypothetical protein POPTR_0005s10560g [Populus trichocarpa]
Length=913

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE  I  SRL ALN  EDY KALK+GP+ GGV AV+DERAY+ELFLST C+FSIVGQEF 
Sbjct  701  EEYNIARSRLVALNSDEDYAKALKDGPQKGGVAAVIDERAYIELFLSTRCDFSIVGQEFS  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMS AILKLSE GELQRIHDKWL RSAC+S+  K  ++RL LKS
Sbjct  761  KSGWGFAFPRDSPLAVDMSAAILKLSEGGELQRIHDKWLQRSACSSEGAKESINRLHLKS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C VAC LALL+Y I +  +F+ YS D E  PSS G+S S  LQTF SFV EKE
Sbjct  821  FWGLFLMCGVACLLALLLYLIKILWKFSNYSEDTE--PSSRGTS-SPGLQTFFSFVSEKE  877

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDS  126
                SRS K+++ME  S +    D+S
Sbjct  878  ADITSRS-KKRRMERTSKKVRGGDES  902



>ref|XP_002306988.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE93984.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=932

 Score =   239 bits (610),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 153/206 (74%), Gaps = 8/206 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE Y  AL+ GP+ GGV A+VDE  Y+ELFLS  C F IVGQEF 
Sbjct  711  EEVGIPKSRLVALGSPEAYANALQLGPEKGGVAAIVDELPYVELFLSRQCTFRIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENG+LQRIHDKWL +S C+S+ ++LE DRL LKS
Sbjct  771  KSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSTCSSETSELESDRLHLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDEK  207
            F GLF IC +ACF++LL++F  +TRQ   Y + P ++PS+G GS RS RL    S +DEK
Sbjct  831  FWGLFLICGLACFISLLIHFCQITRQL--YRTAPVESPSAGQGSLRSGRLHRLFSLMDEK  888

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD  129
                KS ++KR+++E    RS+ ++D
Sbjct  889  ASQEKS-AVKRRKLE----RSLSEND  909



>ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
 gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
Length=870

 Score =   239 bits (609),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE Y  ALK GP+ GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  647  QELNISRSRLVALGSPEAYASALKLGPEKGGVAAVVDERPYIELFLSSQCTFRIVGQEFT  706

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL L+ENG+LQRI DKWLL+S C+ ++T++E +RL L S
Sbjct  707  KSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTCSLESTEIESNRLHLSS  766

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL +YF+ + RQ  R    PE   +  GS RS  LQ FLS +DEKE
Sbjct  767  FWGLFLICGIACFIALFIYFLQILRQLRRVPP-PESASTGQGSLRSGGLQRFLSLMDEKE  825

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + +KS   KR+++E    +S+ D+D
Sbjct  826  DQSKSGQ-KRRKIE----KSLSDND  845



>ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
 gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
Length=941

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE Y  ALK GP+ GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  718  QELNISRSRLVALGSPEAYASALKLGPEKGGVAAVVDERPYIELFLSSQCTFRIVGQEFT  777

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL L+ENG+LQRI DKWLL+S C+ ++T++E +RL L S
Sbjct  778  KSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTCSLESTEIESNRLHLSS  837

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL +YF+ + RQ  R    PE   +  GS RS  LQ FLS +DEKE
Sbjct  838  FWGLFLICGIACFIALFIYFLQILRQLRRVPP-PESASTGQGSLRSGGLQRFLSLMDEKE  896

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + +KS   KR+++E    +S+ D+D
Sbjct  897  DQSKSGQ-KRRKIE----KSLSDND  916



>ref|XP_010266236.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266237.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
 ref|XP_010266238.1| PREDICTED: glutamate receptor 3.2-like [Nelumbo nucifera]
Length=928

 Score =   239 bits (609),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 152/216 (70%), Gaps = 8/216 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE  I  SRL AL  PE+Y  AL  G     V AVVDER+Y+ELFLS  C+FSIVG+EF 
Sbjct  705  EEFNIPKSRLVALGSPEEYATALDKG----TVAAVVDERSYVELFLSKQCKFSIVGREFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL LSENG+LQRIHDKWL    C+S+ T+ E DRL L+S
Sbjct  761  KSGWGFAFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTSKTCSSRGTEFESDRLHLRS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGG-SSRSARLQTFLSFVDEK  207
            F GLF IC +ACF+AL +YFIL+ RQF +    P +  SSG  SSRSARLQTFLSFVDEK
Sbjct  821  FWGLFLICGIACFIALFLYFILMVRQFNQ--EFPNEVDSSGHESSRSARLQTFLSFVDEK  878

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSI  99
             + + S+S KRK  E  S  +  +D+       R I
Sbjct  879  VDGSSSKS-KRKLTEKSSDINSKEDEQRNGSKGRQI  913



>ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
Length=933

 Score =   239 bits (609),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE Y  ALK GP+ GGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  710  QELNISRSRLVALGSPEAYASALKLGPEKGGVAAVVDERPYIELFLSSQCTFRIVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL L+ENG+LQRI DKWLL+S C+ ++T++E +RL L S
Sbjct  770  KSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTCSLESTEIESNRLHLSS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL +YF+ + RQ  R    PE   +  GS RS  LQ FLS +DEKE
Sbjct  830  FWGLFLICGIACFIALFIYFLQILRQLRRVPP-PESASTGQGSLRSGGLQRFLSLMDEKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDD  129
            + +KS   KR+++E    +S+ D+D
Sbjct  889  DQSKSGQ-KRRKIE----KSLSDND  908



>ref|XP_009392852.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392854.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=941

 Score =   237 bits (604),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL   E+Y KAL+ GP NGGV A+VDERAY+ELFLST+C F+IVG EF 
Sbjct  736  EELSIPRSRLKALGSREEYAKALELGPDNGGVAAIVDERAYVELFLSTNCNFAIVGSEFT  795

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKWL R+AC S+  +++  RL+L S
Sbjct  796  KSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTRAACISETDEIDSQRLQLSS  855

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSA-RLQTFLSFVDEK  207
            F GLF IC  +CFLALL+Y IL+ RQ+ +++   +   SSG + RS   LQ F SF   K
Sbjct  856  FWGLFLICGTSCFLALLIYLILVLRQYIKHAPVDKHDSSSGQTPRSGFSLQKFFSFASGK  915

Query  206  EETAKSRSIKRKQMEGDSARSIDD  135
            EE  +SRS K+ +M+  +  +  D
Sbjct  916  EEDVRSRS-KQGEMQKPTINATVD  938



>ref|XP_009392853.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=915

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 118/204 (58%), Positives = 148/204 (73%), Gaps = 2/204 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL   E+Y KAL+ GP NGGV A+VDERAY+ELFLST+C F+IVG EF 
Sbjct  710  EELSIPRSRLKALGSREEYAKALELGPDNGGVAAIVDERAYVELFLSTNCNFAIVGSEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLAVDMSTAIL LSENG+LQRIHDKWL R+AC S+  +++  RL+L S
Sbjct  770  KSGWGFVFPRDSPLAVDMSTAILTLSENGDLQRIHDKWLTRAACISETDEIDSQRLQLSS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSA-RLQTFLSFVDEK  207
            F GLF IC  +CFLALL+Y IL+ RQ+ +++   +   SSG + RS   LQ F SF   K
Sbjct  830  FWGLFLICGTSCFLALLIYLILVLRQYIKHAPVDKHDSSSGQTPRSGFSLQKFFSFASGK  889

Query  206  EETAKSRSIKRKQMEGDSARSIDD  135
            EE  +SRS K+ +M+  +  +  D
Sbjct  890  EEDVRSRS-KQGEMQKPTINATVD  912



>gb|KDP43779.1| hypothetical protein JCGZ_22406 [Jatropha curcas]
Length=860

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/213 (57%), Positives = 154/213 (72%), Gaps = 10/213 (5%)
 Frame = -2

Query  731  IHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQKNGW  552
            I  SRL  LN  ++Y KALK+GPK GGV A+VDE+AY+ELFLS++CEFSIVGQEF +NGW
Sbjct  646  IDKSRLVPLNSEQEYAKALKDGPKKGGVAAIVDEKAYIELFLSSNCEFSIVGQEFGRNGW  705

Query  551  GFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSFAGL  372
            GFAFP+DSPLA DMS+AIL LSE+G+LQRI DKWL R AC S++   E +RL L+SF GL
Sbjct  706  GFAFPRDSPLAADMSSAILTLSESGDLQRIRDKWLSRRACNSEDASGEANRLHLESFWGL  765

Query  371  FSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSR----SARLQTFLSFVDEKE  204
            F IC  AC LA ++Y + L R+F  YS + E     GGS R    SA  QTFLSFVDEKE
Sbjct  766  FLICGTACLLAFILYLVQLLRKFKLYSKELE-----GGSLRQSSLSAHFQTFLSFVDEKE  820

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            +  K RS KR++M+  ++ +  + ++  N SS+
Sbjct  821  KDVKKRS-KRRRMDQKASDTNINRNALRNSSSK  852



>ref|XP_010530328.1| PREDICTED: glutamate receptor 3.3 [Tarenaya hassleriana]
Length=962

 Score =   236 bits (603),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 146/198 (74%), Gaps = 5/198 (3%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL I  SRL  L  PE Y KALK+GP+ GGV A+VDER Y+ELFLS++C + IVGQEF K
Sbjct  715  ELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVELFLSSNCAYRIVGQEFTK  774

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKSF  381
            +GWGFAFP+DSPLAVD+STAIL+L+ENG+LQRIHDKWL+++ACT  N +LE DRL LKSF
Sbjct  775  SGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLMKNACTLDNAELESDRLHLKSF  834

Query  380  AGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS----SRSARLQTFLSFVD  213
             GLF IC +AC LALL+YF  + RQ  R +   +     G S    SRS  LQ F S +D
Sbjct  835  WGLFLICGIACLLALLIYFASILRQLYRANPSGDAISKDGSSNGSLSRSNHLQRFWSLMD  894

Query  212  EKEETAKSRSIKRKQMEG  159
            EKE+ +K R  K+++++G
Sbjct  895  EKEDLSK-RGNKKRKIDG  911



>ref|XP_009107640.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Brassica rapa]
Length=929

 Score =   236 bits (602),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/197 (59%), Positives = 145/197 (74%), Gaps = 6/197 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L   E Y KALK+GP+ GGV A+VDER Y+ELFLS++C + IVGQEF 
Sbjct  706  DELNISESRLVPLGSREAYAKALKDGPRKGGVAAIVDERPYVELFLSSNCAYRIVGQEFT  765

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL+L+ENG+LQRIHDKWL+++ACT +N +LE DRL LKS
Sbjct  766  KSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKS  825

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG------GSSRSARLQTFLS  222
            F GLF IC VAC LAL +YF+ + RQ        E+  + G       S RS RLQ FLS
Sbjct  826  FWGLFLICGVACVLALFLYFVQIIRQLYNGKPSEEEEDAIGRENHDSSSLRSTRLQRFLS  885

Query  221  FVDEKEETAKSRSIKRK  171
             +DEKE+ +K+ S KRK
Sbjct  886  LMDEKEDVSKAGSKKRK  902



>gb|AET03597.2| glutamate receptor 3.2 [Medicago truncatula]
Length=936

 Score =   236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 120/216 (56%), Positives = 151/216 (70%), Gaps = 2/216 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN P +Y KALK+GP NGGV A+VDERAYME+FL   CEF I+GQEF 
Sbjct  716  QELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFLEMRCEFGIIGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG LQRIHDKWL RS+C S+  K  +DRL+L+S
Sbjct  776  KMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRSEEEKQGMDRLDLQS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF I  +ACF++L  Y   +   + ++ S      +   SSRSARL++FLSFV EKE
Sbjct  836  FWGLFLITGIACFVSLFCYVFQMAYSYRKHYSK-NNNNNVQFSSRSARLRSFLSFVKEKE  894

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIG  96
            E  K  S  R + E  S+R +  +D  ++    ++G
Sbjct  895  EEDKC-SENRIKKEKSSSRRVAHEDGPLDLDDSNVG  929



>ref|XP_007203444.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
 gb|EMJ04643.1| hypothetical protein PRUPE_ppa022019mg, partial [Prunus persica]
Length=895

 Score =   234 bits (598),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/195 (59%), Positives = 151/195 (77%), Gaps = 9/195 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KAL++GP  GGV AV+DERAYMELFLS+ C +SIVGQEF 
Sbjct  706  DELNIHRSRLVPLNSPEEYEKALQDGPSAGGVAAVIDERAYMELFLSSRCGYSIVGQEFT  765

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL++KS
Sbjct  766  KMGWGFAFPRDSPLAIDMSTAVLKLSEKGDLQKIHDKWLMKSACSAEGAKQAVDRLQIKS  825

Query  383  FAGLFSICAVACFLALLVYFI-LLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +  +ACFLAL+++ I ++ + + R  SD E       SS+S RLQ+F+SFV+++
Sbjct  826  FWGLFLLSGIACFLALVLHVIRMMHKYYKRPDSDCE-------SSQSRRLQSFVSFVNKR  878

Query  206  EETAKSRSIKRKQME  162
            E+  KSR  KR + E
Sbjct  879  EQEVKSRP-KRMRTE  892



>ref|XP_007135963.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 ref|XP_007135964.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07957.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07958.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
Length=918

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 146/192 (76%), Gaps = 2/192 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +++GI  SRL AL  PE+Y KAL+ GPK GGV A+VDER Y+E+FLS+ C F IVGQEF 
Sbjct  708  QDIGISKSRLIALGSPEEYAKALQLGPKRGGVAAIVDERPYVEIFLSSQCTFRIVGQEFT  767

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKW+ RS+C+  N +++ DRL+LKS
Sbjct  768  RSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCSLDNAEIDSDRLQLKS  827

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+ALL++F+ +  Q   + S P +  +S   S S R Q FLS +D KE
Sbjct  828  FWGLFIICGIACFVALLLHFLQIIFQL--WKSPPSEPAASTACSISGRFQRFLSLIDAKE  885

Query  203  ETAKSRSIKRKQ  168
            +++ S+  KR++
Sbjct  886  DSSGSKVKKRER  897



>ref|XP_011022198.1| PREDICTED: glutamate receptor 3.6-like [Populus euphratica]
Length=931

 Score =   234 bits (597),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 154/207 (74%), Gaps = 5/207 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EE  I  SRL ALN  EDY KALK+GP K GGV AV+DERAY+ELFLS+ C+FSIVGQEF
Sbjct  718  EEYNIARSRLVALNTVEDYAKALKDGPQKEGGVAAVIDERAYIELFLSSRCDFSIVGQEF  777

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             KNGWGFAFP+DSPLAVDMS AILKLSE GELQRIHDKWL  SAC+S+  K  ++RL LK
Sbjct  778  SKNGWGFAFPRDSPLAVDMSAAILKLSEGGELQRIHDKWLQSSACSSEGAKESINRLHLK  837

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF +C VAC LALL+Y I +   F+ YS D E  PSS G+S S  LQTF+SFV EK
Sbjct  838  SFWGLFLMCGVACLLALLLYLIKILWTFSNYSEDTE--PSSRGTS-SPGLQTFISFVSEK  894

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDS  126
            E    SRS K+++ME  S +    D+S
Sbjct  895  EADITSRS-KKRRMERASNKVGGGDES  920



>ref|XP_011041194.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041195.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041196.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041197.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041198.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041199.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041200.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
Length=933

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/207 (58%), Positives = 154/207 (74%), Gaps = 9/207 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE Y  AL+ GP+ GGV A+VDE  Y++LFLS  C F IVGQEF 
Sbjct  711  EEVGISKSRLVALGSPEAYANALQLGPEKGGVAAIVDELPYVQLFLSRQCTFRIVGQEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENG+LQRIHDKWL +S+C+S+ ++LE DRL LKS
Sbjct  771  KSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSSCSSETSELESDRLHLKS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSA-RLQTFLSFVDE  210
            F GLF IC +ACF++LL++F  +TRQ   Y + P ++PS+G GS RS  RL   LS +DE
Sbjct  831  FWGLFLICGLACFISLLIHFCQITRQL--YRATPVESPSAGQGSLRSGRRLHRLLSLMDE  888

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDD  129
            K    KS + KR+++E    RS+ ++D
Sbjct  889  KAGQEKSAA-KRRKLE----RSLSEND  910



>ref|XP_010935350.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
 ref|XP_010935351.1| PREDICTED: glutamate receptor 3.1 [Elaeis guineensis]
Length=916

 Score =   233 bits (593),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 150/195 (77%), Gaps = 2/195 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y +AL+ GP NGGV AVVDER Y+E FL T C+F+I+G EF 
Sbjct  711  EELNIAKSRLKALGTPEEYARALELGPDNGGVAAVVDERPYVENFLETKCKFAIIGSEFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF FP+DSPLA+DMSTAIL LSENG+LQRIHDKWL RSAC+S   +L+ DRL+L S
Sbjct  771  KSGWGFIFPRDSPLAMDMSTAILSLSENGDLQRIHDKWLTRSACSSATDELDSDRLQLTS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDEK  207
            F GLF IC VACFLALL +F L+ RQ+ R++ + E  PS+ G S S R L  FLSFVD+K
Sbjct  831  FWGLFLICGVACFLALLTFFFLMLRQYLRHAPEDEADPSNQGKSTSGRSLHKFLSFVDDK  890

Query  206  EETAKSRSIKRKQME  162
            EE  K+RS K++QM+
Sbjct  891  EEAVKNRS-KQRQMQ  904



>ref|XP_009359749.1| PREDICTED: glutamate receptor 3.6-like [Pyrus x bretschneideri]
Length=933

 Score =   232 bits (592),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 143/181 (79%), Gaps = 6/181 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KALK+GP  GGV+AV+DERAYMELFLS  C +SIVGQEF 
Sbjct  725  DELNIHKSRLVPLNSPEEYEKALKDGPNAGGVVAVIDERAYMELFLSVRCGYSIVGQEFT  784

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL+++S
Sbjct  785  KMGWGFAFPRDSPLAIDMSTAVLKLSERGDLQKIHDKWLMKSACSAEGAKQAVDRLQMRS  844

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +  +ACFLAL+++ + + RQ+ R+        S   SS++ RL++F+SFV+++E
Sbjct  845  FWGLFLLSGIACFLALVLHVLRMVRQYYRFHD------SDCDSSQARRLRSFVSFVNKRE  898

Query  203  E  201
            E
Sbjct  899  E  899



>ref|XP_008237957.1| PREDICTED: glutamate receptor 3.3 [Prunus mume]
Length=945

 Score =   232 bits (591),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 156/207 (75%), Gaps = 7/207 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKN-GGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EELGI  SRL  L  P+ Y +AL+ GPK  GGV AVVDER Y+E+FLS+ C+F ++GQEF
Sbjct  720  EELGISKSRLIPLGSPQAYAQALQLGPKKAGGVAAVVDERLYVEVFLSSQCKFRVIGQEF  779

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVDMSTA+L+LSENG+LQRI+DKWL +S+CT ++T+LE DRL LK
Sbjct  780  TKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSSCTLESTELESDRLHLK  839

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF+ +  +  R++       +S GSSRS +L+ FLS +DEK
Sbjct  840  SFWGLFLICGIACFVALFIYFLQILNKL-RHADPTPCVSTSPGSSRSRQLRRFLSLIDEK  898

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDS  126
            ++ + S S KRK++     RS  D+D+
Sbjct  899  KDPSNSGS-KRKKI----VRSFSDNDT  920



>ref|XP_008337899.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=925

 Score =   231 bits (590),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 155/210 (74%), Gaps = 6/210 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KALK+GP  GG+ AV+DERAYMELFLS  C +SIVGQEF 
Sbjct  717  DELNIHKSRLVPLNSPEEYEKALKDGPNAGGIAAVIDERAYMELFLSVRCGYSIVGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+LKLSE G+LQ+IHDKWL++SAC+++  K  VDRL ++S
Sbjct  777  KMGWGFAFPRDSPLAIDMSTAVLKLSERGDLQKIHDKWLMKSACSAEGAKQAVDRLPMRS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +  +ACFLAL+++ + + RQ+ R+        S   SS++ RL++F+SFV+++E
Sbjct  837  FWGLFLLSGIACFLALVLHVLRMVRQYYRFHD------SDCDSSQARRLRSFVSFVNKRE  890

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNG  114
            E  K R+ +R+  +  +    D D S ++G
Sbjct  891  EEVKRRTKRRRTEKASNKVVQDQDSSSIDG  920



>ref|XP_007210370.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
 gb|EMJ11569.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
Length=863

 Score =   231 bits (588),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 155/206 (75%), Gaps = 7/206 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKN-GGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EELGI  SRL  L  P+ Y +AL+ GPK  GGV AVVDER Y+E+FLS+ C+F ++GQEF
Sbjct  638  EELGISKSRLIPLGSPQAYAQALQLGPKKAGGVAAVVDERPYVEVFLSSQCKFRVIGQEF  697

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVDMSTA+L+LSENG+LQRI+DKWL +S+CT ++T+LE DRL LK
Sbjct  698  TKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSSCTLESTELESDRLHLK  757

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACF+AL +YF+ +  +  R++       +S G+SRS +L+ FLS +DEK
Sbjct  758  SFWGLFLICGIACFIALFIYFLQILNKL-RHADPTPCVSTSPGNSRSRQLRRFLSLIDEK  816

Query  206  EETAKSRSIKRKQMEGDSARSIDDDD  129
            ++ + S S KRK++     RS  D+D
Sbjct  817  KDPSNSGS-KRKKI----VRSFSDND  837



>ref|XP_004512282.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Cicer arietinum]
Length=915

 Score =   231 bits (589),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L   E+  +AL+ GP NGGV A V+ERAY+E+FLS+ CEF++VGQ F 
Sbjct  680  QEIGIDESRLVPLKTAEEAARALEKGPHNGGVAAYVEERAYIEIFLSSRCEFTVVGQAFT  739

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ +NG+LQRIHDKWLL  AC SQ  KLEV++L+LKS
Sbjct  740  RNGWGFAFPRDSPLAVDLSTAILQMVDNGDLQRIHDKWLLSRACLSQGAKLEVEKLKLKS  799

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL++IC  AC LAL ++ I + RQ+ +  S  E+  S+  +S S+ L+ F +FVD+KE
Sbjct  800  FWGLYAICGSACLLALFIFLIQIIRQYNKNHS--EELDSTDQNSGSSCLRRFFAFVDKKE  857

Query  203  ETAKSRSIKRKQME  162
            ET ++R +KR++ME
Sbjct  858  ETLQNR-LKRRKME  870



>ref|XP_004512281.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Cicer arietinum]
Length=943

 Score =   231 bits (589),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/194 (56%), Positives = 149/194 (77%), Gaps = 3/194 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +E+GI  SRL  L   E+  +AL+ GP NGGV A V+ERAY+E+FLS+ CEF++VGQ F 
Sbjct  708  QEIGIDESRLVPLKTAEEAARALEKGPHNGGVAAYVEERAYIEIFLSSRCEFTVVGQAFT  767

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ +NG+LQRIHDKWLL  AC SQ  KLEV++L+LKS
Sbjct  768  RNGWGFAFPRDSPLAVDLSTAILQMVDNGDLQRIHDKWLLSRACLSQGAKLEVEKLKLKS  827

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GL++IC  AC LAL ++ I + RQ+ +  S  E+  S+  +S S+ L+ F +FVD+KE
Sbjct  828  FWGLYAICGSACLLALFIFLIQIIRQYNKNHS--EELDSTDQNSGSSCLRRFFAFVDKKE  885

Query  203  ETAKSRSIKRKQME  162
            ET ++R +KR++ME
Sbjct  886  ETLQNR-LKRRKME  898



>ref|XP_010923968.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
 ref|XP_010923969.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=930

 Score =   230 bits (587),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 144/198 (73%), Gaps = 8/198 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L+ PEDY  AL  GPKNGGV AVVDE  Y+ELFLS HC+F  VGQEF 
Sbjct  714  QELNIAESRLVPLDTPEDYASALDLGPKNGGVSAVVDELPYVELFLSNHCKFKTVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAIL+LSENG+LQRIHDKWL R+ CTSQ+T ++ +RL LKS
Sbjct  774  KNGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLTRNGCTSQDTGVDSNRLSLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-------LQTFL  225
            F GLF I  +AC +AL+V+F+ +  Q++ YSS  +       S RS R       ++  L
Sbjct  834  FWGLFLISGIACLIALMVFFMRMLCQYSEYSSREQVECPISDSERSIRRPARLSSVKDIL  893

Query  224  SFVDEKEETAKSRSIKRK  171
            SF+D+KE+  KS +IKRK
Sbjct  894  SFLDKKEDDVKS-AIKRK  910



>gb|KJB57940.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
 gb|KJB57942.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
 gb|KJB57944.1| hypothetical protein B456_009G186500 [Gossypium raimondii]
Length=909

 Score =   230 bits (587),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 142/192 (74%), Gaps = 4/192 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +L  PE Y  ALK GP NGGV AVVDER Y+ELFLS+ C F +VGQEF 
Sbjct  710  EELNISRSRLVSLGSPEAYALALKRGPGNGGVAAVVDERPYVELFLSSQCTFKVVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL L+ENG+LQRIHDKWL++S C+ ++T++E ++L L S
Sbjct  770  KSGWGFAFPRDSPLAIDMSTAILALAENGDLQRIHDKWLMQSTCSLESTEIETNQLNLSS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDEK  207
            F GLF IC +AC +ALL+YF+ + +Q       PE    +G  SS S RL+ FLS +DEK
Sbjct  830  FWGLFLICGIACIIALLIYFLQILQQL---PPAPESASITGQDSSHSRRLRRFLSLMDEK  886

Query  206  EETAKSRSIKRK  171
            EE ++S   +RK
Sbjct  887  EEQSRSGQKRRK  898



>ref|XP_008373417.1| PREDICTED: glutamate receptor 3.3 [Malus domestica]
Length=959

 Score =   230 bits (586),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  +RL AL  P+ Y +AL+ GPK GGV AVVDER Y+ELFLS+ C+F +VG EF 
Sbjct  739  EELGIPKNRLMALGSPQAYARALQLGPKKGGVAAVVDERPYVELFLSSQCKFRVVGPEFT  798

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL+LSENG+LQRIHDKWL++S+C+   T+LE DRL LKS
Sbjct  799  KSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSCSLDTTELESDRLHLKS  858

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC +AL +Y + +  +  R +   ++  +S G+S+S RL+ FLS +DE++
Sbjct  859  FWGLFLICGIACSVALFIYLLQVLNKLRR-AEVTQRVSTSPGNSQSGRLKRFLSIIDERK  917

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
            + + S S KRK++     RS  D+
Sbjct  918  DQSSSGS-KRKKI----VRSFSDN  936



>ref|XP_008453000.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Cucumis melo]
Length=833

 Score =   229 bits (584),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EEL I  SRL  L  PE+Y KAL+ GP K GGV A+VDE  Y+E FLS  C F +VGQEF
Sbjct  625  EELNISKSRLIPLGSPEEYAKALELGPDKEGGVAAIVDELLYVESFLSRQCSFRVVGQEF  684

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVD+STAIL+LSENG+LQRIHDKWL++SACT +N +LE DRL+LK
Sbjct  685  TKSGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLVKSACTMENAELESDRLQLK  744

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTP-SSGGSSRSARLQTFLSFVDE  210
            SF GLF IC + CF+AL +Y   + RQ   Y ++PE+   SS   S S RL+  +S +DE
Sbjct  745  SFWGLFLICGIVCFIALAIYCFQIIRQL--YHTEPEEPDLSSNSGSHSNRLRRIISLLDE  802

Query  209  KEETAKSRSIKRKQMEGDSARSIDDD  132
            K+E++K R  KR+++E  S    ++D
Sbjct  803  KKESSK-RGSKRRKVEKSSENDKNND  827



>gb|KCW70331.1| hypothetical protein EUGRSUZ_F03574 [Eucalyptus grandis]
Length=808

 Score =   229 bits (584),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 146/208 (70%), Gaps = 5/208 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  P+ Y KAL++GP  GGV A+VDE  Y+E+FLST C F IVG EF 
Sbjct  586  QELKISRSRLKPLGSPDAYAKALRDGPGKGGVAALVDELPYVEMFLSTQCSFRIVGPEFT  645

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL++++C S + ++E DRL LKS
Sbjct  646  KSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSCLSDSAEIESDRLHLKS  705

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL +YF+ +  Q    ++  E  P    SSRS  LQ FLS +DEKE
Sbjct  706  FWGLFLICGIACFVALFIYFLQILHQLC--TTPAESVPEGSSSSRSRHLQRFLSLMDEKE  763

Query  203  ET---AKSRSIKRKQMEGDSARSIDDDD  129
            +    +K R ++R   E D A + + D+
Sbjct  764  DPSKRSKRRKVERALSENDIAGNPERDN  791



>ref|XP_006590755.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Glycine max]
 ref|XP_006590756.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=938

 Score =   229 bits (585),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 153/196 (78%), Gaps = 3/196 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             E+GI+ SRL  L   E+  KAL+ GP+NGGV A +DERAY ++FLS+ C+ ++VGQEF 
Sbjct  714  HEIGINESRLVPLTTTEEAAKALRKGPENGGVAAYIDERAYTDIFLSSRCDLTVVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ +NG+LQRIHDKWLL SAC SQ  KLEV+RL+LKS
Sbjct  774  RNGWGFAFPRDSPLAVDLSTAILQMIDNGDLQRIHDKWLLSSACLSQGAKLEVERLQLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GL+ IC +AC LALLVY I + RQ+ ++    E   S G S  S+S+RL+TFLSF DE
Sbjct  834  FWGLYVICGLACLLALLVYLIQIWRQYHKHYVSEELDSSDGQSLGSKSSRLKTFLSFADE  893

Query  209  KEETAKSRSIKRKQME  162
            KEET KSRS KR++ME
Sbjct  894  KEETVKSRS-KRRKME  908



>ref|XP_010063139.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Eucalyptus 
grandis]
Length=940

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 146/208 (70%), Gaps = 5/208 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  P+ Y KAL++GP  GGV A+VDE  Y+E+FLST C F IVG EF 
Sbjct  718  QELKISRSRLKPLGSPDAYAKALRDGPGKGGVAALVDELPYVEMFLSTQCSFRIVGPEFT  777

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL++++C S + ++E DRL LKS
Sbjct  778  KSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSCLSDSAEIESDRLHLKS  837

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL +YF+ +  Q    ++  E  P    SSRS  LQ FLS +DEKE
Sbjct  838  FWGLFLICGIACFVALFIYFLQILHQLC--TTPAESVPEGSSSSRSRHLQRFLSLMDEKE  895

Query  203  ET---AKSRSIKRKQMEGDSARSIDDDD  129
            +    +K R ++R   E D A + + D+
Sbjct  896  DPSKRSKRRKVERALSENDIAGNPERDN  923



>ref|XP_008452999.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Cucumis melo]
Length=918

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 150/206 (73%), Gaps = 5/206 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EEL I  SRL  L  PE+Y KAL+ GP K GGV A+VDE  Y+E FLS  C F +VGQEF
Sbjct  710  EELNISKSRLIPLGSPEEYAKALELGPDKEGGVAAIVDELLYVESFLSRQCSFRVVGQEF  769

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLAVD+STAIL+LSENG+LQRIHDKWL++SACT +N +LE DRL+LK
Sbjct  770  TKSGWGFAFPRDSPLAVDLSTAILQLSENGDLQRIHDKWLVKSACTMENAELESDRLQLK  829

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTP-SSGGSSRSARLQTFLSFVDE  210
            SF GLF IC + CF+AL +Y   + RQ   Y ++PE+   SS   S S RL+  +S +DE
Sbjct  830  SFWGLFLICGIVCFIALAIYCFQIIRQL--YHTEPEEPDLSSNSGSHSNRLRRIISLLDE  887

Query  209  KEETAKSRSIKRKQMEGDSARSIDDD  132
            K+E++K R  KR+++E  S    ++D
Sbjct  888  KKESSK-RGSKRRKVEKSSENDKNND  912



>ref|XP_003603849.1| Glutamate-gated kainate-type ion channel receptor subunit GluR5 
[Medicago truncatula]
 gb|AES74100.1| glutamate receptor 3.2 [Medicago truncatula]
Length=914

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 146/196 (74%), Gaps = 10/196 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E++GI  SRL  L  PE+Y KAL+ GP  GGV A+VDER Y+E+FLST C F IVGQEF 
Sbjct  708  EDIGISRSRLVPLGSPEEYAKALQLGPNKGGVAAIVDERPYVEIFLSTQCTFRIVGQEFT  767

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAIL+LSE G+LQRIHDKW+ RS C+  NT++E DRL+LKS
Sbjct  768  RSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCSLDNTEIESDRLQLKS  827

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACF+AL++YF+ +     R+S+ PE +PS+ G      LQ FLS +DEK+
Sbjct  828  FWGLFIICGAACFIALVIYFLQIM-LLVRHSTPPE-SPSNVGP-----LQRFLSLIDEKK  880

Query  203  ETAKSRSIKRKQMEGD  156
              ++S   +R++  GD
Sbjct  881  GPSRS---ERRKRNGD  893



>gb|KEH36346.1| glutamate receptor 3.2 [Medicago truncatula]
Length=959

 Score =   229 bits (583),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 146/196 (74%), Gaps = 10/196 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E++GI  SRL  L  PE+Y KAL+ GP  GGV A+VDER Y+E+FLST C F IVGQEF 
Sbjct  753  EDIGISRSRLVPLGSPEEYAKALQLGPNKGGVAAIVDERPYVEIFLSTQCTFRIVGQEFT  812

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAIL+LSE G+LQRIHDKW+ RS C+  NT++E DRL+LKS
Sbjct  813  RSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCSLDNTEIESDRLQLKS  872

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC  ACF+AL++YF+ +     R+S+ PE +PS+ G      LQ FLS +DEK+
Sbjct  873  FWGLFIICGAACFIALVIYFLQIML-LVRHSTPPE-SPSNVGP-----LQRFLSLIDEKK  925

Query  203  ETAKSRSIKRKQMEGD  156
              ++S   +R++  GD
Sbjct  926  GPSRS---ERRKRNGD  938



>ref|XP_002313575.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
 gb|EEE87530.2| Glutamate receptor 3.1 precursor family protein [Populus trichocarpa]
Length=900

 Score =   228 bits (582),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 141/191 (74%), Gaps = 7/191 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  +RL  L  PE+Y  ALKNG     V AVVDER Y++LFLS HCEFSI+GQEF 
Sbjct  705  EELSIAKTRLVPLGSPEEYADALKNGT----VAAVVDERPYVDLFLSEHCEFSIIGQEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLA+DMSTAIL+LSENGELQ IH+KWL R  C+SQ+     D+L+L+S
Sbjct  761  RSGWGFAFPRDSPLAIDMSTAILQLSENGELQNIHNKWLQRKLCSSQDIGSSADQLQLQS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS-SRSARLQTFLSFVDEK  207
            F GLF IC +AC LALL+YF    RQF+R+   PE++ SS  S SRS RLQTFLSF D+K
Sbjct  821  FWGLFLICGIACLLALLIYFCTTFRQFSRHF--PEESDSSVQSRSRSKRLQTFLSFADDK  878

Query  206  EETAKSRSIKR  174
             E  K  ++ R
Sbjct  879  VEQWKKSNVAR  889



>emb|CDP07274.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   228 bits (581),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL +L  PE+Y   L +GPK GGV AVVDE  Y+ELFLS+ C+F IVGQEF 
Sbjct  714  EEIGIPKSRLVSLGTPEEYATNLLSGPKKGGVAAVVDELPYVELFLSSQCKFRIVGQEFT  773

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DS LAVD+STAIL LSENG+LQRIHDKWL +S C+S N +++ DRL LKS
Sbjct  774  KSGWGFAFPRDSALAVDLSTAILALSENGDLQRIHDKWLTKSTCSSDNAEIDSDRLHLKS  833

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F+GLF +C + CF+ALL+YF+ +  +F   +          GSSRS  LQT LS +D K 
Sbjct  834  FSGLFLLCGITCFIALLIYFLQIMHKFREAARAGRIANEGPGSSRSRSLQTLLSLMDAKA  893

Query  203  ETAKSRSIKRKQMEGDSARSID  138
            + ++ R  KR+++E   +  ID
Sbjct  894  DPSR-RDSKRRKIEISLSDGID  914



>ref|XP_008803655.1| PREDICTED: glutamate receptor 3.5-like [Phoenix dactylifera]
Length=957

 Score =   228 bits (582),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 145/199 (73%), Gaps = 9/199 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PED+  AL+ GPKNGGV A+VDE  Y+E+FLS +C+F  VGQEF 
Sbjct  740  QELNIHESRLVPLNTPEDFASALERGPKNGGVSAIVDELPYVEIFLSNYCKFKTVGQEFT  799

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLAVD+STAIL LSE+G+LQRIHDKWL RS CTSQ+T ++ +RL L S
Sbjct  800  KNGWGFAFPRDSPLAVDLSTAILTLSESGDLQRIHDKWLTRSGCTSQDTGIDSNRLSLGS  859

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPE-QTPSSGGSSRS-------ARLQTF  228
            F GLF I  +AC  A++V+ + +  Q+++YSS  + + P S GSSR          L+  
Sbjct  860  FWGLFLISGLACLTAVMVFTMRILCQYSKYSSREDVECPESEGSSRRPASLTSLTSLRGL  919

Query  227  LSFVDEKEETAKSRSIKRK  171
            +SFVD+KEE  KS  IKRK
Sbjct  920  MSFVDKKEEEVKS-VIKRK  937



>ref|XP_009372603.1| PREDICTED: glutamate receptor 3.3-like [Pyrus x bretschneideri]
Length=936

 Score =   227 bits (579),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  +RL AL  P+ Y  AL+ GPK GGV AVVDER Y+ELFLS+ C+F +VG EF 
Sbjct  716  EELGIPKNRLIALGSPQAYALALQLGPKKGGVAAVVDERPYVELFLSSQCKFRVVGPEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL+LSENG+LQRIHDKWL++S+C    T+LE DRL LKS
Sbjct  776  KSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSCGLDTTELESDRLHLKS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC ++L +Y + +  +  R++   +   +S G+S+S RL+ FLS +DE++
Sbjct  836  FWGLFLICGIACSVSLFIYLLQVLNKL-RHAEVTQHISTSPGNSQSGRLKRFLSIIDERK  894

Query  203  ETAKSRSIKRKQMEGDSARSID  138
            + + S S ++K +   S    D
Sbjct  895  DQSNSGSKRKKIVRSFSGNVTD  916



>gb|KHG26328.1| Glutamate receptor 3.3 -like protein [Gossypium arboreum]
Length=909

 Score =   227 bits (578),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 140/192 (73%), Gaps = 4/192 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +L  PE Y  ALK GP NGGV AVVDER Y+ELFLS+ C F IVGQEF 
Sbjct  710  EELNISRSRLVSLGSPEAYALALKRGPGNGGVAAVVDERPYVELFLSSQCSFKIVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL L+ENG+LQRIHDKWL++S C+ ++T++E ++L L S
Sbjct  770  KSGWGFAFPRDSPLAIDMSTAILALAENGDLQRIHDKWLMQSTCSLESTEIETNQLNLSS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDEK  207
            F GLF IC VAC +AL +YF+ + +Q       PE    +G  SS S  L+ FLS +DEK
Sbjct  830  FWGLFLICGVACIIALFIYFLQILQQL---PPAPESASITGQDSSHSRPLRRFLSLMDEK  886

Query  206  EETAKSRSIKRK  171
            EE ++S   +RK
Sbjct  887  EEQSRSGQKRRK  898



>gb|KHN41809.1| Glutamate receptor 3.6 [Glycine soja]
Length=988

 Score =   227 bits (579),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/196 (61%), Positives = 153/196 (78%), Gaps = 3/196 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             E+GI+ SRL  L   E+  KAL+ GP+NGGV A +DERAY ++FLS+ C+ ++VGQEF 
Sbjct  764  HEIGINESRLVPLTTTEEAAKALRKGPENGGVAAYIDERAYTDIFLSSRCDLTVVGQEFT  823

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            +NGWGFAFP+DSPLAVD+STAIL++ ++G+LQRIHDKWLL SAC SQ  KLEV+RL+LKS
Sbjct  824  RNGWGFAFPRDSPLAVDLSTAILQMIDSGDLQRIHDKWLLSSACLSQGAKLEVERLQLKS  883

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GL+ IC +AC LALLVY I + RQ+ ++    E   S G S  S+S+RL+TFLSF DE
Sbjct  884  FWGLYVICGLACLLALLVYLIQIWRQYHKHYVSEELDSSDGQSLGSKSSRLKTFLSFADE  943

Query  209  KEETAKSRSIKRKQME  162
            KEET KSRS KR++ME
Sbjct  944  KEETVKSRS-KRRKME  958



>ref|XP_008392995.1| PREDICTED: glutamate receptor 3.6-like [Malus domestica]
Length=832

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 135/167 (81%), Gaps = 4/167 (2%)
 Frame = -2

Query  632  ERAYMELFLSTHCEFSIVGQEFQKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDK  453
            +RAY+ELFL++ CEFS+VGQEF K GWGFAFP+DSPLAVD+STAILKLSENG+LQRI+DK
Sbjct  645  QRAYIELFLASRCEFSVVGQEFTKTGWGFAFPRDSPLAVDLSTAILKLSENGDLQRIYDK  704

Query  452  WLLRSACTSQNTKLEVDRLELKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQT  273
            WL+R+ C S    L+VDRL++KSF GLF IC  ACFLAL +YF ++ RQF+R+ +   + 
Sbjct  705  WLIRTPCASNGGTLQVDRLKVKSFRGLFIICGAACFLALAIYFCIMLRQFSRHYT---EE  761

Query  272  PSSGGSSRSARLQTFLSFVDEKEETAKSRSIKRKQMEGDSARSIDDD  132
              S GSS SAR+QTFL+FVDEKEE  KSRS KR++ME  S RS DD+
Sbjct  762  LVSTGSSTSARVQTFLTFVDEKEEEVKSRS-KRRRMERLSNRSADDE  807



>ref|XP_002520606.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF41779.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=924

 Score =   226 bits (575),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 156/213 (73%), Gaps = 9/213 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  +RL AL  PE+Y  AL NG     V AVVDER Y++LFLS HC+FSI GQEF 
Sbjct  704  EELNIAKTRLVALGSPEEYASALANG----TVAAVVDERPYVDLFLSDHCQFSIRGQEFT  759

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL LSE G+LQ+IHDKWL R  C+SQ +    ++L+L+S
Sbjct  760  KSGWGFAFPRDSPLAMDISTAILTLSETGDLQKIHDKWLARKVCSSQISDSGSEQLQLQS  819

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLAL +YF ++ RQF+R++  PE +  S  SSRS R+QTFLSFVDEK 
Sbjct  820  FWGLFLICGIACFLALFIYFCMMLRQFSRHA--PEDSDPSIRSSRSRRIQTFLSFVDEKA  877

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            + +KS+S KRK+  GD +     +D  V+GS R
Sbjct  878  DESKSKS-KRKR--GDESIGYGKEDDSVDGSDR  907



>ref|XP_011034843.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Populus euphratica]
Length=951

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE+Y KALK GP  GGV A+VDER Y+ELFL+  C F IVG+EF 
Sbjct  731  EEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFLAGQCTFRIVGREFT  790

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP DSPLAVDMSTAIL LSENG+LQRIHDKWL++S C+S  ++LE D+L L+S
Sbjct  791  KSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSSDTSELEADKLYLRS  850

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +ACF++L+++ + + R F  Y++  E        SRS  ++  L+ +D+KE
Sbjct  851  FWGLFLLCGLACFISLVIHVLQIIRLF--YAAPAESASPGQCPSRSGCIRRLLTLMDQKE  908

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            +  K+ S KR+++E   +    D +S  N   + I R+
Sbjct  909  DPTKNAS-KRRKLETSLSGKDQDGESLRNPKRKEIERT  945



>ref|XP_011034842.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Populus euphratica]
Length=969

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE+Y KALK GP  GGV A+VDER Y+ELFL+  C F IVG+EF 
Sbjct  749  EEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFLAGQCTFRIVGREFT  808

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP DSPLAVDMSTAIL LSENG+LQRIHDKWL++S C+S  ++LE D+L L+S
Sbjct  809  KSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSSDTSELEADKLYLRS  868

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +ACF++L+++ + + R F  Y++  E        SRS  ++  L+ +D+KE
Sbjct  869  FWGLFLLCGLACFISLVIHVLQIIRLF--YAAPAESASPGQCPSRSGCIRRLLTLMDQKE  926

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            +  K+ S KR+++E   +    D +S  N   + I R+
Sbjct  927  DPTKNAS-KRRKLETSLSGKDQDGESLRNPKRKEIERT  963



>ref|XP_011034844.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
 ref|XP_011034845.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
Length=931

 Score =   225 bits (574),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 152/218 (70%), Gaps = 3/218 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE+Y KALK GP  GGV A+VDER Y+ELFL+  C F IVG+EF 
Sbjct  711  EEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFLAGQCTFRIVGREFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP DSPLAVDMSTAIL LSENG+LQRIHDKWL++S C+S  ++LE D+L L+S
Sbjct  771  KSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSSDTSELEADKLYLRS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +ACF++L+++ + + R F  Y++  E        SRS  ++  L+ +D+KE
Sbjct  831  FWGLFLLCGLACFISLVIHVLQIIRLF--YAAPAESASPGQCPSRSGCIRRLLTLMDQKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGRS  90
            +  K+ S KR+++E   +    D +S  N   + I R+
Sbjct  889  DPTKNAS-KRRKLETSLSGKDQDGESLRNPKRKEIERT  925



>ref|XP_002301908.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE81181.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=931

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 154/220 (70%), Gaps = 7/220 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+GI  SRL AL  PE+Y KAL+ GP  GGV A+VDER Y+ELFL+  C F IVG+EF 
Sbjct  711  EEIGISKSRLVALGSPEEYAKALQLGPGKGGVAAIVDERPYVELFLAGQCTFRIVGREFT  770

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTAIL LSENG+LQRIHDKWL++S C+S  ++LE D+L L+S
Sbjct  771  KSGWGFAFPRDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSSDTSELEADKLYLRS  830

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF +C +ACF++L++Y + + R F  Y++  E        SRS  ++  L+ +D+KE
Sbjct  831  FWGLFLLCGLACFISLVIYVLQIIRLF--YAAPAESASPGQCPSRSGCIRRLLTLMDQKE  888

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNG----SSRSIG  96
            +  K+ S KR+++E   +    D +S  N     + R+IG
Sbjct  889  DPTKNAS-KRRKLERSLSGKDQDGESLRNPKKKETERTIG  927



>ref|XP_004500849.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Cicer arietinum]
Length=871

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 144/196 (73%), Gaps = 10/196 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E++GI  SRL AL  PE+Y KAL+ GP  GGV A++DER Y+E+FLS  C F IVGQEF 
Sbjct  659  EDIGISKSRLVALGSPEEYAKALQLGPNKGGVAAIIDERPYVEIFLSAQCTFRIVGQEFT  718

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAIL+LSE G+LQRIHDKW+ RS C+  NT+++ DRL+LKS
Sbjct  719  RSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCSLDNTEIDSDRLQLKS  778

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+ALL+YF+ +     R  S P +  S+ G      +Q FLS VDEK+
Sbjct  779  FWGLFIICGLACFIALLIYFLQIMLLLWR--SAPSEPASNVGP-----MQRFLSLVDEKK  831

Query  203  ETAKSRSIKRKQMEGD  156
            + ++S   +R++  GD
Sbjct  832  DPSRS---ERRKRNGD  844



>ref|XP_011000874.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
 ref|XP_011000875.1| PREDICTED: glutamate receptor 3.2 [Populus euphratica]
Length=928

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 138/182 (76%), Gaps = 7/182 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  +RL AL  PE+Y  ALKNG     V AVVDER Y++LFLS HCEFSI+GQEF 
Sbjct  705  EELSIAKTRLVALGSPEEYADALKNGT----VAAVVDERPYVDLFLSEHCEFSIIGQEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLA+DMS AIL+LSENGELQ+IH+KWL R  C+SQ+     D+L+L+S
Sbjct  761  RSGWGFAFPRDSPLAIDMSNAILQLSENGELQKIHNKWLQRKLCSSQDIGSSADQLQLQS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS-SRSARLQTFLSFVDEK  207
            F GLF IC +AC LALL+YF    RQF+R+   PE++ SS  S SRS RLQTFLSF D+K
Sbjct  821  FWGLFLICGIACILALLIYFCTTFRQFSRHF--PEESDSSVRSCSRSKRLQTFLSFADDK  878

Query  206  EE  201
             E
Sbjct  879  VE  880



>ref|XP_004500848.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Cicer arietinum]
Length=935

 Score =   225 bits (573),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 144/196 (73%), Gaps = 10/196 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E++GI  SRL AL  PE+Y KAL+ GP  GGV A++DER Y+E+FLS  C F IVGQEF 
Sbjct  723  EDIGISKSRLVALGSPEEYAKALQLGPNKGGVAAIIDERPYVEIFLSAQCTFRIVGQEFT  782

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAIL+LSE G+LQRIHDKW+ RS C+  NT+++ DRL+LKS
Sbjct  783  RSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCSLDNTEIDSDRLQLKS  842

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+ALL+YF+ +     R  S P +  S+ G      +Q FLS VDEK+
Sbjct  843  FWGLFIICGLACFIALLIYFLQIMLLLWR--SAPSEPASNVGP-----MQRFLSLVDEKK  895

Query  203  ETAKSRSIKRKQMEGD  156
            + ++S   +R++  GD
Sbjct  896  DPSRS---ERRKRNGD  908



>gb|KJB47169.1| hypothetical protein B456_008G013900 [Gossypium raimondii]
Length=838

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 5/211 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE+Y  AL+   +N  V AV+DER Y++LFLS HCEFS+ GQEF 
Sbjct  618  EELNIPKSRLVPLGSPEEYALALER--RN--VAAVIDERPYVDLFLSEHCEFSVRGQEFT  673

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQ+IHD+WL +SAC+S+N++ ++++L+LKS
Sbjct  674  KSGWGFAFPRDSPLAIDMSTAILSLSENGELQKIHDRWLSKSACSSENSEDDIEQLDLKS  733

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LALLVYF L+ R+F+R   + E   +S  +SRS RLQTFLSFVDEK 
Sbjct  734  FWGLFVICGIACMLALLVYFWLMFRKFSRLPPE-ELDTTSPSTSRSTRLQTFLSFVDEKV  792

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGS  111
            E  KS S ++++        I+D+  + +GS
Sbjct  793  EKPKSSSKRKRESMSRIGYHINDESPHRSGS  823



>ref|XP_009417233.1| PREDICTED: glutamate receptor 3.4-like [Musa acuminata subsp. 
malaccensis]
Length=931

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 146/197 (74%), Gaps = 10/197 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +LN PE Y +AL+ GPKNGGV A+VDE  Y+E+FLS +C+++ VGQEF 
Sbjct  717  EELNIAESRLISLNNPEAYARALELGPKNGGVAAIVDELPYIEIFLSNNCKYTTVGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL LSENG+LQRIHDKWL R+ C+SQ+ +++ +RL L S
Sbjct  777  KSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLARTGCSSQDNEIDSNRLSLGS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSS-------DPEQTPSSGGSSRSARLQTFL  225
            F GLF IC +AC LAL+V+F+ +  Q++RYSS       DPE+  S     R   ++  +
Sbjct  837  FWGLFLICGLACLLALIVFFMRIFCQYSRYSSQDDVGSIDPER--SFRRPMRLTSIKDLI  894

Query  224  SFVDEKEETAKSRSIKR  174
            SFVD+KEE  K  +IKR
Sbjct  895  SFVDKKEEEVKC-AIKR  910



>gb|KJB47170.1| hypothetical protein B456_008G013900 [Gossypium raimondii]
 gb|KJB47171.1| hypothetical protein B456_008G013900 [Gossypium raimondii]
Length=925

 Score =   224 bits (571),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 157/211 (74%), Gaps = 5/211 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE+Y  AL+   +N  V AV+DER Y++LFLS HCEFS+ GQEF 
Sbjct  705  EELNIPKSRLVPLGSPEEYALALER--RN--VAAVIDERPYVDLFLSEHCEFSVRGQEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQ+IHD+WL +SAC+S+N++ ++++L+LKS
Sbjct  761  KSGWGFAFPRDSPLAIDMSTAILSLSENGELQKIHDRWLSKSACSSENSEDDIEQLDLKS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LALLVYF L+ R+F+R   + E   +S  +SRS RLQTFLSFVDEK 
Sbjct  821  FWGLFVICGIACMLALLVYFWLMFRKFSRLPPE-ELDTTSPSTSRSTRLQTFLSFVDEKV  879

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGS  111
            E  KS S ++++        I+D+  + +GS
Sbjct  880  EKPKSSSKRKRESMSRIGYHINDESPHRSGS  910



>ref|XP_006577929.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
Length=925

 Score =   224 bits (571),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            ++LGI  SRL  L  PE+Y KAL+ GPK GGV A+VDER Y+E+FLS+ C F IVGQEF 
Sbjct  713  QDLGIAKSRLIPLGSPEEYAKALQLGPKRGGVAAIVDERPYVEIFLSSQCTFRIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKW+ RS+C+ +N +++ DRL+LKS
Sbjct  773  RSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCSLENAEIDSDRLQLKS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL+++F+ L  Q  +       + +   SS S R Q FL+ +DEKE
Sbjct  833  FWGLFLICGIACFIALVLHFMQLMFQLWQSPPSEPASSA---SSISGRFQRFLTLIDEKE  889

Query  203  ETAKSRSIKRKQMEGDSARSIDD  135
            + +KS+  KR    GD  RS++D
Sbjct  890  DPSKSKGRKR---NGDE-RSLED  908



>gb|EYU41186.1| hypothetical protein MIMGU_mgv1a000937mg [Erythranthe guttata]
Length=938

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 152/209 (73%), Gaps = 3/209 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E +GI  SRL  L  PE Y +AL+ GP+ GGV AVVDER Y+ELFL++ C+F I+GQEF 
Sbjct  716  EGIGIPQSRLVPLGGPEAYAEALQLGPEKGGVAAVVDERPYIELFLASQCKFRIIGQEFT  775

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+D+STAIL LSENG+LQRIHDKWL  S C+S NT+LE DRL LKS
Sbjct  776  KSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLTMSTCSSDNTELESDRLHLKS  835

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD--PEQTPSSGGSSRSARLQTFLSFVDE  210
            F GL+ +C +ACF+ALL+Y   +  +F   +++        SGG SRS RLQT LS +DE
Sbjct  836  FWGLYLLCGIACFIALLIYVFQIFHRFRHAATEDYSPDGGPSGGGSRSKRLQTLLSLIDE  895

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSY  123
            KE+ +K R  KR+++E ++   +D   S+
Sbjct  896  KEDLSK-RDRKRRKIEKENDLEMDSKRSH  923



>gb|KHG21169.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=925

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 157/210 (75%), Gaps = 5/210 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE+Y  AL+   +N  V AV+DER Y++LFLS HCEFS+ GQEF 
Sbjct  705  EELNIPKSRLVPLGSPEEYALALER--RN--VAAVIDERPYVDLFLSEHCEFSVRGQEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQ+IHD+WL +SAC+S+N++ ++++L+LKS
Sbjct  761  KSGWGFAFPRDSPLAIDMSTAILSLSENGELQKIHDRWLSKSACSSENSEDDIEQLDLKS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LALLVYF L+ R+F+R   + E   +S  +SRS RLQTFLSFVDEK 
Sbjct  821  FWGLFVICGIACMLALLVYFWLMFRKFSRLPPE-ELDTTSPSTSRSTRLQTFLSFVDEKV  879

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNG  114
            E  KS S ++++    +   I+D+  + +G
Sbjct  880  EKPKSSSKRKRESMSRNGYHINDESPHRSG  909



>ref|XP_006855692.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
 gb|ERN17159.1| hypothetical protein AMTR_s00044p00137040 [Amborella trichopoda]
Length=936

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 158/236 (67%), Gaps = 15/236 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELG+  SRL  L+  + Y KAL +GP NGGV AVVDE  Y++LFLS +C+F I G++F 
Sbjct  712  EELGVPWSRLVPLDSAQAYAKALTDGPNNGGVAAVVDELPYVDLFLSQYCKFKIAGKQFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGF F +DSPLAVDMSTAILKLSE+G+LQRIHDKW  R  C+SQ+T +E ++L L+S
Sbjct  772  KSGWGFVFQRDSPLAVDMSTAILKLSESGDLQRIHDKWFARLGCSSQDTDIESNQLRLRS  831

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF ICAVA  +AL V+ + +  QF+RY   P    +   SS S R+QTFL F+DE+E
Sbjct  832  FWGLFLICAVASLVALAVFLLHMLYQFSRYGP-PMNELARPQSSPSGRIQTFLWFMDERE  890

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR---SIGRSQVFSNRA*SLGNSQS  45
            E+++ RS KR   E          DS +  S+R   S GRS+       S+GN+ S
Sbjct  891  ESSRGRS-KRTHTE----------DSSIGNSTREQASQGRSKTTHTGDTSIGNNIS  935



>gb|KHN33784.1| Glutamate receptor 3.3 [Glycine soja]
Length=882

 Score =   223 bits (567),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 150/203 (74%), Gaps = 7/203 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            ++LGI  SRL  L  PE+Y KAL+ GPK GGV A+VDER Y+E+FLS+ C F IVGQEF 
Sbjct  670  QDLGIAKSRLIPLGSPEEYAKALQLGPKRGGVAAIVDERPYVEIFLSSQCTFRIVGQEFT  729

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVD+STAIL+LSE G+LQRIHDKW+ RS+C+ +N +++ DRL+LKS
Sbjct  730  RSGWGFAFPRDSPLAVDISTAILQLSETGDLQRIHDKWMTRSSCSLENAEIDSDRLQLKS  789

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL+++F+ L  Q  +       + +   SS S R Q FL+ +DEKE
Sbjct  790  FWGLFLICGIACFIALVLHFMQLMFQLWQSPPSEPASSA---SSISGRFQRFLTLIDEKE  846

Query  203  ETAKSRSIKRKQMEGDSARSIDD  135
            + +KS+  KR    GD  RS++D
Sbjct  847  DPSKSKGRKR---NGDE-RSLED  865



>gb|KDP43780.1| hypothetical protein JCGZ_22407 [Jatropha curcas]
Length=919

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             E  I  SRL  LN  ED V+ALK+GP+ GGV AVVDERAY+ELFLS+ CEFSIVGQEF 
Sbjct  701  NEYQISRSRLVPLNSAEDCVRALKDGPQKGGVAAVVDERAYIELFLSSQCEFSIVGQEFS  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAFP+DSPLA+DMS AILKLSE G+LQR+HDKWLL SAC S+  K + +RL L S
Sbjct  761  KNGWGFAFPRDSPLALDMSNAILKLSEGGDLQRMHDKWLLGSACRSEGAKEDANRLHLTS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +  FLALL+Y I + R F ++ S+ +   SS   +R A  QTFL+FVD+KE
Sbjct  821  FWGLFLICGLTLFLALLLYVIKMVRLFLKHCSE-DHGGSSIQGTRHANFQTFLAFVDKKE  879

Query  203  ETAKSRSIKRKQMEGDSARSIDDD  132
               KS S +R+  +  S R +D +
Sbjct  880  VEMKSTSKRRRIDQRASNRVMDGN  903



>gb|KHN46864.1| Glutamate receptor 3.2 [Glycine soja]
Length=809

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 9/202 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E+L I   RL  L  PE+Y  AL++G     V AVVDER Y+ELFLS HC+FSI GQEF 
Sbjct  603  EQLNIPKHRLVPLGSPEEYAVALESG----TVAAVVDERPYVELFLSNHCQFSIRGQEFT  658

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIH+KWL   AC   +T  E ++L+L S
Sbjct  659  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKACGFHST--EDEQLKLNS  716

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQT-PSSGGSSRSARLQTFLSFVDEK  207
            F GLF IC + CFLALL+YF+ + RQF + S  P++  PS+  SSRSAR+QTFL FVDEK
Sbjct  717  FRGLFLICGITCFLALLIYFLSMVRQFNKKS--PQKVGPSNRCSSRSARIQTFLHFVDEK  774

Query  206  EETAKSRSIKRKQMEGDSARSI  141
            E+ +     K   +  +  RSI
Sbjct  775  EDVSPKLKRKLDYISSNRLRSI  796



>ref|XP_003545055.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Glycine max]
Length=915

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 9/202 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E+L I   RL  L  PE+Y  AL++G     V AVVDER Y+ELFLS HC+FSI GQEF 
Sbjct  709  EQLNIPKHRLVPLGSPEEYAVALESGT----VAAVVDERPYVELFLSNHCQFSIRGQEFT  764

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIH+KWL   AC   +T  E ++L+L S
Sbjct  765  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKACGFHST--EDEQLKLNS  822

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQT-PSSGGSSRSARLQTFLSFVDEK  207
            F GLF IC + CFLALL+YF+ + RQF + S  P++  PS+  SSRSAR+QTFL FVDEK
Sbjct  823  FRGLFLICGITCFLALLIYFLSMVRQFNKKS--PQKVGPSNRCSSRSARIQTFLHFVDEK  880

Query  206  EETAKSRSIKRKQMEGDSARSI  141
            E+ +     K   +  +  RSI
Sbjct  881  EDVSPKLKRKLDYISSNRLRSI  902



>ref|XP_006595634.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Glycine max]
Length=909

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 143/202 (71%), Gaps = 9/202 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E+L I   RL  L  PE+Y  AL++G     V AVVDER Y+ELFLS HC+FSI GQEF 
Sbjct  703  EQLNIPKHRLVPLGSPEEYAVALESGT----VAAVVDERPYVELFLSNHCQFSIRGQEFT  758

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIH+KWL   AC   +T  E ++L+L S
Sbjct  759  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHEKWLSEKACGFHST--EDEQLKLNS  816

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQT-PSSGGSSRSARLQTFLSFVDEK  207
            F GLF IC + CFLALL+YF+ + RQF + S  P++  PS+  SSRSAR+QTFL FVDEK
Sbjct  817  FRGLFLICGITCFLALLIYFLSMVRQFNKKS--PQKVGPSNRCSSRSARIQTFLHFVDEK  874

Query  206  EETAKSRSIKRKQMEGDSARSI  141
            E+ +     K   +  +  RSI
Sbjct  875  EDVSPKLKRKLDYISSNRLRSI  896



>ref|XP_011087613.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Sesamum indicum]
Length=930

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/199 (59%), Positives = 140/199 (70%), Gaps = 7/199 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL +  SRL  L  PEDY  ALK G     V AVVDER Y++LFLS +C F  VGQEF 
Sbjct  706  EELSVPKSRLVPLGSPEDYADALKTG----RVAAVVDERPYIDLFLSYYCTFQAVGQEFT  761

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQ+IHDKWL   AC   +   +V++L LKS
Sbjct  762  KSGWGFAFPRDSPLAMDMSTAILTLSENGELQKIHDKWLNTRACWPASAG-DVEQLNLKS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC +ALL+YF  + ++F +Y     Q PS   SSRS R+Q FLSF DEKE
Sbjct  821  FWGLFLICGIACLIALLLYFCSIIQKFKQYFRQQPQ-PSLQSSSRSIRIQRFLSFADEKE  879

Query  203  ETAKSRSIKRKQMEGDSAR  147
              ++SRS KRKQME  S R
Sbjct  880  GESRSRS-KRKQMEALSGR  897



>ref|XP_004952127.1| PREDICTED: glutamate receptor 3.1-like isoform X3 [Setaria italica]
Length=934

 Score =   221 bits (562),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%), Gaps = 3/190 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  P++Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F 
Sbjct  712  KELNISRSRLKALGSPDEYAENLKQGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL VD+STAIL LSENGELQRIHDKWL  S C++ NT+ ++ ++L L+
Sbjct  772  SRGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLRTSDCSADNTEFVDSNQLRLE  831

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+YF ++ R++ R+   PE   + GGSS+S R L+ F SFVD+
Sbjct  832  SFMGLFLICGAACVLALLIYFGIMLRRYLRHEP-PESISAEGGSSKSKRSLKRFFSFVDD  890

Query  209  KEETAKSRSI  180
            +E   + RS+
Sbjct  891  REPPKQKRSL  900



>ref|XP_004952125.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Setaria italica]
 ref|XP_004952126.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Setaria italica]
Length=965

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%), Gaps = 3/190 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  P++Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F 
Sbjct  743  KELNISRSRLKALGSPDEYAENLKQGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFT  802

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL VD+STAIL LSENGELQRIHDKWL  S C++ NT+ ++ ++L L+
Sbjct  803  SRGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLRTSDCSADNTEFVDSNQLRLE  862

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+YF ++ R++ R+   PE   + GGSS+S R L+ F SFVD+
Sbjct  863  SFMGLFLICGAACVLALLIYFGIMLRRYLRHEP-PESISAEGGSSKSKRSLKRFFSFVDD  921

Query  209  KEETAKSRSI  180
            +E   + RS+
Sbjct  922  REPPKQKRSL  931



>ref|XP_007043075.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
 gb|EOX98906.1| Glutamate receptor 2 isoform 1 [Theobroma cacao]
Length=944

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 5/192 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +L  PE+Y  AL++      V A++DER Y++LFLS HC+FSI GQEF 
Sbjct  721  EELNIPKSRLVSLGTPEEYAHALQSR----RVAAIIDERPYVDLFLSDHCKFSIRGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFPKDSPLA+DMSTAIL LSENGELQ+IHD+WL R AC+S +++ E ++L+L+S
Sbjct  777  KSGWGFAFPKDSPLAIDMSTAILALSENGELQKIHDRWLSRKACSSDSSEAESEQLDLQS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LALL+YF L+ RQF+R+  + E   +S  SSRSARLQTFLSF D K 
Sbjct  837  FWGLFLICGIACVLALLMYFSLMFRQFSRHCPE-EPDSTSPVSSRSARLQTFLSFADGKV  895

Query  203  ETAKSRSIKRKQ  168
            E  KS S ++++
Sbjct  896  EKPKSSSKRKRE  907



>ref|XP_002279899.1| PREDICTED: glutamate receptor 3.2 [Vitis vinifera]
Length=917

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 159/215 (74%), Gaps = 11/215 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y  AL+NG     V AVVDER Y+E+FL++HC+FSIVG +F 
Sbjct  704  DELDIPKSRLIALGSPEEYATALENGT----VAAVVDERPYIEVFLASHCKFSIVGPQFT  759

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DS L VD+STAIL LSENG+LQRIHDKWL    C S N++L  D+L+ +S
Sbjct  760  RSGWGFAFPRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC-SDNSQLGSDQLQFQS  818

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALLVYF ++ RQF++  S  E +PSS GSS SARLQTFLSFVD K 
Sbjct  819  FWGLFLICGIACFLALLVYFCMMVRQFSKQFS--EASPSSHGSSLSARLQTFLSFVDNKA  876

Query  203  ETAKSRSIKRKQMEGD-SARSIDDDDSYVNGSSRS  102
            E +K++S KRK+  GD S  S   +D   NGS+R+
Sbjct  877  EVSKAKS-KRKR--GDMSLDSNGREDKSRNGSTRT  908



>ref|XP_007043076.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
 gb|EOX98907.1| Glutamate receptor 2 isoform 2 [Theobroma cacao]
Length=940

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 146/192 (76%), Gaps = 5/192 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +L  PE+Y  AL++      V A++DER Y++LFLS HC+FSI GQEF 
Sbjct  717  EELNIPKSRLVSLGTPEEYAHALQSR----RVAAIIDERPYVDLFLSDHCKFSIRGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFPKDSPLA+DMSTAIL LSENGELQ+IHD+WL R AC+S +++ E ++L+L+S
Sbjct  773  KSGWGFAFPKDSPLAIDMSTAILALSENGELQKIHDRWLSRKACSSDSSEAESEQLDLQS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LALL+YF L+ RQF+R+  + E   +S  SSRSARLQTFLSF D K 
Sbjct  833  FWGLFLICGIACVLALLMYFSLMFRQFSRHCPE-EPDSTSPVSSRSARLQTFLSFADGKV  891

Query  203  ETAKSRSIKRKQ  168
            E  KS S ++++
Sbjct  892  EKPKSSSKRKRE  903



>gb|EEE56178.1| hypothetical protein OsJ_05129 [Oryza sativa Japonica Group]
Length=870

 Score =   219 bits (559),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 137/201 (68%), Gaps = 14/201 (7%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL I  SRL AL  PE+Y +ALK+GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F  
Sbjct  639  ELNISRSRLRALGSPEEYAEALKHGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFTS  698

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELKS  384
             GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL  S C++ NT+ ++ D+L L+S
Sbjct  699  RGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSECSADNTEFVDSDQLRLES  758

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSS-------------RSA  243
            F GLF IC +AC +ALL+YF    R+F R+    + TP  GGS+                
Sbjct  759  FWGLFLICGIACVIALLIYFFTTVRKFLRHEPPEDPTPRPGGSTTLPDERTPPKNGQEKC  818

Query  242  RLQTFLSFVDEKEETAKSRSI  180
              + F+SF+D KE   K RS+
Sbjct  819  NCRNFISFLDHKEPPKKKRSL  839



>gb|KHG05232.1| Glutamate receptor 3.2 -like protein [Gossypium arboreum]
Length=905

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 144/198 (73%), Gaps = 8/198 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL  L  PEDY  AL+       V AVVDER Y++LFLS  CEFSI GQEF 
Sbjct  713  EELGIPKSRLVQLGSPEDYAHALEKR----QVAAVVDERPYVDLFLSDRCEFSIRGQEFS  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K  WGFAFP+DSPLA+DMSTAIL LSENGELQ+IHDKWL RSAC+S+ ++ E ++L+L+S
Sbjct  769  KRAWGFAFPRDSPLAIDMSTAILALSENGELQKIHDKWLSRSACSSEKSEDEAEQLDLQS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDEK  207
            F GLF IC +AC LALLVY +L+ RQ++R S  PE+  S+   +S SARL+T LSF+D K
Sbjct  829  FWGLFLICGIACILALLVYSLLMFRQYSRRS--PEELDSTNRNNSFSARLRTCLSFIDGK  886

Query  206  EETAKSRSI-KRKQMEGD  156
             E +KS S  KR  M  D
Sbjct  887  VENSKSSSKRKRDSMHSD  904



>ref|NP_001045687.1| Os02g0117500 [Oryza sativa Japonica Group]
 dbj|BAD07727.1| putative glutamate receptor [Oryza sativa Japonica Group]
 dbj|BAF07601.1| Os02g0117500 [Oryza sativa Japonica Group]
Length=944

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 137/201 (68%), Gaps = 14/201 (7%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL I  SRL AL  PE+Y +ALK+GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F  
Sbjct  713  ELNISRSRLRALGSPEEYAEALKHGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFTS  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELKS  384
             GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL  S C++ NT+ ++ D+L L+S
Sbjct  773  RGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSECSADNTEFVDSDQLRLES  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSS-------------RSA  243
            F GLF IC +AC +ALL+YF    R+F R+    + TP  GGS+                
Sbjct  833  FWGLFLICGIACVIALLIYFFTTVRKFLRHEPPEDPTPRPGGSTTLPDERTPPKNGQEKC  892

Query  242  RLQTFLSFVDEKEETAKSRSI  180
              + F+SF+D KE   K RS+
Sbjct  893  NCRNFISFLDHKEPPKKKRSL  913



>ref|XP_003527293.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006581132.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006581133.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
Length=929

 Score =   219 bits (558),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 7/203 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            ++LGI  SRL  L  PE+Y  AL+ GPK GGV A+VDER Y+E+FLS+ C F IVGQEF 
Sbjct  713  QDLGIAKSRLIPLGSPEEYANALQLGPKRGGVAAIVDERPYVEIFLSSQCTFRIVGQEFT  772

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAFP+DSPLAVDMSTAIL+LSE G+LQRIHDKW+ RS+C+ +N +++ DRL+LKS
Sbjct  773  RSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCSLENAEIDSDRLQLKS  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACF+AL+++F+ L  Q  +       + +   SS S R   FL+ +DEKE
Sbjct  833  FWGLFLICGIACFIALVLHFLQLMFQLRQSPPSEPASSA---SSISGRFHRFLTLIDEKE  889

Query  203  ETAKSRSIKRKQMEGDSARSIDD  135
            + +K +  KR    GD  RS++D
Sbjct  890  DPSKRKGRKRN---GDE-RSLED  908



>ref|XP_010270511.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=774

 Score =   218 bits (554),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            E+LGI  SRL  L   E+Y  AL+ GP K GGV AVVDE  Y+ LFLSTHC+F IVGQ F
Sbjct  554  EQLGISKSRLLPLGSAEEYALALERGPGKGGGVAAVVDEFPYVNLFLSTHCKFRIVGQPF  613

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAF +DSPLAVD+STAIL+LSENG+LQRI+DKWL RS C+   T+ E +RL LK
Sbjct  614  TKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSICSLVVTEFEANRLHLK  673

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            SF GLF +C +A FLAL++Y +L+ R+F RY   PE++ S+G G SR   L  F+SF+++
Sbjct  674  SFRGLFIMCGLAFFLALVIYCLLIIRKFIRY--HPEESDSTGQGGSRYRLLFKFISFLNK  731

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRS  102
            KE+ +++R  KR+Q +  S    D++D +     R+
Sbjct  732  KEDRSETRP-KRRQSDETSTDDDDNEDEFGRNPKRT  766



>ref|XP_010270510.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=852

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            E+LGI  SRL  L   E+Y  AL+ GP K GGV AVVDE  Y+ LFLSTHC+F IVGQ F
Sbjct  632  EQLGISKSRLLPLGSAEEYALALERGPGKGGGVAAVVDEFPYVNLFLSTHCKFRIVGQPF  691

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAF +DSPLAVD+STAIL+LSENG+LQRI+DKWL RS C+   T+ E +RL LK
Sbjct  692  TKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSICSLVVTEFEANRLHLK  751

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            SF GLF +C +A FLAL++Y +L+ R+F RY   PE++ S+G G SR   L  F+SF+++
Sbjct  752  SFRGLFIMCGLAFFLALVIYCLLIIRKFIRY--HPEESDSTGQGGSRYRLLFKFISFLNK  809

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRS  102
            KE+ +++R  KR+Q +  S    D++D +     R+
Sbjct  810  KEDRSETRP-KRRQSDETSTDDDDNEDEFGRNPKRT  844



>ref|XP_010270508.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=897

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            E+LGI  SRL  L   E+Y  AL+ GP K GGV AVVDE  Y+ LFLSTHC+F IVGQ F
Sbjct  677  EQLGISKSRLLPLGSAEEYALALERGPGKGGGVAAVVDEFPYVNLFLSTHCKFRIVGQPF  736

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAF +DSPLAVD+STAIL+LSENG+LQRI+DKWL RS C+   T+ E +RL LK
Sbjct  737  TKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSICSLVVTEFEANRLHLK  796

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            SF GLF +C +A FLAL++Y +L+ R+F RY   PE++ S+G G SR   L  F+SF+++
Sbjct  797  SFRGLFIMCGLAFFLALVIYCLLIIRKFIRY--HPEESDSTGQGGSRYRLLFKFISFLNK  854

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRS  102
            KE+ +++R  KR+Q +  S    D++D +     R+
Sbjct  855  KEDRSETRP-KRRQSDETSTDDDDNEDEFGRNPKRT  889



>emb|CBI37733.3| unnamed protein product [Vitis vinifera]
Length=1147

 Score =   220 bits (560),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 159/215 (74%), Gaps = 11/215 (5%)
 Frame = -2

Query  743   EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
             +EL I  SRL AL  PE+Y  AL+NG     V AVVDER Y+E+FL++HC+FSIVG +F 
Sbjct  934   DELDIPKSRLIALGSPEEYATALENGT----VAAVVDERPYIEVFLASHCKFSIVGPQFT  989

Query  563   KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
             ++GWGFAFP+DS L VD+STAIL LSENG+LQRIHDKWL    C S N++L  D+L+ +S
Sbjct  990   RSGWGFAFPRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC-SDNSQLGSDQLQFQS  1048

Query  383   FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
             F GLF IC +ACFLALLVYF ++ RQF++  S  E +PSS GSS SARLQTFLSFVD K 
Sbjct  1049  FWGLFLICGIACFLALLVYFCMMVRQFSKQFS--EASPSSHGSSLSARLQTFLSFVDNKA  1106

Query  203   ETAKSRSIKRKQMEGD-SARSIDDDDSYVNGSSRS  102
             E +K++S KRK+  GD S  S   +D   NGS+R+
Sbjct  1107  EVSKAKS-KRKR--GDMSLDSNGREDKSRNGSTRT  1138



>ref|XP_010270507.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera]
Length=938

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/216 (54%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            E+LGI  SRL  L   E+Y  AL+ GP K GGV AVVDE  Y+ LFLSTHC+F IVGQ F
Sbjct  718  EQLGISKSRLLPLGSAEEYALALERGPGKGGGVAAVVDEFPYVNLFLSTHCKFRIVGQPF  777

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAF +DSPLAVD+STAIL+LSENG+LQRI+DKWL RS C+   T+ E +RL LK
Sbjct  778  TKSGWGFAFRRDSPLAVDLSTAILRLSENGDLQRIYDKWLKRSICSLVVTEFEANRLHLK  837

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSG-GSSRSARLQTFLSFVDE  210
            SF GLF +C +A FLAL++Y +L+ R+F RY   PE++ S+G G SR   L  F+SF+++
Sbjct  838  SFRGLFIMCGLAFFLALVIYCLLIIRKFIRY--HPEESDSTGQGGSRYRLLFKFISFLNK  895

Query  209  KEETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRS  102
            KE+ +++R  KR+Q +  S    D++D +     R+
Sbjct  896  KEDRSETRP-KRRQSDETSTDDDDNEDEFGRNPKRT  930



>emb|CDX75491.1| BnaA01g02110D [Brassica napus]
Length=204

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 11/206 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  P++Y  AL+NG     V A+VDER Y++LFLS  C F+I GQEF 
Sbjct  3    DELNIARSRLVALGSPKEYATALQNGT----VAAIVDERPYVDLFLSEFCGFAIRGQEFT  58

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVD---RLE  393
            ++GWGFAFP+DSPLAVDMSTAIL LSE G+LQ+IHDKWL +S C++ N     D   +L+
Sbjct  59   RSGWGFAFPRDSPLAVDMSTAILGLSEAGKLQKIHDKWLSKSNCSNVNGSASDDDPEQLK  118

Query  392  LKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQ---TPSSGGSSRSARLQTFLS  222
            L+SF GLF +C +ACF+AL +YF ++ R F  +   PE+   T  S   SRS  LQTFL+
Sbjct  119  LRSFWGLFLLCGIACFIALFIYFFMIVRDFCNHHKKPEEEEATVPSPEVSRSKTLQTFLA  178

Query  221  FVDEKEETAKSRSIKRKQMEGDSARS  144
            + DEKE  + SR +KRK+ +  S +S
Sbjct  179  YFDEKEAES-SRRLKRKRNDDLSLKS  203



>ref|XP_010907850.1| PREDICTED: glutamate receptor 3.4-like [Elaeis guineensis]
Length=932

 Score =   217 bits (553),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 140/199 (70%), Gaps = 9/199 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I PSRL  LN PE+Y +AL+ GPK GGV A+VDE  Y+++FLS +C+F IVGQEF 
Sbjct  724  EELNIAPSRLVPLNSPEEYARALELGPKGGGVAAIVDEVPYVDIFLSMYCQFKIVGQEFT  783

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGF F K+SPLA D+STAIL LSENG+LQRIHDKWL    CT Q T+++ +RL L+S
Sbjct  784  KNGWGFVFQKNSPLAEDLSTAILTLSENGDLQRIHDKWLAHKGCTLQATEMDTNRLSLQS  843

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSS--DPEQTPSSGGSSRSARLQTF------  228
            F GLF IC + CF+ALLV+F  +  Q+++Y+S  D +   +     R A L +F      
Sbjct  844  FWGLFLICGLVCFIALLVFFTRICCQYSQYNSTADEKSNETQTCDERQASLSSFNSFKDL  903

Query  227  LSFVDEKEETAKSRSIKRK  171
            + FVD+KEE   S +I+RK
Sbjct  904  IHFVDKKEEEVMS-AIRRK  921



>ref|XP_010270512.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
 ref|XP_010270513.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Nelumbo nucifera]
Length=924

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 149/224 (67%), Gaps = 27/224 (12%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE Y  AL+ G     V AVVDER+Y+ELFLS  C+FSIVG+EF 
Sbjct  705  EELNIPKSRLVALGSPEQYAIALEKG----KVAAVVDERSYVELFLSNQCKFSIVGEEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPL +DMSTAIL LSENG+LQRIHDKWL R  C SQ+T+LE +RL L+S
Sbjct  761  KSGWGFAFPRDSPLPIDMSTAILTLSENGDLQRIHDKWLSRKTC-SQSTELEPNRLHLRS  819

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK-  207
            F GLF IC +ACFLAL +YFI + RQF++   + E   SS  SSRS RL +FL+FVD K 
Sbjct  820  FWGLFLICGIACFLALFIYFISVVRQFSQ-EFNSEADSSSHASSRSRRLHSFLAFVDGKV  878

Query  206  --------------------EETAKSRSIKRKQMEGDSARSIDD  135
                                EE  + R  KRKQME  +  S+DD
Sbjct  879  DESRSKSKTKLTENSPNTIVEEDEQRRGYKRKQMEASANSSVDD  922



>gb|EYU33298.1| hypothetical protein MIMGU_mgv1a001051mg [Erythranthe guttata]
Length=904

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 141/195 (72%), Gaps = 7/195 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE+Y  AL  G     V A+VDER Y++LFLS +C F  VG+EF 
Sbjct  689  EELNIPKSRLVPLGSPEEYADALDRG----RVAAIVDERPYVDLFLSNYCMFQAVGREFT  744

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGEL++IHDKWL  S C   ++K + D+L+LKS
Sbjct  745  KSGWGFAFPRDSPLAMDMSTAILALSENGELEKIHDKWLKTSDCGQTSSK-DSDQLQLKS  803

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTR-YSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            F GLF +C +ACFLALLVYF L+ R+FTR +    E  PS    S+S R++ FLSFVDEK
Sbjct  804  FWGLFLMCGIACFLALLVYFCLMLRKFTRHFPQQSENDPSIKRGSKSIRIKRFLSFVDEK  863

Query  206  EETAKSRSIKRKQME  162
            EE  K++ +KRK ++
Sbjct  864  EEELKNK-LKRKHID  877



>ref|XP_008645171.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.1-like [Zea 
mays]
Length=926

 Score =   217 bits (552),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 140/198 (71%), Gaps = 5/198 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ GQ+F 
Sbjct  712  KELNISQSRLKALGSPEEYAENLKLGPKKGGVMAIVDERPYVELFLSTYCKIAVAGQDFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL VD+STAIL LSE+GELQRIHDKWL    C+S NT+ ++ ++L L+
Sbjct  772  SGGWGFAFPRDSPLQVDLSTAILTLSEDGELQRIHDKWLKTGDCSSDNTEFVDSNQLRLE  831

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+YF +  RQ+ R+        +  GSS S R L+ F+SFVDE
Sbjct  832  SFMGLFLICGAACVLALLIYFGITLRQYLRHEQPGSAISADSGSSTSKRSLRKFISFVDE  891

Query  209  KEETAKSR---SIKRKQM  165
            ++ + K +   S+ R  M
Sbjct  892  RQRSPKXKRTMSLSRSSM  909



>ref|XP_006422389.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35629.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68412.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=843

 Score =   216 bits (551),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y  AL+N      V AVVDER Y++LFLS HC+FS+ GQEF 
Sbjct  619  EELSIPKSRLVALGSPEEYAIALENR----TVAAVVDERPYIDLFLSDHCQFSVRGQEFT  674

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIHDKWL + AC+S++++ + ++L+++S
Sbjct  675  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKACSSESSQSDSEQLQIQS  734

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALL YF L+ RQF +YS++ E   S   SSRSARLQTFLSF DEK 
Sbjct  735  FRGLFLICGIACFLALLAYFCLMLRQFKKYSAE-ESASSVPSSSRSARLQTFLSFADEKV  793

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            +  KS+ +KRK+ +  S   + + +   NGS+R
Sbjct  794  DRTKSK-LKRKREDMPSNVYMIEAEPK-NGSAR  824



>ref|XP_007203978.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
 gb|EMJ05177.1| hypothetical protein PRUPE_ppa025247mg, partial [Prunus persica]
Length=813

 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 8/176 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KAL++GP  GGV AV+DERAYMELFLS+   +SIVGQEF 
Sbjct  645  DELNIHRSRLVPLNSPEEYEKALQDGPSAGGVAAVIDERAYMELFLSSRGGYSIVGQEFT  704

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTA+ KLSE G LQ+IHDKWL++SAC+++  K  VDRL++KS
Sbjct  705  KMGWGFAFPRDSPLAIDMSTAVFKLSEKGNLQKIHDKWLMKSACSAEGAKQAVDRLQIKS  764

Query  383  FAGLFSICAVACFLALLVYFI-LLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSF  219
            F GLF +  +ACFLAL+++ I ++ + + R  SD E       SS+S RLQ+F+SF
Sbjct  765  FWGLFLLSGIACFLALVLHVIRMMHKYYKRPDSDCE-------SSQSRRLQSFVSF  813



>ref|XP_010028854.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028855.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028856.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028857.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010028858.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Eucalyptus 
grandis]
Length=912

 Score =   216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 133/181 (73%), Gaps = 5/181 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE Y  ALK G     V AVVDE+ Y++LFLS HC+FSI G+EF 
Sbjct  707  EELNIPKSRLVPLGSPEAYALALKTG----RVAAVVDEQPYIDLFLSNHCKFSIRGEEFT  762

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTA+L LSENGELQ+I+D+WL R  C SQ +  E D+L L+S
Sbjct  763  KSGWGFAFPRDSPLAVDMSTALLALSENGELQKINDRWLSRKTCGSQISGEESDQLRLQS  822

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VAC  ALLVY  ++  +F R+S    + PSS G SRSARLQTFL+FVD+KE
Sbjct  823  FWGLFLICGVACVAALLVYVFVMLHKFKRHSPQASE-PSSHGGSRSARLQTFLTFVDKKE  881

Query  203  E  201
            +
Sbjct  882  D  882



>gb|KCW55682.1| hypothetical protein EUGRSUZ_I01532 [Eucalyptus grandis]
 gb|KCW55683.1| hypothetical protein EUGRSUZ_I01532 [Eucalyptus grandis]
Length=924

 Score =   216 bits (551),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 133/181 (73%), Gaps = 5/181 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE Y  ALK G     V AVVDE+ Y++LFLS HC+FSI G+EF 
Sbjct  707  EELNIPKSRLVPLGSPEAYALALKTG----RVAAVVDEQPYIDLFLSNHCKFSIRGEEFT  762

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVDMSTA+L LSENGELQ+I+D+WL R  C SQ +  E D+L L+S
Sbjct  763  KSGWGFAFPRDSPLAVDMSTALLALSENGELQKINDRWLSRKTCGSQISGEESDQLRLQS  822

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC VAC  ALLVY  ++  +F R+S    + PSS G SRSARLQTFL+FVD+KE
Sbjct  823  FWGLFLICGVACVAALLVYVFVMLHKFKRHSPQASE-PSSHGGSRSARLQTFLTFVDKKE  881

Query  203  E  201
            +
Sbjct  882  D  882



>ref|XP_004145549.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 ref|XP_004157067.1| PREDICTED: glutamate receptor 3.3-like [Cucumis sativus]
 gb|KGN55521.1| hypothetical protein Csa_4G664290 [Cucumis sativus]
Length=918

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 147/206 (71%), Gaps = 5/206 (2%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGP-KNGGVMAVVDERAYMELFLSTHCEFSIVGQEF  567
            EEL I  SRL AL  PE+Y +AL  GP K GGV A+VDE  Y+E FLS  C F +VGQEF
Sbjct  710  EELNISKSRLIALGSPEEYARALDLGPDKEGGVAAIVDELLYVESFLSRQCSFRVVGQEF  769

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLA+D+STAIL+LSENG+LQRIHDKWL +SACT +N +LE DRL+LK
Sbjct  770  TKSGWGFAFPRDSPLAIDLSTAILQLSENGDLQRIHDKWLAKSACTMENAELESDRLQLK  829

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTP-SSGGSSRSARLQTFLSFVDE  210
            SF GLF IC + CF+AL +Y   + RQ   Y ++ E+   SS   S S RL+  +S +DE
Sbjct  830  SFWGLFLICGIVCFIALAIYCFQIIRQL--YHTETEEPDLSSSSGSHSNRLRRIISLLDE  887

Query  209  KEETAKSRSIKRKQMEGDSARSIDDD  132
            K+E++K R  KR+++E  S     DD
Sbjct  888  KKESSK-RGSKRRKVEKSSENDKVDD  912



>ref|XP_006422390.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 ref|XP_006422391.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35630.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|ESR35631.1| hypothetical protein CICLE_v10027770mg [Citrus clementina]
 gb|KDO68408.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68409.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68410.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
 gb|KDO68411.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=930

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y  AL+N      V AVVDER Y++LFLS HC+FS+ GQEF 
Sbjct  706  EELSIPKSRLVALGSPEEYAIALENRT----VAAVVDERPYIDLFLSDHCQFSVRGQEFT  761

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIHDKWL + AC+S++++ + ++L+++S
Sbjct  762  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKACSSESSQSDSEQLQIQS  821

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALL YF L+ RQF +YS++ E   S   SSRSARLQTFLSF DEK 
Sbjct  822  FRGLFLICGIACFLALLAYFCLMLRQFKKYSAE-ESASSVPSSSRSARLQTFLSFADEKV  880

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            +  KS+ +KRK+ +  S   + + +   NGS+R
Sbjct  881  DRTKSK-LKRKREDMPSNVYMIEAEPK-NGSAR  911



>ref|XP_006486565.1| PREDICTED: glutamate receptor 3.2-like isoform X1 [Citrus sinensis]
 ref|XP_006486566.1| PREDICTED: glutamate receptor 3.2-like isoform X2 [Citrus sinensis]
Length=930

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y  AL+N      V AVVDER Y++LFLS HC+FS+ GQEF 
Sbjct  706  EELSIPKSRLVALGSPEEYAIALENRT----VAAVVDERPYIDLFLSDHCQFSVRGQEFT  761

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIHDKWL + AC+S++++ + ++L+++S
Sbjct  762  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKACSSESSQSDSEQLQIQS  821

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALL YF L+ RQF +YS++ E   S   SSRSARLQTFLSF DEK 
Sbjct  822  FRGLFLICGIACFLALLAYFCLMLRQFKKYSAE-ESASSVPSSSRSARLQTFLSFADEKV  880

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            +  KS+ +KRK+ +  S   + + +   NGS+R
Sbjct  881  DRTKSK-LKRKREDMPSNVYMIEAEPK-NGSAR  911



>gb|KDO68407.1| hypothetical protein CISIN_1g002211mg [Citrus sinensis]
Length=953

 Score =   216 bits (551),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 124/213 (58%), Positives = 159/213 (75%), Gaps = 7/213 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL AL  PE+Y  AL+N      V AVVDER Y++LFLS HC+FS+ GQEF 
Sbjct  729  EELSIPKSRLVALGSPEEYAIALENRT----VAAVVDERPYIDLFLSDHCQFSVRGQEFT  784

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENGELQRIHDKWL + AC+S++++ + ++L+++S
Sbjct  785  KSGWGFAFPRDSPLAIDMSTAILTLSENGELQRIHDKWLRKKACSSESSQSDSEQLQIQS  844

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALL YF L+ RQF +YS++ E   S   SSRSARLQTFLSF DEK 
Sbjct  845  FRGLFLICGIACFLALLAYFCLMLRQFKKYSAE-ESASSVPSSSRSARLQTFLSFADEKV  903

Query  203  ETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSR  105
            +  KS+ +KRK+ +  S   + + +   NGS+R
Sbjct  904  DRTKSK-LKRKREDMPSNVYMIEAEPK-NGSAR  934



>gb|EEC72350.1| hypothetical protein OsI_05591 [Oryza sativa Indica Group]
Length=906

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 136/201 (68%), Gaps = 14/201 (7%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL I  SRL AL  PE+Y +ALK+GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F  
Sbjct  675  ELNISRSRLRALGSPEEYAEALKHGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFTS  734

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELKS  384
             GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL  S C++ NT+ ++ D+L L+S
Sbjct  735  RGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTSECSADNTEFVDSDQLRLES  794

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSS-------------RSA  243
            F GLF IC +AC +ALL+YF    R+F R+    + TP  GGS+                
Sbjct  795  FWGLFLICGIACVIALLIYFFTTVRKFLRHEPPEDPTPRPGGSTTLPDERTPPKNGQEKC  854

Query  242  RLQTFLSFVDEKEETAKSRSI  180
              + F+SF+D KE   K + +
Sbjct  855  NCRNFISFLDHKEPPKKKQPL  875



>gb|AFW69814.1| hypothetical protein ZEAMMB73_405216 [Zea mays]
Length=901

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 135/186 (73%), Gaps = 2/186 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ GQ+F 
Sbjct  712  KELNISQSRLKALGSPEEYAENLKLGPKKGGVMAIVDERPYVELFLSTYCKIAVAGQDFT  771

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL VD+STAIL LSE+GELQRIHDKWL    C+S NT+ ++ ++L L+
Sbjct  772  SGGWGFAFPRDSPLQVDLSTAILTLSEDGELQRIHDKWLKTGDCSSDNTEFVDSNQLRLE  831

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+YF +  RQ+ R+        +  GSS S R L+ F+SFVDE
Sbjct  832  SFMGLFLICGAACVLALLIYFGITLRQYLRHEQPGSAISADSGSSTSKRSLRKFISFVDE  891

Query  209  KEETAK  192
            ++ + K
Sbjct  892  RQRSPK  897



>gb|ACN36836.1| unknown [Zea mays]
Length=376

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 5/198 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F 
Sbjct  162  KELNISQSRLKALGSPEEYAENLKLGPKKGGVMAIVDERPYVELFLSTYCKIAVAGSDFT  221

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL    C++ N + ++ ++L L+
Sbjct  222  SGGWGFAFPRDSPLQIDLSTAILTLSENGELQRIHDKWLKTGDCSTDNAEFVDSNQLRLE  281

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+Y  +  RQ+ R+           GSS S R L+ F+SF D+
Sbjct  282  SFMGLFLICGAACVLALLIYLGITIRQYLRHEQPGPAISVDAGSSTSKRSLRKFISFADD  341

Query  209  KEETAKSR---SIKRKQM  165
            K+   K +   S+ R  M
Sbjct  342  KQPPPKKKRAMSLSRSSM  359



>ref|XP_006646788.1| PREDICTED: glutamate receptor 3.1-like [Oryza brachyantha]
Length=937

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 132/192 (69%), Gaps = 5/192 (3%)
 Frame = -2

Query  740  ELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQK  561
            EL I  SRL AL  PE+Y  ALK GPK GGVMA+VDER Y+ELFLST+C  ++ G +F  
Sbjct  713  ELNISRSRLKALGSPEEYADALKRGPKKGGVMAIVDERPYVELFLSTYCRIAVAGSDFTS  772

Query  560  NGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELKS  384
             GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL    CT+ NT+ ++ ++L L+S
Sbjct  773  RGWGFAFPRDSPLQIDLSTAILSLSENGELQRIHDKWLKTGECTADNTEFVDSNQLRLES  832

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPE----QTPSSGGSSRSARLQTFLSFV  216
            F GLF IC VAC +ALL+YFI+  R+F R+    E    + P S         + FLSF+
Sbjct  833  FWGLFLICGVACVIALLIYFIIAVRKFLRHVPPEEPATPEAPISPKEEPKCDCRKFLSFL  892

Query  215  DEKEETAKSRSI  180
            D KE   K RS+
Sbjct  893  DHKEPPKKKRSL  904



>emb|CAN64711.1| hypothetical protein VITISV_043726 [Vitis vinifera]
Length=959

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 158/215 (73%), Gaps = 11/215 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  PE+Y  AL+NG     V AVVDER Y+E+FL++HC+FSIVG +F 
Sbjct  746  DELDIPKSRLIPLGSPEEYATALENGT----VAAVVDERPYIEVFLASHCKFSIVGPQFT  801

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            ++GWGFAF +DS L VD+STAIL LSENG+LQRIHDKWL    C S N++L  D+L+ +S
Sbjct  802  RSGWGFAFXRDSSLTVDLSTAILTLSENGDLQRIHDKWLKNKVC-SDNSQLGSDQLQFQS  860

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +ACFLALLVYF ++ RQF++  S  E +PSS GSSRSARLQTFLSFVD K 
Sbjct  861  FWGLFLICGIACFLALLVYFCMMVRQFSKQFS--EASPSSHGSSRSARLQTFLSFVDNKA  918

Query  203  ETAKSRSIKRKQMEGD-SARSIDDDDSYVNGSSRS  102
            E +K++S KRK+  GD S  S   +D   NGS+R+
Sbjct  919  EVSKAKS-KRKR--GDMSLDSNGREDKSRNGSTRT  950



>ref|XP_009416682.1| PREDICTED: glutamate receptor 3.4-like, partial [Musa acuminata 
subsp. malaccensis]
Length=933

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 142/206 (69%), Gaps = 7/206 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL +LN PEDY +AL+ GP+ GGV A+VDE  Y+ELFLST+C+F  VGQEF 
Sbjct  717  EELNIAESRLVSLNNPEDYARALELGPQRGGVAAIVDELPYVELFLSTNCKFKTVGQEFT  776

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLAVD+STAIL+LSENG+LQRIHDKWL  + C+SQ++ +  +RL L S
Sbjct  777  KSGWGFAFPRDSPLAVDLSTAILRLSENGDLQRIHDKWLPPTGCSSQDSGIGSNRLSLGS  836

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSD------PEQTPSSGGSSRSARLQTFLS  222
            F GLF I  +AC +AL+++F  +  Q+  YSS       PE   S     R   ++  ++
Sbjct  837  FWGLFLISGLACLVALIIFFARILCQYNEYSSSQETVGIPESERSFKRPMRLTSIKDLIA  896

Query  221  FVDEKEETAKSRSIKRKQMEGDSARS  144
            FVD+KE   KS  IK+K +     RS
Sbjct  897  FVDKKEHEVKS-VIKQKSISQQQRRS  921



>ref|XP_007046476.1| Glutamate receptor 3.4, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX90633.1| Glutamate receptor 3.4, putative isoform 3, partial [Theobroma 
cacao]
Length=762

 Score =   211 bits (537),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  LN  +DY KALK+GPK GGV AV+DE AYMELFLST CEFSIVG EF 
Sbjct  623  EELSIPKSRLVPLNSADDYAKALKDGPKKGGVAAVIDEHAYMELFLSTQCEFSIVGSEFS  682

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DS LAVDMSTAILKLSENG+LQRIH+KWL   AC SQ TK EVDRL+L S
Sbjct  683  KMGWGFAFPRDSQLAVDMSTAILKLSENGDLQRIHNKWLKGIACRSQGTKEEVDRLQLNS  742

Query  383  FAGLFSICAVACFLALLVYF  324
            F GLF +C  AC LALLVY 
Sbjct  743  FWGLFVLCGFACLLALLVYL  762



>ref|XP_002451392.1| hypothetical protein SORBIDRAFT_04g001300 [Sorghum bicolor]
 gb|EES04368.1| hypothetical protein SORBIDRAFT_04g001300 [Sorghum bicolor]
Length=874

 Score =   211 bits (538),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 106/198 (54%), Positives = 137/198 (69%), Gaps = 5/198 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F 
Sbjct  660  KELNISRSRLKALGSPEEYAENLKLGPKKGGVMAIVDERPYVELFLSTYCKIAVAGSDFT  719

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL VD+STAIL LSENGELQRIHDKWL  + C+  NT+ ++ ++L L+
Sbjct  720  STGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLKTADCSIDNTEFVDSNQLRLE  779

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+YF +  RQ+ R+           GSS S R L+ F+SFVD+
Sbjct  780  SFMGLFLICGAACVLALLIYFGITLRQYLRHEQPGSAISVDAGSSTSKRSLRKFISFVDD  839

Query  209  KEETAKSR---SIKRKQM  165
            ++   K +   S+ R  M
Sbjct  840  RQPPPKKKRTMSLSRSSM  857



>ref|XP_008242065.1| PREDICTED: glutamate receptor 3.6-like [Prunus mume]
Length=867

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN PE+Y KAL++GP  GGV A+VDER YMELFLS  C +SIVGQEF 
Sbjct  710  DELKIHRSRLVPLNSPEEYEKALEDGPSAGGVAAIVDERTYMELFLSVRCGYSIVGQEFT  769

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA DMSTA+LKLSE G+LQ+IHDKWL++SAC++Q TK  VDRL LKS
Sbjct  770  KMGWGFAFPRDSPLAADMSTALLKLSEKGDLQKIHDKWLMKSACSAQGTKQAVDRLPLKS  829

Query  383  FAGLFSICAVACFLALLVYFILLTRQ  306
            F GLF +  +ACFLALL++ I L  +
Sbjct  830  FWGLFLLSGIACFLALLLHVIRLVHK  855



>gb|KJB79723.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=886

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 134/181 (74%), Gaps = 5/181 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL  L  PEDY +AL+       V AVVDER Y++LFLS  CEFSI GQEF 
Sbjct  694  EELGIPKSRLVQLGSPEDYARALEKR----QVAAVVDERPYVDLFLSDRCEFSIRGQEFS  749

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K  WGFAFP+DSPLA+DMSTAIL LSENGELQ+IHDKWL RSAC+S+ ++ E ++L+L+S
Sbjct  750  KRAWGFAFPRDSPLAIDMSTAILALSENGELQKIHDKWLSRSACSSEKSEDEAEQLDLQS  809

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LAL VY +L+ RQ++R+  + E   +S  +S SA L+T LSFVD K 
Sbjct  810  FWGLFLICGIACVLALFVYSLLMFRQYSRHCPE-ELDSTSRNNSFSAHLRTCLSFVDGKV  868

Query  203  E  201
            E
Sbjct  869  E  869



>ref|XP_009763348.1| PREDICTED: glutamate receptor 3.2-like [Nicotiana sylvestris]
Length=902

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+ I  SRL  L  PE+Y  AL+ G     V AVVDER Y++ FLST+C F  VG EF 
Sbjct  705  EEVNIAKSRLVPLGSPEEYADALEQG----RVAAVVDERPYVDQFLSTYCGFQKVGPEFT  760

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL+LSENGEL++IH KWL R  C  Q+++ + ++L+LKS
Sbjct  761  KSGWGFAFPRDSPLAIDMSTAILQLSENGELEKIHKKWLNRKVCGGQSSEADSEQLQLKS  820

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GLF IC V C  ALLVYF  + RQF R+  +  Q  +S  +  S S RL+ FLSFVDE
Sbjct  821  FWGLFLICGVTCCFALLVYFCFMLRQFKRHFPESTQCSTSTRTRISHSIRLRKFLSFVDE  880

Query  209  KEETAKSRSIKRKQME  162
            K E + +R +KRK+ME
Sbjct  881  KAEISANR-LKRKRME  895



>ref|XP_008812266.1| PREDICTED: glutamate receptor 3.4 isoform X2 [Phoenix dactylifera]
Length=765

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I PSRL  LN PE+Y + L+ GPK GGV A+VDE  Y+E+FLS +C+F +VGQEF 
Sbjct  560  EELNISPSRLVPLNSPEEYARVLELGPKGGGVAAIVDEIPYVEIFLSIYCQFQMVGQEFT  619

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAF ++SPLA D+STAIL LSE+G+LQRIHD+WL R  CTS+ T+ + +RL L S
Sbjct  620  KNGWGFAFQRNSPLAEDLSTAILSLSESGDLQRIHDQWLARKGCTSEVTETDTNRLSLGS  679

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSS-DPEQTPSSGGSSRSARL----QTFLSF  219
            F GLF IC +ACF+ALLV+FI +  Q+ +Y++ +  +T +S G   S  +    +  + F
Sbjct  680  FWGLFLICGLACFIALLVFFIRIYCQYNQYNTGESTETRTSDGPQPSLSIFNCCKRLIHF  739

Query  218  VDEKEETAKSRSIKRK  171
             D+KEE    R+I  K
Sbjct  740  FDKKEEEVM-RAISGK  754



>gb|KJB79725.1| hypothetical protein B456_013G064100 [Gossypium raimondii]
Length=905

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 134/181 (74%), Gaps = 5/181 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EELGI  SRL  L  PEDY +AL+       V AVVDER Y++LFLS  CEFSI GQEF 
Sbjct  713  EELGIPKSRLVQLGSPEDYARALEKR----QVAAVVDERPYVDLFLSDRCEFSIRGQEFS  768

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K  WGFAFP+DSPLA+DMSTAIL LSENGELQ+IHDKWL RSAC+S+ ++ E ++L+L+S
Sbjct  769  KRAWGFAFPRDSPLAIDMSTAILALSENGELQKIHDKWLSRSACSSEKSEDEAEQLDLQS  828

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF IC +AC LAL VY +L+ RQ++R+  + E   +S  +S SA L+T LSFVD K 
Sbjct  829  FWGLFLICGIACVLALFVYSLLMFRQYSRHCPE-ELDSTSRNNSFSAHLRTCLSFVDGKV  887

Query  203  E  201
            E
Sbjct  888  E  888



>ref|XP_009608800.1| PREDICTED: glutamate receptor 3.2-like [Nicotiana tomentosiformis]
Length=903

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 138/196 (70%), Gaps = 7/196 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EE+ I  SRL  L  P++Y  AL+ G     V AVVDER Y++ FLST+C F  VG EF 
Sbjct  706  EEVNIAKSRLVPLGSPKEYADALEQG----RVAAVVDERPYVDQFLSTYCGFQKVGPEFT  761

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL+LSENGEL++IH KWL R  C  QN++ + ++L+LKS
Sbjct  762  KSGWGFAFPRDSPLAIDMSTAILQLSENGELEKIHKKWLNRKVCGGQNSEADSEQLQLKS  821

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGS--SRSARLQTFLSFVDE  210
            F GLF IC V C  ALLVYF  + RQF R+  +  Q  +S  +  S S RL+ FLSFVDE
Sbjct  822  FWGLFLICGVTCCFALLVYFCFMLRQFKRHFPELTQRSTSTRTRISHSIRLKKFLSFVDE  881

Query  209  KEETAKSRSIKRKQME  162
            K E + +R +KRK+ME
Sbjct  882  KAEISANR-LKRKRME  896



>ref|XP_008812265.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Phoenix dactylifera]
Length=929

 Score =   209 bits (531),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 139/196 (71%), Gaps = 6/196 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I PSRL  LN PE+Y + L+ GPK GGV A+VDE  Y+E+FLS +C+F +VGQEF 
Sbjct  724  EELNISPSRLVPLNSPEEYARVLELGPKGGGVAAIVDEIPYVEIFLSIYCQFQMVGQEFT  783

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNGWGFAF ++SPLA D+STAIL LSE+G+LQRIHD+WL R  CTS+ T+ + +RL L S
Sbjct  784  KNGWGFAFQRNSPLAEDLSTAILSLSESGDLQRIHDQWLARKGCTSEVTETDTNRLSLGS  843

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSS-DPEQTPSSGGSSRSARL----QTFLSF  219
            F GLF IC +ACF+ALLV+FI +  Q+ +Y++ +  +T +S G   S  +    +  + F
Sbjct  844  FWGLFLICGLACFIALLVFFIRIYCQYNQYNTGESTETRTSDGPQPSLSIFNCCKRLIHF  903

Query  218  VDEKEETAKSRSIKRK  171
             D+KEE    R+I  K
Sbjct  904  FDKKEEEVM-RAISGK  918



>ref|XP_006283116.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 ref|XP_006283117.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 gb|EOA16014.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 gb|EOA16015.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
Length=824

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 144/205 (70%), Gaps = 11/205 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  P++Y  AL+NG     V A+VDER Y++LFLS  C F+I GQEF 
Sbjct  620  DELNIARSRLVPLGSPKEYATALQNG----TVAAIVDERPYVDLFLSEFCGFAIRGQEFT  675

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQN---TKLEVDRLE  393
            ++GWGFAFP+DSPLAVDMSTAIL LSE G+LQ+IHDKWL RS C++ N   +  + ++L+
Sbjct  676  RSGWGFAFPRDSPLAVDMSTAILGLSETGQLQKIHDKWLSRSNCSNLNGSESDEDSEQLK  735

Query  392  LKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQ---TPSSGGSSRSARLQTFLS  222
            L+SF GLF +C +ACF+AL +YF  + R F R+S   E+   T  S  SSRS  LQTFL+
Sbjct  736  LRSFWGLFLVCGIACFIALTIYFFKIVRDFCRHSKPEEEAAATLPSPESSRSKTLQTFLA  795

Query  221  FVDEKEETAKSRSIKRKQMEGDSAR  147
            + DEKEE +K R +KRK+ +  S R
Sbjct  796  YFDEKEEDSK-RRLKRKRNDDHSVR  819



>ref|XP_010446945.1| PREDICTED: glutamate receptor 3.2-like [Camelina sativa]
Length=907

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 143/204 (70%), Gaps = 10/204 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  P++Y  AL+NG     V A+VDER Y++LFLS  C F+I GQEF 
Sbjct  704  DELNIARSRLVPLGSPKEYATALQNG----TVAAIVDERPYVDLFLSEFCGFAIRGQEFT  759

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEV---DRLE  393
            ++GWGFAFP+DSPLAVDMSTAIL LSE G+LQ+IHDKWL +S C++ N    V   ++L+
Sbjct  760  RSGWGFAFPRDSPLAVDMSTAILGLSETGQLQKIHDKWLSKSNCSNLNGSESVEDSEQLK  819

Query  392  LKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQ--TPSSGGSSRSARLQTFLSF  219
            L+SF GLF +C +ACF+AL +YF ++ R F R++   E+  T  S  SSRS  L TFL++
Sbjct  820  LRSFWGLFLVCGIACFIALFIYFFMIVRDFCRHNKPEEEAATVPSPESSRSKTLLTFLAY  879

Query  218  VDEKEETAKSRSIKRKQMEGDSAR  147
             DEKEE  K R +KRK+++  S R
Sbjct  880  FDEKEEETK-RRLKRKRIDDHSVR  902



>ref|XP_008358485.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.2-like, 
partial [Malus domestica]
Length=584

 Score =   205 bits (522),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 144/221 (65%), Gaps = 12/221 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            E+L I  SRL  L  PE Y  ALK+      V AVVDERAY+ELFLS +CEFSI G EF 
Sbjct  348  EQLNIPKSRLVPLGSPEAYATALKDK----TVAAVVDERAYIELFLSENCEFSIRGSEFT  403

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPLA+DMSTAIL LSENG+ QRI++KWL R  C S+ +    D+L+L+S
Sbjct  404  KSGWGFAFPRDSPLAIDMSTAILTLSENGDXQRIYNKWLSRKICASETSDXVSDQLQLQS  463

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPE--QTPSSGG--SSRS--ARLQTFLS  222
            F GLF I    CF+ALL++   + RQF R++ + E    PSS G  SSRS    L TFLS
Sbjct  464  FXGLFLIAGAVCFIALLIHLFSVLRQFKRHTPEAEDHSEPSSHGNISSRSTLTHLLTFLS  523

Query  221  FVDEKEETAKSRSIKRKQMEG--DSARSIDDDDSYVNGSSR  105
            FVDEK + +K    KRK+ E    +    +DD S  + S R
Sbjct  524  FVDEKRDESKRNKSKRKRNESVVPNVNEKEDDQSVRSASKR  564



>gb|KDP47011.1| hypothetical protein JCGZ_10738 [Jatropha curcas]
Length=914

 Score =   208 bits (530),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 150/218 (69%), Gaps = 9/218 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +ELGI  +RL AL  PE+Y  AL N      V AVVDER Y++LFLS HCE SI GQ F 
Sbjct  702  DELGIAKTRLVALGSPEEYASALTNRT----VAAVVDERPYVDLFLSEHCECSIRGQAFT  757

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSAC-TSQNTKLEVDRLELK  387
            K+GWGFAFP+DSPLAVDMSTAIL LSENG+LQ+IHDKWL+R AC +S       ++LEL+
Sbjct  758  KSGWGFAFPRDSPLAVDMSTAILTLSENGDLQKIHDKWLVRKACSSSSTGDSGTEQLELQ  817

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEK  207
            SF GLF IC +ACFLALL+Y   + RQF ++    +  PS   SSRS RLQTFLSF D+K
Sbjct  818  SFWGLFLICGIACFLALLIYLCKVLRQFRKHFPI-DSDPSIHRSSRSRRLQTFLSFADDK  876

Query  206  EETAKSRSIKRKQMEGDSARSIDDDDSYVNGSSRSIGR  93
             E  KS+S KRK+ +  S     +D+S   G S SI R
Sbjct  877  VEDWKSKS-KRKREDALSNGYAREDESV--GGSHSIQR  911



>ref|XP_003608176.1| Glutamate receptor 3.3, partial [Medicago truncatula]
Length=799

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 111/139 (80%), Gaps = 0/139 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN P +Y KALK+GP NGGV A+VDERAYME+FL   CEF I+GQEF 
Sbjct  656  QELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFLEMRCEFGIIGQEFT  715

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG LQRIHDKWL RS+C S+  K  +DRL+L+S
Sbjct  716  KMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRSEEEKQGMDRLDLQS  775

Query  383  FAGLFSICAVACFLALLVY  327
            F GLF I  +ACF++L  Y
Sbjct  776  FWGLFLITGIACFVSLFCY  794



>ref|XP_010680624.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=907

 Score =   208 bits (529),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 131/183 (72%), Gaps = 2/183 (1%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL    S+L  L   E Y +AL+ GPK GGV+A+VD+   +E FLS  CEF I GQ F 
Sbjct  719  EELHFPKSQLVPLENEEAYAEALRKGPKKGGVVALVDDMTRIEAFLSRRCEFIIRGQRFT  778

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            KNG GFAF + SPLAVDMSTAILK+SENG+LQRIHDKWL +SAC SQ+TKL VDRLELKS
Sbjct  779  KNGRGFAFSRGSPLAVDMSTAILKMSENGDLQRIHDKWLRKSACRSQDTKLTVDRLELKS  838

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSS--RSARLQTFLSFVDE  210
            F GLF +  +ACF AL+VYF ++ R   R S  P +   SGG +  RS  L+TF ++V+E
Sbjct  839  FWGLFLLSGLACFFALIVYFGIMVRDLVRRSRRPPEEEESGGQTPPRSTCLKTFFAYVNE  898

Query  209  KEE  201
            K++
Sbjct  899  KDD  901



>gb|AFW66756.1| hypothetical protein ZEAMMB73_452909 [Zea mays]
Length=951

 Score =   207 bits (528),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/198 (52%), Positives = 134/198 (68%), Gaps = 5/198 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL AL  PE+Y + LK GPK GGVMA+VDER Y+ELFLST+C+ ++ G +F 
Sbjct  737  KELNISQSRLKALGSPEEYAENLKLGPKKGGVMAIVDERPYVELFLSTYCKIAVAGSDFT  796

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTK-LEVDRLELK  387
              GWGFAFP+DSPL +D+STAIL LSENGELQRIHDKWL    C++ N + ++ ++L L+
Sbjct  797  SGGWGFAFPRDSPLQIDLSTAILTLSENGELQRIHDKWLKTGDCSTDNAEFVDSNQLRLE  856

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSAR-LQTFLSFVDE  210
            SF GLF IC  AC LALL+Y  +  RQ+ R+           GSS S R L+ F+SF D+
Sbjct  857  SFMGLFLICGAACVLALLIYLGITIRQYLRHEQPGPAISVDAGSSTSKRSLRKFISFADD  916

Query  209  KEETAKSR---SIKRKQM  165
            K+   K +   S+ R  M
Sbjct  917  KQPPPKKKRAMSLSRSSM  934



>ref|XP_010276016.1| PREDICTED: glutamate receptor 3.4-like [Nelumbo nucifera]
 ref|XP_010276017.1| PREDICTED: glutamate receptor 3.4-like [Nelumbo nucifera]
Length=931

 Score =   207 bits (527),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 143/208 (69%), Gaps = 8/208 (4%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLS-THCEFSIVGQEF  567
             EL I  SRL  L   E+Y  AL  GPK GGV A+VDE  Y+E+FLS  +C+F IVGQEF
Sbjct  713  NELNIPESRLVNLRDQEEYADALLRGPKGGGVAAIVDEFPYVEIFLSHNNCKFKIVGQEF  772

Query  566  QKNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELK  387
             K+GWGFAFP+DSPLA+D+STA+L+LSENG+LQRIHDKWL  + C+ Q  +++ +RL L 
Sbjct  773  TKSGWGFAFPRDSPLAIDLSTAVLQLSENGDLQRIHDKWLSSNGCSMQVAEIDSNRLSLN  832

Query  386  SFAGLFSICAVACFLALLVYFILLTRQFTRYSSD------PEQTPSSGGSSRSARLQTFL  225
            SF GLF IC +ACFLALLV+F+ +  Q+ RY+ D       E +  S  ++RS   ++ +
Sbjct  833  SFWGLFLICGIACFLALLVFFVRVLCQYRRYNPDEVEEEEVESSHCSRHTTRSTSFKSLI  892

Query  224  SFVDEKEETAKSRSIKRKQMEGDSARSI  141
             FVD+KE   K++ +KRK  +G   + I
Sbjct  893  DFVDKKEAEIKNK-LKRKTGDGKQNQMI  919



>ref|XP_008235912.1| PREDICTED: glutamate receptor 3.2-like [Prunus mume]
Length=932

 Score =   207 bits (527),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 115/213 (54%), Positives = 145/213 (68%), Gaps = 12/213 (6%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            EEL I  SRL  L  PE Y  ALK       V AVVDE+AY+ELFLS +C FSI GQEF 
Sbjct  702  EELNIPRSRLVPLGSPEAYADALKKR----TVAAVVDEKAYIELFLSENCMFSIRGQEFT  757

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFP+DSPL +DMSTAIL LSENG+LQ+IHDKWL R  C +Q + L  D+L+L+S
Sbjct  758  KSGWGFAFPRDSPLTIDMSTAILTLSENGDLQKIHDKWLSRKTC-AQTSDLISDQLQLQS  816

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPE-QTPSSGGSSR---SARLQTFLSFV  216
            F GLF IC +A  +AL ++F+L  RQF+R+S + E QT  S  S R   SARL  FLSF+
Sbjct  817  FWGLFLICGIASLIALFIHFLLALRQFSRHSPEAEDQTEPSSHSRRTSCSARLPMFLSFI  876

Query  215  DEKEETAKSRSI---KRKQMEGDSARSIDDDDS  126
            DEK   +K+ +    KRK+M   + +   ++DS
Sbjct  877  DEKANESKNNNKTKRKRKEMMVSNGKENCENDS  909



>ref|XP_010090700.1| Glutamate receptor 3.2 [Morus notabilis]
 gb|EXB40419.1| Glutamate receptor 3.2 [Morus notabilis]
Length=927

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 138/194 (71%), Gaps = 6/194 (3%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I   RL AL  P +Y KAL+NG     V AVVDER Y+ELFLS HC F++ GQEF 
Sbjct  706  KELDIPQFRLVALGSPNEYAKALENGT----VAAVVDERPYIELFLSDHCMFAVRGQEFT  761

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K+GWGFAFPK SP+AVDMSTAIL LSENGELQRIH++WL +  C    + ++ ++L L+S
Sbjct  762  KSGWGFAFPKGSPIAVDMSTAILNLSENGELQRIHNRWLSKKGCALHGSDIQSEQLPLES  821

Query  383  FAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQTPSSGGSSRSARLQTFLSFVDEKE  204
            F GLF ICA+ C ++L++YF  +  +F+++     + PS   SSRS R+  FL+F+DEKE
Sbjct  822  FWGLFVICAIVCLVSLIIYFWKMIHEFSKHFPRVSE-PSEHASSRSERILNFLAFIDEKE  880

Query  203  ETAKSRSIKRKQME  162
            + ++ R +KRK+ E
Sbjct  881  DESRKR-LKRKRNE  893



>ref|XP_010432300.1| PREDICTED: glutamate receptor 3.2 [Camelina sativa]
 ref|XP_010432301.1| PREDICTED: glutamate receptor 3.2 [Camelina sativa]
Length=907

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 143/204 (70%), Gaps = 10/204 (5%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL I  SRL  L  P++Y  AL+NG     V A+VDER Y++LFLS  C F+I GQEF 
Sbjct  704  DELNIARSRLVPLGSPKEYATALQNG----TVAAIVDERPYVDLFLSEFCGFAIRGQEFT  759

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEV---DRLE  393
            ++GWGFAFP+DSPLAVDMSTAIL LSE G+LQ+IHDKWL +S C++ N    V   ++L+
Sbjct  760  RSGWGFAFPRDSPLAVDMSTAILGLSETGQLQKIHDKWLSKSNCSNLNGSESVEDSEQLK  819

Query  392  LKSFAGLFSICAVACFLALLVYFILLTRQFTRYSSDPEQ--TPSSGGSSRSARLQTFLSF  219
            L+SF GLF +C +ACF+AL +YF  + R F R++   E+  T  S  SSRS  L TFL++
Sbjct  820  LRSFWGLFLVCGIACFIALFIYFFKIVRDFCRHNKPEEEAATVPSPESSRSKTLLTFLAY  879

Query  218  VDEKEETAKSRSIKRKQMEGDSAR  147
             DEKEE +K R +KRK+++  S R
Sbjct  880  FDEKEEESK-RRLKRKRIDDHSVR  902



>ref|XP_003629121.1| Glutamate receptor [Medicago truncatula]
Length=745

 Score =   205 bits (522),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = -2

Query  743  EELGIHPSRLXALNLPEDYVKALKNGPKNGGVMAVVDERAYMELFLSTHCEFSIVGQEFQ  564
            +EL IH SRL  LN P +Y KALK+GP NGGV A+VDERAYME+FL   CEF I+GQEF 
Sbjct  591  QELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFLEMRCEFGIIGQEFT  650

Query  563  KNGWGFAFPKDSPLAVDMSTAILKLSENGELQRIHDKWLLRSACTSQNTKLEVDRLELKS  384
            K GWGFAFP+DSPLA+DMSTAILKLSENG LQRIHDKWL RS+C S+  K  +DRL+L+S
Sbjct  651  KMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRSEEEKQGMDRLDLQS  710

Query  383  FAGLFSICAVACFLALL  333
            F GLF I  +ACF++L 
Sbjct  711  FWGLFLITGIACFVSLF  727



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1360982043420