BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032F10

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009769985.1|  PREDICTED: uncharacterized protein LOC104220752    295   5e-95   Nicotiana sylvestris
ref|XP_011098348.1|  PREDICTED: mpv17-like protein isoform X2           293   3e-94   Sesamum indicum [beniseed]
ref|XP_011098346.1|  PREDICTED: mpv17-like protein isoform X1           293   4e-94   Sesamum indicum [beniseed]
ref|XP_009594216.1|  PREDICTED: uncharacterized protein LOC104090749    293   4e-94   Nicotiana tomentosiformis
ref|XP_004244201.1|  PREDICTED: uncharacterized protein LOC101247444    290   5e-93   Solanum lycopersicum
ref|XP_007021315.1|  Peroxisomal membrane 22 kDa family protein i...    290   9e-93   Theobroma cacao [chocolate]
ref|XP_006360143.1|  PREDICTED: uncharacterized protein LOC102590255    289   2e-92   Solanum tuberosum [potatoes]
gb|EPS62403.1|  hypothetical protein M569_12387                         283   5e-92   Genlisea aurea
emb|CBI20352.3|  unnamed protein product                                283   7e-92   Vitis vinifera
ref|XP_004149288.1|  PREDICTED: uncharacterized protein LOC101205134    286   3e-91   Cucumis sativus [cucumbers]
ref|XP_002517962.1|  Peroxisomal membrane protein, putative             285   4e-91   
ref|XP_008452277.1|  PREDICTED: uncharacterized protein LOC103493...    285   4e-91   Cucumis melo [Oriental melon]
ref|XP_002284644.1|  PREDICTED: mpv17-like protein isoform X1           285   4e-91   Vitis vinifera
ref|XP_010644223.1|  PREDICTED: uncharacterized protein LOC100253...    285   5e-91   Vitis vinifera
ref|XP_010092169.1|  Peroxisomal membrane protein 2                     286   5e-91   
gb|EYU26408.1|  hypothetical protein MIMGU_mgv1a007901mg                286   6e-91   Erythranthe guttata [common monkey flower]
ref|XP_004291669.1|  PREDICTED: uncharacterized protein LOC101306984    285   6e-91   Fragaria vesca subsp. vesca
gb|KGN56219.1|  hypothetical protein Csa_3G100790                       286   6e-91   Cucumis sativus [cucumbers]
gb|KDP24169.1|  hypothetical protein JCGZ_25826                         284   7e-91   Jatropha curcas
ref|XP_008452276.1|  PREDICTED: uncharacterized protein LOC103493...    285   7e-91   Cucumis melo [Oriental melon]
emb|CDP05871.1|  unnamed protein product                                284   2e-90   Coffea canephora [robusta coffee]
ref|XP_008226678.1|  PREDICTED: uncharacterized protein LOC103326248    283   3e-90   Prunus mume [ume]
ref|XP_007021317.1|  Peroxisomal membrane 22 kDa family protein i...    284   3e-90   
ref|XP_007211442.1|  hypothetical protein PRUPE_ppa007209mg             283   4e-90   Prunus persica
ref|XP_010278296.1|  PREDICTED: uncharacterized protein LOC104612557    283   6e-90   Nelumbo nucifera [Indian lotus]
ref|XP_011029433.1|  PREDICTED: mpv17-like protein                      282   8e-90   Populus euphratica
ref|XP_006650305.1|  PREDICTED: peroxisomal membrane protein 2-like     276   2e-89   Oryza brachyantha
ref|XP_006370309.1|  hypothetical protein POPTR_0001s41510g             281   2e-89   Populus trichocarpa [western balsam poplar]
ref|XP_011042502.1|  PREDICTED: uncharacterized protein LOC105138177    280   4e-89   Populus euphratica
ref|NP_001151402.1|  mpv17 / PMP22 family protein                       279   8e-89   Zea mays [maize]
ref|XP_010060525.1|  PREDICTED: uncharacterized protein LOC104448413    280   9e-89   Eucalyptus grandis [rose gum]
ref|XP_002317517.2|  hypothetical protein POPTR_0011s12440g             279   9e-89   Populus trichocarpa [western balsam poplar]
gb|KCW67302.1|  hypothetical protein EUGRSUZ_F01090                     280   9e-89   Eucalyptus grandis [rose gum]
gb|KDP38924.1|  hypothetical protein JCGZ_00681                         279   1e-88   Jatropha curcas
ref|XP_009378495.1|  PREDICTED: uncharacterized protein LOC103966...    280   1e-88   
ref|XP_009378494.1|  PREDICTED: uncharacterized protein LOC103966...    280   1e-88   Pyrus x bretschneideri [bai li]
gb|AFW68287.1|  hypothetical protein ZEAMMB73_230689                    276   1e-88   
ref|XP_008366686.1|  PREDICTED: uncharacterized protein LOC103430324    278   2e-88   Malus domestica [apple tree]
ref|XP_010924060.1|  PREDICTED: uncharacterized protein LOC105046...    279   2e-88   Elaeis guineensis
ref|XP_004982515.1|  PREDICTED: uncharacterized protein LOC101756875    278   3e-88   
ref|XP_008800139.1|  PREDICTED: uncharacterized protein LOC103714610    277   4e-88   
gb|KJB62714.1|  hypothetical protein B456_009G432500                    278   8e-88   Gossypium raimondii
ref|XP_006366011.1|  PREDICTED: protein SYM1-like                       276   9e-88   Solanum tuberosum [potatoes]
ref|XP_008681255.1|  PREDICTED: hypothetical protein isoform X2         276   1e-87   
ref|NP_001136458.1|  hypothetical protein                               276   1e-87   
gb|KHF98025.1|  Peroxisomal membrane 2                                  277   1e-87   Gossypium arboreum [tree cotton]
gb|KJB62727.1|  hypothetical protein B456_009G432500                    275   1e-87   Gossypium raimondii
gb|KDO74163.1|  hypothetical protein CISIN_1g017634mg                   273   1e-87   Citrus sinensis [apfelsine]
gb|EEC75642.1|  hypothetical protein OsI_12389                          276   2e-87   Oryza sativa Indica Group [Indian rice]
ref|NP_001050563.1|  Os03g0583800                                       276   2e-87   
gb|KJB79961.1|  hypothetical protein B456_013G074900                    275   2e-87   Gossypium raimondii
gb|KFK35762.1|  hypothetical protein AALP_AA4G033000                    275   2e-87   Arabis alpina [alpine rockcress]
ref|XP_002466876.1|  hypothetical protein SORBIDRAFT_01g015680          276   2e-87   Sorghum bicolor [broomcorn]
gb|KDO74161.1|  hypothetical protein CISIN_1g017634mg                   275   3e-87   Citrus sinensis [apfelsine]
ref|XP_009334618.1|  PREDICTED: uncharacterized protein LOC103927419    276   3e-87   Pyrus x bretschneideri [bai li]
gb|KDO74162.1|  hypothetical protein CISIN_1g017634mg                   275   3e-87   Citrus sinensis [apfelsine]
ref|XP_006464706.1|  PREDICTED: uncharacterized protein LOC102611604    275   3e-87   Citrus sinensis [apfelsine]
ref|XP_006447327.1|  hypothetical protein CICLE_v10015813mg             275   3e-87   Citrus clementina [clementine]
gb|KDO40771.1|  hypothetical protein CISIN_1g019056mg                   275   3e-87   Citrus sinensis [apfelsine]
ref|XP_009766316.1|  PREDICTED: protein SYM1                            274   3e-87   Nicotiana sylvestris
gb|KJB62726.1|  hypothetical protein B456_009G432500                    276   3e-87   Gossypium raimondii
ref|XP_010545803.1|  PREDICTED: uncharacterized protein LOC104818056    275   3e-87   Tarenaya hassleriana [spider flower]
gb|KJB62715.1|  hypothetical protein B456_009G432500                    276   3e-87   Gossypium raimondii
ref|XP_006451942.1|  hypothetical protein CICLE_v10008646mg             275   4e-87   
gb|KJB62719.1|  hypothetical protein B456_009G432500                    275   4e-87   Gossypium raimondii
ref|XP_009397791.1|  PREDICTED: uncharacterized protein LOC103982557    276   4e-87   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921049.1|  PREDICTED: uncharacterized protein LOC105044749    276   5e-87   Elaeis guineensis
emb|CDY26037.1|  BnaC06g05870D                                          274   5e-87   Brassica napus [oilseed rape]
gb|KJB62718.1|  hypothetical protein B456_009G432500                    275   6e-87   Gossypium raimondii
ref|XP_009147654.1|  PREDICTED: uncharacterized protein LOC103871177    274   8e-87   Brassica rapa
emb|CDY53804.1|  BnaA06g01790D                                          274   9e-87   Brassica napus [oilseed rape]
ref|XP_006451944.1|  hypothetical protein CICLE_v10008646mg             274   1e-86   
gb|KHG05370.1|  Peroxisomal membrane 2                                  273   1e-86   Gossypium arboreum [tree cotton]
ref|XP_010268765.1|  PREDICTED: uncharacterized protein LOC104605628    274   1e-86   Nelumbo nucifera [Indian lotus]
ref|XP_003562336.1|  PREDICTED: uncharacterized protein LOC100846887    273   2e-86   Brachypodium distachyon [annual false brome]
ref|XP_006392859.1|  hypothetical protein EUTSA_v10011607mg             273   3e-86   Eutrema salsugineum [saltwater cress]
ref|XP_011039751.1|  PREDICTED: protein SYM1 isoform X1                 272   3e-86   Populus euphratica
ref|XP_006371588.1|  hypothetical protein POPTR_0019s13430g             271   5e-86   Populus trichocarpa [western balsam poplar]
ref|XP_011085340.1|  PREDICTED: peroxisomal membrane protein 2          270   1e-85   Sesamum indicum [beniseed]
ref|NP_564615.3|  peroxisomal membrane Mpv17/PMP22 family protein       271   2e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675607.1|  PREDICTED: protein SYM1-like                       269   4e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007043533.1|  Peroxisomal membrane 22 kDa family protein         273   4e-85   
ref|XP_006841712.1|  hypothetical protein AMTR_s00003p00254020          270   5e-85   
ref|XP_004487310.1|  PREDICTED: protein SYM1-like isoform X1            269   7e-85   
ref|XP_004487311.1|  PREDICTED: protein SYM1-like isoform X2            267   1e-84   Cicer arietinum [garbanzo]
gb|EMT03498.1|  Peroxisomal membrane protein 2                          264   2e-84   
ref|XP_010522636.1|  PREDICTED: protein SYM1                            266   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_010051673.1|  PREDICTED: uncharacterized protein LOC104440...    267   3e-84   
ref|XP_008455339.1|  PREDICTED: mpv17-like protein                      266   7e-84   Cucumis melo [Oriental melon]
dbj|BAJ94190.1|  predicted protein                                      265   1e-83   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP14740.1|  unnamed protein product                                265   1e-83   Coffea canephora [robusta coffee]
gb|KEH38794.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    266   1e-83   Medicago truncatula
ref|XP_004248154.1|  PREDICTED: protein SYM1                            265   1e-83   Solanum lycopersicum
ref|XP_002874865.1|  hypothetical protein ARALYDRAFT_490222             265   2e-83   
ref|XP_006305136.1|  hypothetical protein CARUB_v10009510mg             266   2e-83   Capsella rubella
ref|XP_010657274.1|  PREDICTED: mpv17-like protein                      265   3e-83   Vitis vinifera
gb|KEH39092.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    263   5e-83   Medicago truncatula
gb|EMS63851.1|  Peroxisomal membrane protein 2                          259   7e-83   Triticum urartu
gb|KEH39091.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    263   7e-83   Medicago truncatula
gb|EYU26133.1|  hypothetical protein MIMGU_mgv1a009627mg                263   8e-83   Erythranthe guttata [common monkey flower]
gb|AAP40491.1|  unknown protein                                         262   8e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KEH39090.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...    263   8e-83   Medicago truncatula
ref|NP_192250.2|  peroxisomal membrane (Mpv17/PMP22) family protein     262   8e-83   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974505.1|  peroxisomal membrane (Mpv17/PMP22) family protein     263   1e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500911.1|  PREDICTED: mpv17-like protein                      263   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002891718.1|  hypothetical protein ARALYDRAFT_474411             263   2e-82   
gb|ABR17136.1|  unknown                                                 260   3e-82   Picea sitchensis
ref|XP_003543349.1|  PREDICTED: peroxisomal membrane protein 2          261   3e-82   Glycine max [soybeans]
ref|XP_010095804.1|  Protein SYM1                                       261   4e-82   Morus notabilis
gb|KHN04274.1|  Peroxisomal membrane protein 2                          261   6e-82   Glycine soja [wild soybean]
gb|KHN36615.1|  Peroxisomal membrane protein 2                          263   6e-82   Glycine soja [wild soybean]
ref|XP_003539526.1|  PREDICTED: peroxisomal membrane protein 2-like     260   7e-82   
ref|XP_009623041.1|  PREDICTED: protein SYM1                            259   2e-81   Nicotiana tomentosiformis
ref|XP_006396570.1|  hypothetical protein EUTSA_v10028802mg             259   2e-81   Eutrema salsugineum [saltwater cress]
gb|KFK30935.1|  hypothetical protein AALP_AA6G045100                    258   2e-81   Arabis alpina [alpine rockcress]
ref|XP_010462139.1|  PREDICTED: uncharacterized protein LOC104742787    260   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010479814.1|  PREDICTED: uncharacterized protein LOC104758621    260   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006288235.1|  hypothetical protein CARUB_v10001476mg             258   2e-81   Capsella rubella
ref|XP_004137017.1|  PREDICTED: uncharacterized protein LOC101214701    259   2e-81   Cucumis sativus [cucumbers]
ref|XP_009134349.1|  PREDICTED: protein SYM1                            258   2e-81   Brassica rapa
ref|XP_010422462.1|  PREDICTED: LOW QUALITY PROTEIN: mpv17-like p...    260   3e-81   
ref|XP_004487676.1|  PREDICTED: uncharacterized protein LOC101505712    260   3e-81   Cicer arietinum [garbanzo]
emb|CDY48204.1|  BnaCnng15950D                                          258   4e-81   Brassica napus [oilseed rape]
ref|XP_010455892.1|  PREDICTED: protein SYM1-like                       258   5e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004304121.1|  PREDICTED: protein SYM1                            258   1e-80   Fragaria vesca subsp. vesca
ref|XP_007149878.1|  hypothetical protein PHAVU_005G106400g             256   1e-80   Phaseolus vulgaris [French bean]
ref|XP_010687649.1|  PREDICTED: uncharacterized protein LOC104901742    258   1e-80   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX90887.1|  BnaA03g25670D                                          256   2e-80   
ref|XP_008353524.1|  PREDICTED: PXMP2/4 family protein 1-like           257   2e-80   Malus domestica [apple tree]
ref|XP_004155526.1|  PREDICTED: uncharacterized protein LOC101223761    258   3e-80   
ref|XP_003543260.1|  PREDICTED: uncharacterized protein LOC100786706    256   2e-79   Glycine max [soybeans]
gb|KHN36788.1|  Peroxisomal membrane protein 2                          256   2e-79   Glycine soja [wild soybean]
ref|XP_003539587.1|  PREDICTED: uncharacterized protein LOC100805057    255   3e-79   Glycine max [soybeans]
ref|XP_007149619.1|  hypothetical protein PHAVU_005G085000g             255   3e-79   Phaseolus vulgaris [French bean]
gb|EMT31197.1|  Peroxisomal membrane protein 2                          249   9e-79   
ref|XP_009357078.1|  PREDICTED: uncharacterized protein LOC103947838    253   1e-78   Pyrus x bretschneideri [bai li]
ref|XP_008230247.1|  PREDICTED: mpv17-like protein isoform X1           252   2e-78   
ref|XP_008230248.1|  PREDICTED: mpv17-like protein isoform X2           252   3e-78   
ref|XP_008379554.1|  PREDICTED: uncharacterized protein LOC103442533    251   7e-78   
ref|XP_007217251.1|  hypothetical protein PRUPE_ppa007825mg             251   8e-78   Prunus persica
gb|KJB79964.1|  hypothetical protein B456_013G074900                    246   4e-76   Gossypium raimondii
ref|XP_002966359.1|  hypothetical protein SELMODRAFT_66864              242   7e-76   
ref|XP_002978201.1|  hypothetical protein SELMODRAFT_56885              241   8e-76   
gb|EMS63743.1|  Protein SYM1                                            241   1e-75   Triticum urartu
gb|KJB62721.1|  hypothetical protein B456_009G432500                    244   4e-75   Gossypium raimondii
ref|XP_001774069.1|  predicted protein                                  233   3e-72   
ref|XP_001765838.1|  predicted protein                                  225   1e-69   
dbj|BAD34004.1|  peroxisomal membrane protein-like                      218   8e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008386298.1|  PREDICTED: uncharacterized protein LOC103448811    213   1e-64   
gb|AAT76331.1|  putative peroxisomal membrane protein, 5'-partial       206   2e-63   Oryza sativa Japonica Group [Japonica rice]
gb|KDO74155.1|  hypothetical protein CISIN_1g017634mg                   211   8e-63   Citrus sinensis [apfelsine]
gb|ABR25909.1|  mpv17/pmp22 family protein                              198   2e-60   Oryza sativa Indica Group [Indian rice]
gb|EEE59413.1|  hypothetical protein OsJ_11563                          178   4e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEE59409.1|  hypothetical protein OsJ_11557                          173   1e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97329.1|  peroxisomal membrane protein, putative, expressed       174   9e-49   Oryza sativa Japonica Group [Japonica rice]
gb|KDO74164.1|  hypothetical protein CISIN_1g017634mg                   174   1e-48   Citrus sinensis [apfelsine]
ref|XP_006451945.1|  hypothetical protein CICLE_v10008646mg             174   1e-48   
ref|XP_008230249.1|  PREDICTED: uncharacterized protein LOC103329...    172   3e-48   
gb|KDO40772.1|  hypothetical protein CISIN_1g019056mg                   172   5e-48   Citrus sinensis [apfelsine]
ref|XP_008230251.1|  PREDICTED: uncharacterized protein LOC103329...    171   9e-48   Prunus mume [ume]
ref|XP_008230252.1|  PREDICTED: uncharacterized protein LOC103329...    171   1e-47   
ref|XP_008230250.1|  PREDICTED: uncharacterized protein LOC103329...    171   1e-47   Prunus mume [ume]
gb|KJB79963.1|  hypothetical protein B456_013G074900                    170   2e-47   Gossypium raimondii
ref|NP_564616.1|  peroxisomal membrane Mpv17/PMP22 family protein       170   3e-47   Arabidopsis thaliana [mouse-ear cress]
gb|KDO74165.1|  hypothetical protein CISIN_1g017634mg                   170   4e-47   Citrus sinensis [apfelsine]
ref|XP_006447326.1|  hypothetical protein CICLE_v10015813mg             167   2e-46   
ref|XP_011039752.1|  PREDICTED: uncharacterized protein LOC105136...    167   3e-46   Populus euphratica
gb|KDO40773.1|  hypothetical protein CISIN_1g019056mg                   166   4e-46   Citrus sinensis [apfelsine]
gb|KJB62720.1|  hypothetical protein B456_009G432500                    166   1e-45   Gossypium raimondii
gb|KJB79962.1|  hypothetical protein B456_013G074900                    166   1e-45   Gossypium raimondii
gb|KJB62723.1|  hypothetical protein B456_009G432500                    166   2e-45   Gossypium raimondii
gb|KJB62724.1|  hypothetical protein B456_009G432500                    166   3e-45   Gossypium raimondii
ref|XP_010051684.1|  PREDICTED: uncharacterized protein LOC104440...    164   3e-45   Eucalyptus grandis [rose gum]
gb|ABF97328.1|  peroxisomal membrane protein, putative, expressed       155   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002183832.1|  predicted protein                                  140   2e-36   Phaeodactylum tricornutum CCAP 1055/1
emb|CBJ48801.1|  conserved unknown protein                              140   7e-36   Ectocarpus siliculosus
ref|XP_002176482.1|  predicted protein                                  135   3e-35   Phaeodactylum tricornutum CCAP 1055/1
gb|EWM29375.1|  peroxisomal membrane 22 kda (mpv17 pmp22) family ...    140   7e-35   Nannochloropsis gaditana
ref|XP_002294377.1|  predicted protein                                  134   2e-34   Thalassiosira pseudonana CCMP1335
gb|EJK64618.1|  hypothetical protein THAOC_14631                        134   3e-33   Thalassiosira oceanica
ref|XP_002509068.1|  predicted protein                                  123   3e-29   Micromonas commoda
gb|AFK40557.1|  unknown                                                 114   2e-28   Medicago truncatula
ref|XP_009035372.1|  hypothetical protein AURANDRAFT_4597               117   4e-28   Aureococcus anophagefferens
gb|AFK33326.1|  unknown                                                 113   5e-28   Medicago truncatula
ref|XP_002530181.1|  conserved hypothetical protein                     118   9e-28   
ref|XP_003061699.1|  predicted protein                                  116   1e-26   Micromonas pusilla CCMP1545
gb|AFK44918.1|  unknown                                                 105   2e-25   Lotus japonicus
ref|XP_010924061.1|  PREDICTED: uncharacterized protein LOC105046...    110   1e-24   
emb|CBJ27831.1|  conserved unknown protein                              105   6e-23   Ectocarpus siliculosus
gb|EWM27713.1|  peroxisomal membrane 22 kda (mpv17 pmp22) family ...    107   8e-23   Nannochloropsis gaditana
gb|ACJ84917.1|  unknown                                               98.2    2e-22   Medicago truncatula
ref|XP_005783132.1|  hypothetical protein EMIHUDRAFT_46294              100   3e-22   Emiliania huxleyi CCMP1516
gb|EAZ27617.1|  hypothetical protein OsJ_11561                        97.8    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002177278.1|  predicted protein                                94.0    2e-19   Phaeodactylum tricornutum CCAP 1055/1
emb|CBN79011.1|  peroxisomal membrane protein-related                 93.6    2e-19   Ectocarpus siliculosus
ref|XP_002183376.1|  predicted protein                                90.1    2e-18   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002287745.1|  predicted protein                                90.1    5e-18   Thalassiosira pseudonana CCMP1335
ref|XP_005707552.1|  peroxisomal membrane MPV17/PMP22-like protein    90.5    6e-18   Galdieria sulphuraria
ref|XP_002287363.1|  predicted protein                                88.6    7e-18   Thalassiosira pseudonana CCMP1335
emb|CBN79193.1|  conserved unknown protein                            89.7    1e-17   Ectocarpus siliculosus
ref|XP_005707818.1|  peroxisomal membrane MPV17/PMP22-like protei...  87.0    3e-17   Galdieria sulphuraria
emb|CBJ27540.1|  conserved unknown protein                            88.2    4e-17   Ectocarpus siliculosus
gb|EJK58198.1|  hypothetical protein THAOC_21696                      89.4    4e-17   Thalassiosira oceanica
emb|CBJ31093.1|  conserved unknown protein                            87.8    1e-16   Ectocarpus siliculosus
ref|XP_005535986.1|  similar to peroxisomal membrane protein PMP22    85.5    3e-16   Cyanidioschyzon merolae strain 10D
gb|EWM28134.1|  mpv17-like protein                                    85.1    4e-16   Nannochloropsis gaditana
ref|XP_005855482.1|  hypothetical protein NGA_0131200                 82.4    7e-16   Nannochloropsis gaditana CCMP526
gb|ACJ84916.1|  unknown                                               82.8    1e-15   Medicago truncatula
gb|EJK66898.1|  hypothetical protein THAOC_12131                      82.0    1e-15   Thalassiosira oceanica
gb|EWM28728.1|  Mpv17/PMP22                                           82.8    2e-15   Nannochloropsis gaditana
ref|XP_005776476.1|  putative peroxisomal membrane protein            82.4    3e-15   Emiliania huxleyi CCMP1516
gb|AAD11583.1|  hypothetical protein                                  82.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005706778.1|  peroxisomal membrane protein-related protein     82.4    4e-15   Galdieria sulphuraria
ref|XP_005538717.1|  similar to peroxisomal membrane protein PMP22    80.9    4e-15   Cyanidioschyzon merolae strain 10D
ref|XP_004359177.1|  pmp22 family protein                             80.9    4e-15   Cavenderia fasciculata
ref|NP_001090480.1|  uncharacterized protein LOC779393                79.7    1e-14   Xenopus laevis [clawed frog]
gb|EWM26132.1|  mpv17-like protein                                    79.0    2e-14   Nannochloropsis gaditana
ref|XP_002291546.1|  predicted protein                                77.4    2e-14   Thalassiosira pseudonana CCMP1335
ref|XP_009039118.1|  hypothetical protein AURANDRAFT_29752            77.4    4e-14   Aureococcus anophagefferens
ref|XP_005788772.1|  hypothetical protein EMIHUDRAFT_122535           80.9    4e-14   Emiliania huxleyi CCMP1516
ref|XP_009039064.1|  hypothetical protein AURANDRAFT_29835            77.4    5e-14   Aureococcus anophagefferens
gb|KIY95774.1|  Protein SYM1                                          76.6    9e-14   Monoraphidium neglectum
ref|XP_004345890.1|  PXMP2/4 family protein 3, putative               77.0    1e-13   Acanthamoeba castellanii str. Neff
gb|KIY95410.1|  Protein sym1                                          77.8    1e-13   Monoraphidium neglectum
ref|XP_007233539.1|  PREDICTED: peroxisomal membrane protein 2-like   75.5    3e-13   
ref|XP_502197.1|  YALI0C23815p                                        75.5    4e-13   Yarrowia lipolytica CLIB122
ref|XP_009040828.1|  hypothetical protein AURANDRAFT_15607            74.7    5e-13   Aureococcus anophagefferens
ref|XP_005535923.1|  similar to peroxisomal membrane protein PMP22    75.1    2e-12   Cyanidioschyzon merolae strain 10D
ref|XP_005782690.1|  putative peroxisomal membrane protein            75.1    2e-12   Emiliania huxleyi CCMP1516
gb|EJK54998.1|  hypothetical protein THAOC_25323                      72.8    4e-12   Thalassiosira oceanica
ref|XP_005186741.1|  PREDICTED: mpv17-like protein 2                  72.0    5e-12   Musca domestica
ref|XP_006298370.1|  hypothetical protein CARUB_v10014441mg           72.8    6e-12   Capsella rubella
ref|XP_003760802.1|  PREDICTED: mpv17-like protein 2                  70.9    8e-12   
ref|XP_001649412.1|  AAEL004577-PA                                    71.2    9e-12   Aedes aegypti
ref|XP_005645051.1|  hypothetical protein COCSUDRAFT_67394            71.6    1e-11   Coccomyxa subellipsoidea C-169
gb|EYE96729.1|  putative integral membrane protein, Mpv17/PMP22 f...  70.9    1e-11   Aspergillus ruber CBS 135680
ref|XP_001691305.1|  predicted protein                                70.9    1e-11   Chlamydomonas reinhardtii
dbj|GAM22026.1|  hypothetical protein SAMD00019534_052010             70.9    1e-11   Acytostelium subglobosum LB1
ref|XP_002071155.1|  GK25287                                          71.2    1e-11   
ref|XP_001978274.1|  GG17779                                          71.6    1e-11   
gb|KDO74166.1|  hypothetical protein CISIN_1g017634mg                 71.2    2e-11   Citrus sinensis [apfelsine]
ref|XP_002180247.1|  predicted protein                                70.1    2e-11   Phaeodactylum tricornutum CCAP 1055/1
gb|ADE76561.1|  unknown                                               71.6    2e-11   Picea sitchensis
ref|XP_002042933.1|  GM11631                                          70.9    3e-11   Drosophila sechellia
ref|XP_004350783.1|  pmp22 family protein                             70.1    3e-11   Cavenderia fasciculata
gb|EPS65622.1|  hypothetical protein M569_09156                       69.7    3e-11   Genlisea aurea
gb|EPS28576.1|  hypothetical protein PDE_03522                        69.7    3e-11   Penicillium oxalicum 114-2
ref|XP_001845069.1|  sym-1                                            69.3    3e-11   Culex quinquefasciatus
ref|XP_002100466.1|  GE17073                                          70.5    3e-11   Drosophila yakuba
ref|XP_009470234.1|  PREDICTED: mpv17-like protein 2                  70.9    4e-11   Nipponia nippon
ref|NP_572883.1|  CG1662, isoform A                                   70.5    4e-11   Drosophila melanogaster
ref|XP_004332855.1|  protein sym1, putative                           68.9    6e-11   Acanthamoeba castellanii str. Neff
ref|XP_005703050.1|  peroxisomal membrane MPV17/PMP22-like protein    68.9    6e-11   Galdieria sulphuraria
emb|CDX71197.1|  BnaC07g04760D                                        69.7    6e-11   
gb|AGO13267.1|  AaceriAFR120Cp                                        68.6    8e-11   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_007489288.1|  PREDICTED: mpv17-like protein 2                  68.9    8e-11   Monodelphis domestica
ref|XP_006028948.1|  PREDICTED: mpv17-like protein 2                  68.2    9e-11   
ref|XP_006271116.1|  PREDICTED: mpv17-like protein 2                  68.2    9e-11   
ref|XP_747686.1|  integral membrane protein, Mpv17/PMP22 family       68.2    1e-10   Aspergillus fumigatus Af293
emb|CDW53985.1|  protein Mpv17                                        68.2    1e-10   Trichuris trichiura
gb|KFK39987.1|  hypothetical protein AALP_AA3G315400                  69.3    1e-10   Arabis alpina [alpine rockcress]
gb|ETM55915.1|  hypothetical protein L914_00909                       68.6    1e-10   Phytophthora parasitica
gb|ETI56565.1|  hypothetical protein F443_00974                       68.2    1e-10   Phytophthora parasitica P1569
ref|XP_009675838.1|  PREDICTED: mpv17-like protein 2                  67.0    1e-10   Struthio camelus australis
ref|XP_008890633.1|  hypothetical protein PPTG_00831                  68.2    1e-10   Phytophthora parasitica INRA-310
ref|XP_011405251.1|  PREDICTED: mpv17-like protein 2                  68.2    1e-10   Amphimedon queenslandica
ref|XP_002025195.1|  GL26921                                          68.2    2e-10   Drosophila persimilis
ref|XP_001355527.1|  GA14082                                          68.2    2e-10   Drosophila pseudoobscura pseudoobscura
ref|XP_001966093.1|  GF19409                                          68.2    2e-10   Drosophila ananassae
ref|XP_004017595.1|  PREDICTED: peroxisomal membrane protein 2        66.6    2e-10   
ref|XP_005444380.1|  PREDICTED: mpv17-like protein 2                  67.4    3e-10   
emb|CAI59818.2|  MPV17 protein                                        67.0    3e-10   Nyctotherus ovalis
ref|XP_005505533.1|  PREDICTED: mpv17-like protein 2 isoform X1       67.0    3e-10   Columba livia [carrier pigeon]
ref|XP_002556376.1|  KLTH0H11660p                                     67.0    3e-10   Lachancea thermotolerans CBS 6340
ref|XP_003284959.1|  hypothetical protein DICPUDRAFT_28562            66.6    4e-10   Dictyostelium purpureum
ref|XP_006824692.1|  PREDICTED: mpv17-like protein-like               66.2    4e-10   Saccoglossus kowalevskii
ref|XP_968777.1|  PREDICTED: mpv17-like protein 2                     66.6    4e-10   Tribolium castaneum [rust-red flour beetle]
gb|EFA78150.1|  pmp22 family protein                                  69.3    4e-10   Heterostelium album PN500
gb|EMC87122.1|  Mpv17-like protein 2                                  66.2    4e-10   
ref|NP_985667.1|  AFR120Cp                                            66.2    4e-10   
gb|KEH39094.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  63.9    5e-10   
gb|KDN41878.1|  protein SYM1                                          66.2    6e-10   
ref|XP_010895811.1|  PREDICTED: mpv17-like protein 2                  66.6    6e-10   
ref|XP_007920141.1|  hypothetical protein MYCFIDRAFT_55315            66.6    6e-10   
ref|XP_011088050.1|  PREDICTED: PXMP2/4 family protein 4-like         67.4    6e-10   
dbj|BAO40318.1|  protein SYM1                                         66.2    6e-10   
ref|XP_007233216.1|  PREDICTED: mpv17-like protein 2-like             66.2    7e-10   
ref|XP_002611065.1|  hypothetical protein BRAFLDRAFT_206123           65.9    7e-10   
ref|XP_006299560.1|  hypothetical protein CARUB_v10015735mg           67.0    8e-10   
ref|XP_001257597.1|  integral membrane protein, Mpv17/PMP22 famil...  65.9    8e-10   
gb|ETN64189.1|  sym-1                                                 65.9    8e-10   
gb|KHN32813.1|  PXMP2/4 family protein 4                              66.2    8e-10   
ref|XP_005691553.1|  PREDICTED: peroxisomal membrane protein 2        65.9    9e-10   
ref|XP_007897040.1|  PREDICTED: mpv17-like protein 2                  65.9    9e-10   
gb|ETN63233.1|  pmp22 peroxisomal membrane protein                    66.2    1e-09   
ref|XP_005710823.1|  unnamed protein product                          67.4    1e-09   
ref|XP_003384042.1|  PREDICTED: protein SYM1-like                     65.9    1e-09   
ref|XP_009657846.1|  SYM1 protein                                     65.1    1e-09   
ref|XP_001624885.1|  predicted protein                                65.5    1e-09   
ref|XP_009032753.1|  hypothetical protein AURANDRAFT_19073            65.1    1e-09   
ref|XP_006126888.1|  PREDICTED: LOW QUALITY PROTEIN: mpv17-like p...  65.5    1e-09   
ref|XP_007072192.1|  PREDICTED: mpv17-like protein 2                  65.5    1e-09   
ref|XP_005961777.1|  PREDICTED: peroxisomal membrane protein 2        63.9    1e-09   
ref|XP_001396700.2|  integral membrane protein, Mpv17/PMP22 family    65.1    1e-09   
ref|XP_010560468.1|  PREDICTED: mpv17-like protein 2                  65.1    2e-09   
gb|ELT94432.1|  hypothetical protein CAPTEDRAFT_146770                65.5    2e-09   
dbj|GAM22227.1|  hypothetical protein SAMD00019534_054020             64.3    2e-09   
ref|XP_003642934.1|  PREDICTED: MPV17 mitochondrial membrane prot...  65.1    2e-09   
ref|XP_011397434.1|  Protein SYM1                                     67.0    2e-09   
ref|XP_004346946.1|  Mpv17 protein                                    64.7    2e-09   
ref|XP_005651770.1|  hypothetical protein COCSUDRAFT_55247            66.2    2e-09   
ref|NP_179092.1|  Mpv17/PMP22 family protein                          65.9    2e-09   
ref|XP_007151917.1|  hypothetical protein PHAVU_004G086700g           65.5    2e-09   
ref|XP_003390621.1|  PREDICTED: mpv17-like protein 2                  65.1    2e-09   
ref|XP_009523527.1|  hypothetical protein PHYSODRAFT_259603           64.7    2e-09   
ref|XP_010530711.1|  PREDICTED: PXMP2/4 family protein 3-like         65.5    2e-09   
ref|XP_002908293.1|  conserved hypothetical protein                   64.7    2e-09   
ref|XP_004635895.1|  PREDICTED: peroxisomal membrane protein 2        64.3    2e-09   
dbj|GAA90623.1|  integral membrane protein, Mpv17/PMP22 family        63.9    2e-09   
gb|ESX01924.1|  Protein required for ethanol metabolism               64.3    2e-09   
ref|NP_001039473.1|  peroxisomal membrane protein 2                   64.3    3e-09   
ref|XP_002894782.1|  conserved hypothetical protein                   64.7    3e-09   
gb|ELR59638.1|  Peroxisomal membrane protein 2                        64.3    3e-09   
gb|AEE62437.1|  unknown                                               64.7    3e-09   
ref|XP_004336503.1|  Hypothetical protein ACA1_192610                 63.2    3e-09   
ref|XP_003972589.1|  PREDICTED: mpv17-like protein-like               64.3    3e-09   
emb|CDR36304.1|  CYFA0S01e00364g1_1                                   64.3    3e-09   
ref|XP_003937174.1|  PREDICTED: peroxisomal membrane protein 2        63.5    3e-09   
gb|KCW89501.1|  hypothetical protein EUGRSUZ_A01792                   65.1    3e-09   
gb|KIW21134.1|  hypothetical protein PV08_01714                       63.9    3e-09   
ref|XP_004289787.1|  PREDICTED: PXMP2/4 family protein 4-like         65.1    4e-09   
ref|XP_007231359.1|  PREDICTED: mpv17-like protein                    63.9    4e-09   
emb|CDQ80777.1|  unnamed protein product                              65.1    4e-09   
gb|KIW61680.1|  hypothetical protein PV05_01773                       63.5    4e-09   
ref|XP_007181381.1|  PREDICTED: peroxisomal membrane protein 2        63.9    4e-09   
ref|XP_006901037.1|  PREDICTED: peroxisomal membrane protein 2        63.9    4e-09   
gb|KFR04803.1|  Mpv17-like 2                                          63.2    5e-09   
ref|XP_003190261.1|  integral membrane protein, Mpv17/PMP22 family    63.5    5e-09   
emb|CEG05272.1|  unnamed protein product                              63.9    5e-09   
ref|XP_010488928.1|  PREDICTED: protein SYM1-like                     64.7    5e-09   
ref|XP_010517857.1|  PREDICTED: protein SYM1-like                     64.7    5e-09   
ref|XP_010467271.1|  PREDICTED: protein SYM1-like                     64.7    5e-09   
gb|KEQ59684.1|  hypothetical protein M437DRAFT_56475                  63.5    5e-09   
ref|XP_005891278.1|  PREDICTED: peroxisomal membrane protein 2        63.9    5e-09   
emb|CBK20905.2|  unnamed protein product                              63.5    5e-09   
ref|XP_003043319.1|  hypothetical protein NECHADRAFT_72973            63.9    5e-09   
gb|KFZ62463.1|  Mpv17-like 2                                          62.4    5e-09   
emb|CDQ79804.1|  unnamed protein product                              63.9    5e-09   
ref|XP_010894669.1|  PREDICTED: peroxisomal membrane protein 2        63.5    5e-09   
ref|XP_011198336.1|  PREDICTED: mpv17-like protein 2                  63.5    5e-09   
ref|XP_002378358.1|  integral membrane protein, Mpv17/PMP22 famil...  63.5    5e-09   
ref|XP_006175085.1|  PREDICTED: peroxisomal membrane protein 2        63.2    5e-09   
ref|XP_006874132.1|  PREDICTED: peroxisomal membrane protein 2        63.5    6e-09   
ref|XP_005244212.1|  PREDICTED: mpv17-like protein 2                  62.4    6e-09   
ref|XP_001270162.1|  integral membrane protein, Mpv17/PMP22 famil...  63.9    6e-09   
ref|XP_006346324.1|  PREDICTED: PXMP2/4 family protein 4-like         64.3    7e-09   
ref|XP_007126875.1|  PREDICTED: peroxisomal membrane protein 2        62.8    7e-09   
ref|XP_010688400.1|  PREDICTED: protein sym-1                         63.9    7e-09   
ref|NP_001004930.1|  mpv17-like protein 2                             63.5    7e-09   
ref|XP_007794075.1|  putative integral membrane mpv17 pmp22 protein   63.5    7e-09   
ref|XP_002885942.1|  hypothetical protein ARALYDRAFT_480374           63.9    8e-09   
ref|XP_002753219.2|  PREDICTED: peroxisomal membrane protein 2        63.2    8e-09   
ref|XP_010871211.1|  PREDICTED: mpv17-like protein                    63.2    8e-09   
ref|XP_006078314.1|  PREDICTED: peroxisomal membrane protein 2        63.2    8e-09   
ref|NP_001004607.1|  peroxisomal membrane protein 2                   63.2    8e-09   
gb|KFV82671.1|  Mpv17-like 2                                          62.0    8e-09   
dbj|GAM25355.1|  hypothetical protein SAMD00019534_085300             62.8    8e-09   
ref|XP_003421311.1|  PREDICTED: peroxisomal membrane protein 2        62.8    9e-09   
ref|XP_009595436.1|  PREDICTED: PXMP2/4 family protein 4-like         63.9    9e-09   
emb|CAF95261.1|  unnamed protein product                              63.2    1e-08   
ref|XP_010946653.1|  PREDICTED: peroxisomal membrane protein 2        62.8    1e-08   
ref|XP_005350406.1|  PREDICTED: mpv17-like protein isoform X1         62.8    1e-08   
ref|XP_006122343.1|  PREDICTED: peroxisomal membrane protein 2        62.4    1e-08   
ref|XP_007432525.1|  PREDICTED: mpv17-like protein 2-like             63.2    1e-08   
gb|KIK46270.1|  hypothetical protein CY34DRAFT_9819                   62.8    1e-08   
ref|XP_002938322.1|  PREDICTED: mpv17-like protein-like isoform X1    62.8    1e-08   
ref|XP_004482081.1|  PREDICTED: mpv17-like protein 2                  63.2    1e-08   
ref|XP_006209527.1|  PREDICTED: peroxisomal membrane protein 2        62.8    1e-08   
gb|KIW37163.1|  hypothetical protein PV06_10782                       62.4    1e-08   
ref|XP_005612720.1|  PREDICTED: peroxisomal membrane protein 2        62.4    1e-08   
gb|EPY88285.1|  serine/threonine-protein phosphatase PGAM5, mitoc...  64.7    1e-08   
ref|XP_004230709.1|  PREDICTED: PXMP2/4 family protein 4              63.5    1e-08   
gb|KFU89702.1|  Mpv17-like 2                                          61.2    1e-08   
ref|XP_007445577.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...  62.4    1e-08   
gb|KFO63890.1|  Mpv17-like 2                                          61.6    1e-08   
ref|XP_008274806.1|  PREDICTED: peroxisomal membrane protein 2        62.4    1e-08   
ref|XP_005028172.1|  PREDICTED: mpv17-like protein 2                  61.6    1e-08   
ref|XP_002963480.1|  hypothetical protein SELMODRAFT_79996            62.4    1e-08   
ref|XP_004931563.1|  PREDICTED: mpv17-like protein-like isoform X1    62.4    1e-08   
gb|KFW76350.1|  Mpv17-like 2                                          61.2    1e-08   
ref|XP_005430428.1|  PREDICTED: mpv17-like protein 2-like             62.0    1e-08   
ref|XP_003519967.1|  PREDICTED: protein SYM1-like                     63.5    1e-08   
gb|ADG55385.1|  CG1662                                                62.4    2e-08   
ref|XP_007588810.1|  putative mpv17 pmp22 protein                     62.4    2e-08   
ref|NP_001087474.1|  mpv17-like protein                               62.4    2e-08   
ref|XP_009523536.1|  hypothetical protein PHYSODRAFT_496960           62.4    2e-08   
ref|XP_006412301.1|  hypothetical protein EUTSA_v10025993mg           63.2    2e-08   
ref|XP_001509760.1|  PREDICTED: peroxisomal membrane protein 2        62.0    2e-08   
ref|XP_002988190.1|  hypothetical protein SELMODRAFT_127764           62.0    2e-08   
gb|KFO77625.1|  Mpv17-like 2                                          61.2    2e-08   
ref|XP_001689352.2|  AGAP001403-PA                                    62.0    2e-08   
gb|KEQ85514.1|  MFS general substrate transporter                     64.3    2e-08   
gb|KIW80472.1|  hypothetical protein Z517_07088                       61.6    2e-08   
emb|CAJ81808.1|  novel protein containing pmp22 domain                61.2    2e-08   
gb|KFB45373.1|  AGAP001403-PA-like protein                            62.0    2e-08   
gb|KIV94522.1|  hypothetical protein PV10_02282                       61.6    2e-08   
ref|XP_002094506.1|  GE20165                                          62.0    2e-08   
ref|NP_567940.1|  Peroxisomal membrane protein Mpv17/PMP22            62.8    2e-08   
gb|EFX86830.1|  hypothetical protein DAPPUDRAFT_230417                62.0    2e-08   
ref|XP_005102213.1|  PREDICTED: mpv17-like protein 2-like isoform X1  61.6    2e-08   
ref|XP_007071400.1|  PREDICTED: peroxisomal membrane protein 2        61.2    2e-08   
gb|ERE75910.1|  peroxisomal membrane protein 2                        60.8    2e-08   
ref|XP_004611169.1|  PREDICTED: peroxisomal membrane protein 2        61.6    2e-08   
ref|XP_008315641.1|  PREDICTED: mpv17-like protein                    62.0    3e-08   
ref|XP_001693967.1|  predicted protein                                61.6    3e-08   
ref|XP_009603125.1|  PREDICTED: PXMP2/4 family protein 4-like         62.4    3e-08   
ref|XP_001991955.1|  GH24495                                          62.4    3e-08   
ref|XP_005060266.1|  PREDICTED: mpv17-like protein 2-like             61.2    3e-08   
ref|XP_010751763.1|  PREDICTED: peroxisomal membrane protein 2        61.2    3e-08   
ref|XP_009395606.1|  PREDICTED: protein SYM1-like isoform X1          62.8    3e-08   
ref|XP_009395607.1|  PREDICTED: protein SYM1-like isoform X2          62.8    3e-08   
gb|EHK40338.1|  hypothetical protein TRIATDRAFT_302717                61.2    3e-08   
emb|CDW91795.1|  mpv17 pmp22 family protein                           62.4    3e-08   
emb|CAG08513.1|  unnamed protein product                              61.2    3e-08   
ref|XP_008638184.1|  PREDICTED: mpv17-like protein 2                  60.8    3e-08   
emb|CDY54475.1|  BnaA09g52780D                                        62.4    3e-08   
ref|XP_006422854.1|  hypothetical protein CICLE_v10028778mg           63.2    3e-08   
ref|XP_009152386.1|  hypothetical protein HMPREF1120_00148            60.1    3e-08   
ref|XP_007953227.1|  PREDICTED: peroxisomal membrane protein 2        61.2    4e-08   
ref|XP_001511126.1|  PREDICTED: mpv17-like protein 2                  61.6    4e-08   
gb|ESA19537.1|  hypothetical protein GLOINDRAFT_134941                60.8    4e-08   
ref|XP_006285322.1|  hypothetical protein CARUB_v10006709mg           62.4    4e-08   
ref|XP_003002638.1|  SYM1                                             60.8    4e-08   
ref|XP_011297995.1|  PREDICTED: protein Mpv17                         60.8    4e-08   
ref|XP_010170545.1|  PREDICTED: mpv17-like protein 2                  60.1    4e-08   
ref|XP_008674384.1|  PREDICTED: PXMP2/4 family protein 4-like         62.0    4e-08   
ref|XP_005336410.1|  PREDICTED: serine/threonine-protein phosphat...  60.8    4e-08   
gb|EMP24873.1|  Peroxisomal membrane protein 2                        60.5    4e-08   
ref|XP_002429452.1|  protein SYM1, putative                           61.6    4e-08   
gb|EWG49024.1|  hypothetical protein FVEG_08647                       61.2    4e-08   
ref|XP_006409625.1|  hypothetical protein EUTSA_v10022822mg           62.0    5e-08   
gb|KEH25967.1|  peroxisomal membrane 22 kDa (Mpv17/PMP22) family ...  61.6    5e-08   
ref|XP_002009408.1|  GI15250                                          61.6    5e-08   
ref|XP_011001710.1|  PREDICTED: PXMP2/4 family protein 4              62.0    5e-08   
ref|XP_008236428.1|  PREDICTED: protein SYM1-like                     62.0    5e-08   
ref|XP_008932227.1|  PREDICTED: mpv17-like protein 2                  60.1    5e-08   
ref|XP_004595845.1|  PREDICTED: mpv17-like protein 2                  60.8    5e-08   
ref|XP_456102.1|  hypothetical protein                                60.8    5e-08   
gb|EGU88751.1|  hypothetical protein FOXB_00726                       61.2    5e-08   
ref|XP_006841958.1|  hypothetical protein AMTR_s00144p00007850        60.1    5e-08   
ref|XP_001238256.1|  AGAP012415-PA                                    60.8    5e-08   
ref|XP_003388107.1|  PREDICTED: mpv17-like protein 2                  60.5    5e-08   
ref|XP_006486943.1|  PREDICTED: PXMP2/4 family protein 4-like         62.0    5e-08   
ref|XP_001694102.1|  predicted protein                                62.8    5e-08   
ref|NP_648518.1|  CG5906                                              60.8    5e-08   
gb|AAM29277.1|  AT16953p                                              60.8    6e-08   
ref|XP_009421094.1|  PREDICTED: protein SYM1-like isoform X1          62.0    6e-08   
ref|XP_010905281.1|  PREDICTED: PXMP2/4 family protein 3-like         62.0    6e-08   
ref|XP_002949264.1|  hypothetical protein VOLCADRAFT_89535            62.4    6e-08   
gb|KFH45512.1|  hypothetical protein ACRE_036540                      60.5    6e-08   
ref|XP_007627415.1|  PREDICTED: peroxisomal membrane protein 2 is...  60.5    6e-08   
ref|XP_003792935.1|  PREDICTED: peroxisomal membrane protein 2        60.5    6e-08   
gb|KFD61789.1|  hypothetical protein M514_04322                       62.8    6e-08   
ref|XP_007201355.1|  hypothetical protein PRUPE_ppa010201mg           61.6    6e-08   
ref|XP_011092520.1|  PREDICTED: PXMP2/4 family protein 4              62.0    6e-08   
ref|XP_002068361.1|  GK19153                                          60.5    6e-08   
ref|XP_002008992.1|  GI13797                                          60.8    6e-08   
gb|KFA60281.1|  hypothetical protein S40285_07383                     60.8    6e-08   
emb|CCT74725.1|  uncharacterized protein FFUJ_10789                   60.8    6e-08   
ref|XP_006910024.1|  PREDICTED: peroxisomal membrane protein 2        59.7    7e-08   
gb|KEY70838.1|  hypothetical protein S7711_08537                      60.8    7e-08   
emb|CEJ88834.1|  Putative Protein SYM1                                60.1    7e-08   
ref|XP_002030195.1|  GM24695                                          60.5    7e-08   
ref|XP_006599453.1|  PREDICTED: PXMP2/4 family protein 4-like         62.0    7e-08   
ref|XP_003501778.1|  PREDICTED: peroxisomal membrane protein 2 is...  60.5    7e-08   
ref|XP_004351386.1|  pmp22 family protein                             60.1    8e-08   
ref|XP_002076534.1|  GD17579                                          60.5    8e-08   
ref|XP_002059535.1|  GJ14822                                          61.2    8e-08   
ref|XP_004538970.1|  PREDICTED: mpv17-like protein-like               60.5    8e-08   
ref|XP_003705140.1|  PREDICTED: mpv17-like protein 2-like             60.5    8e-08   
ref|XP_004152269.1|  PREDICTED: PXMP2/4 family protein 4-like         61.2    8e-08   
gb|EGA57584.1|  Sym1p                                                 60.5    8e-08   
ref|XP_008787156.1|  PREDICTED: PXMP2/4 family protein 4-like         61.2    8e-08   
gb|AFK37482.1|  unknown                                               61.2    8e-08   
ref|NP_001141905.1|  uncharacterized protein LOC100274053             61.2    8e-08   
ref|XP_002867146.1|  hypothetical protein ARALYDRAFT_491288           61.2    8e-08   
ref|XP_635703.1|  pmp22 family protein                                60.1    8e-08   
ref|XP_009757999.1|  PREDICTED: PXMP2/4 family protein 4-like         61.6    8e-08   
ref|XP_003974957.1|  PREDICTED: peroxisomal membrane protein 2-like   60.1    9e-08   
gb|EFX03442.1|  integral membrane protein mpv17 pmp22 family          59.7    9e-08   
ref|XP_005458613.1|  PREDICTED: mpv17-like protein-like isoform X1    60.5    9e-08   
ref|XP_004537761.1|  PREDICTED: mpv17-like protein 2-like isoform X1  60.1    9e-08   
ref|XP_002047909.1|  GJ11665                                          60.1    9e-08   
ref|XP_006790689.1|  PREDICTED: mpv17-like protein-like               60.5    9e-08   
ref|XP_009123223.1|  PREDICTED: PXMP2/4 family protein 4-like         60.8    9e-08   
gb|EYU39053.1|  hypothetical protein MIMGU_mgv1a019256mg              58.9    1e-07   
ref|XP_010277092.1|  PREDICTED: protein SYM1                          61.2    1e-07   
gb|KIW39391.1|  hypothetical protein PV06_09165                       60.1    1e-07   
ref|XP_001223294.1|  hypothetical protein CHGG_04080                  61.2    1e-07   
gb|ABA98698.2|  peroxisomal membrane protein 22 kDa, putative, ex...  61.2    1e-07   



>ref|XP_009769985.1| PREDICTED: uncharacterized protein LOC104220752 [Nicotiana sylvestris]
Length=375

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  217  PLFDFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPVKVAFDQTVWSAIWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TVLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  277  SIYYTVLGVLRFESPLAIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEAR+SE SVEA   PPS+GP Q
Sbjct  337  ELIWVTILSTYSNEKSEARVSEASVEAEMQPPSIGPPQ  374



>ref|XP_011098348.1| PREDICTED: mpv17-like protein isoform X2 [Sesamum indicum]
Length=376

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPFDDWWVVPAKVAFDQT WSA+WN
Sbjct  217  PLFEFDRARMFRSGLLGFTLHGSLSHYYYQFCEALFPFDDWWVVPAKVAFDQTAWSAVWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+T+LG LRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  277  SIYYTLLGVLRLESPLSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE  VEA +  P S GPS+
Sbjct  337  ELIWVTILSTYSNEKSEARISEAPVEANATLPSSKGPSE  375



>ref|XP_011098346.1| PREDICTED: mpv17-like protein isoform X1 [Sesamum indicum]
Length=379

 Score =   293 bits (751),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 146/159 (92%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPFDDWWVVPAKVAFDQT WSA+WN
Sbjct  217  PLFEFDRARMFRSGLLGFTLHGSLSHYYYQFCEALFPFDDWWVVPAKVAFDQTAWSAVWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+T+LG LRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  277  SIYYTLLGVLRLESPLSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE  VEA +  P S GPS+
Sbjct  337  ELIWVTILSTYSNEKSEARISEAPVEANATLPSSKGPSE  375



>ref|XP_009594216.1| PREDICTED: uncharacterized protein LOC104090749 [Nicotiana tomentosiformis]
Length=375

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARM RSGL GFTLHGSLSHYYY  CEALFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  217  PLFDFDRARMLRSGLVGFTLHGSLSHYYYQICEALFPFQDWWVVPVKVAFDQTVWSAIWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TVLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  277  SIYYTVLGILRFESPLTIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEAR+SE SVEA   PPS+GP Q
Sbjct  337  ELIWVTILSTYSNEKSEARVSEASVEAEMQPPSIGPPQ  374



>ref|XP_004244201.1| PREDICTED: uncharacterized protein LOC101247444 [Solanum lycopersicum]
Length=376

 Score =   290 bits (743),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRARM RSGL GFTLHGSLSHYYY FCEALFPF+DWWVVP KVAFDQTVWSAIWN
Sbjct  218  PLFEIDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPVKVAFDQTVWSAIWN  277

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LRLESP +IFSELKATF PMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  278  SIYFTVLGILRLESPLAIFSELKATFLPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  337

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            EL+WVTILSTYSNEKSE+R+SE  VEA + PPSV P Q
Sbjct  338  ELVWVTILSTYSNEKSESRVSEVIVEAEAQPPSVSPPQ  375



>ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
 gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma 
cacao]
Length=386

 Score =   290 bits (742),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFP  DWWVVPAKV FDQT W+A+WN
Sbjct  224  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPSQDWWVVPAKVVFDQTAWAAVWN  283

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  284  SIYFTVLGFLRLESPISIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  343

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   EA S+ P VGPS+
Sbjct  344  ELIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSE  381



>ref|XP_006360143.1| PREDICTED: uncharacterized protein LOC102590255 [Solanum tuberosum]
Length=371

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRARM RSGL GFTLHGSLSHYYY FCEALFPF+DWWVVP KVAFDQTVWSAIWN
Sbjct  213  PLFEIDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPVKVAFDQTVWSAIWN  272

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR ESP +IFSELKATF PMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  273  SIYFTVLGILRFESPLAIFSELKATFLPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  332

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSE+R+SE  VEA + PPS+ P Q
Sbjct  333  ELIWVTILSTYSNEKSESRVSEVIVEAEAQPPSISPPQ  370



>gb|EPS62403.1| hypothetical protein M569_12387, partial [Genlisea aurea]
Length=247

 Score =   283 bits (725),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYYH CE LFPFD+WWVVPAKVAFDQT+WSA+WN
Sbjct  94   PIFEFDRLRMFRSGLLGFTLHGSLSHYYYHLCEDLFPFDEWWVVPAKVAFDQTIWSAVWN  153

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+T+LG LRLESP +IFSELKATFWPMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCV
Sbjct  154  SIYYTLLGVLRLESPVAIFSELKATFWPMLTAGWKLWPFAHLITYGVVPLEQRLLWVDCV  213

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            EL+WVTILSTYSNEKSEARISE ++EA +NP  V
Sbjct  214  ELVWVTILSTYSNEKSEARISEVAIEADTNPTEV  247



>emb|CBI20352.3| unnamed protein product [Vitis vinifera]
Length=262

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WN
Sbjct  104  PLFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWN  163

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  164  SIYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  223

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVG  293
            ELIWVTILSTYSNEKSEAR+SE S EA SN P  G
Sbjct  224  ELIWVTILSTYSNEKSEARVSEASAEAASNSPPTG  258



>ref|XP_004149288.1| PREDICTED: uncharacterized protein LOC101205134 [Cucumis sativus]
 ref|XP_004171301.1| PREDICTED: uncharacterized protein LOC101228605 [Cucumis sativus]
Length=376

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  218  PLFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWN  277

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  278  SIYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  337

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            ELIWVTILSTYSNEKSEARISE + + +S+P
Sbjct  338  ELIWVTILSTYSNEKSEARISEVATDLSSDP  368



>ref|XP_002517962.1| Peroxisomal membrane protein, putative [Ricinus communis]
 gb|EEF44480.1| Peroxisomal membrane protein, putative [Ricinus communis]
Length=344

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 134/153 (88%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+AIWN
Sbjct  184  PIFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAIWN  243

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESP +IFSEL ATFWPMLTAGWKLWPF+HLITYGVIPVEQRLLWVDCV
Sbjct  244  SIYFLVLGFLRFESPANIFSELTATFWPMLTAGWKLWPFSHLITYGVIPVEQRLLWVDCV  303

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEAR SE ++EATS   S
Sbjct  304  ELIWVTILSTYSNEKSEARTSEATIEATSKSSS  336



>ref|XP_008452277.1| PREDICTED: uncharacterized protein LOC103493348 isoform X2 [Cucumis 
melo]
Length=376

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  218  PLFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWN  277

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  278  SIYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  337

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEARISE + +++S+
Sbjct  338  ELIWVTILSTYSNEKSEARISEVATDSSSD  367



>ref|XP_002284644.1| PREDICTED: mpv17-like protein isoform X1 [Vitis vinifera]
Length=371

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WN
Sbjct  213  PLFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWN  272

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  273  SIYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  332

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVG  293
            ELIWVTILSTYSNEKSEAR+SE S EA SN P  G
Sbjct  333  ELIWVTILSTYSNEKSEARVSEASAEAASNSPPTG  367



>ref|XP_010644223.1| PREDICTED: uncharacterized protein LOC100253839 isoform X2 [Vitis 
vinifera]
Length=370

 Score =   285 bits (729),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARM RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT+W+A+WN
Sbjct  213  PLFEFDRARMLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTLWAAVWN  272

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+GFLR +SP ++F EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  273  SIYYTVVGFLRFDSPANVFGELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  332

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVG  293
            ELIWVTILSTYSNEKSEAR+SE S EA SN P  G
Sbjct  333  ELIWVTILSTYSNEKSEARVSEASAEAASNSPPTG  367



>ref|XP_010092169.1| Peroxisomal membrane protein 2 [Morus notabilis]
 gb|EXB50359.1| Peroxisomal membrane protein 2 [Morus notabilis]
Length=393

 Score =   286 bits (731),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT WSA+WN
Sbjct  216  PLFEFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFHDWWVVPAKVVFDQTAWSAVWN  275

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TVLGFLRLESP SIFSELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  276  SIYYTVLGFLRLESPASIFSELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  335

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE  VE      +V P +
Sbjct  336  ELIWVTILSTYSNEKSEARISEAPVEVNLISSNVTPPE  373



>gb|EYU26408.1| hypothetical protein MIMGU_mgv1a007901mg [Erythranthe guttata]
Length=392

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYYHFCEALFPFDDWWVVPAKV FDQTVWSAIWN
Sbjct  233  PIFEFDRARLFRSGLVGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVLFDQTVWSAIWN  292

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFT+LG LR ESP +IFSE KATF PMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  293  SIYFTLLGVLRFESPANIFSEWKATFLPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  352

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN-PPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E  VEA ++ PP  GPS+
Sbjct  353  ELIWVTILSTYSNEKSEARITEAPVEANASLPPVKGPSE  391



>ref|XP_004291669.1| PREDICTED: uncharacterized protein LOC101306984 [Fragaria vesca 
subsp. vesca]
Length=377

 Score =   285 bits (729),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYY  CE LFPF  WWVVP KVAFDQT+W+AIWN
Sbjct  219  PLFEFDRARMFRSGLVGFTLHGSLSHYYYQICEELFPFQGWWVVPVKVAFDQTIWAAIWN  278

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP +I+SELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  279  SIYFTVLGFLRLESPINIYSELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  338

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            ELIWVTILSTYSNEKSEARIS+   EA+SN P++ P
Sbjct  339  ELIWVTILSTYSNEKSEARISDAPAEASSNSPNISP  374



>gb|KGN56219.1| hypothetical protein Csa_3G100790 [Cucumis sativus]
Length=412

 Score =   286 bits (732),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  254  PLFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWN  313

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  314  SIYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  373

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            ELIWVTILSTYSNEKSEARISE + + +S+P
Sbjct  374  ELIWVTILSTYSNEKSEARISEVATDLSSDP  404



>gb|KDP24169.1| hypothetical protein JCGZ_25826 [Jatropha curcas]
Length=354

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVWSAIWN
Sbjct  197  PIFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWSAIWN  256

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP +IFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  257  SIYFTVLGFLRFESPANIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  316

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSE+RISE + E+  N  S  PS+
Sbjct  317  ELIWVTILSTYSNEKSESRISEATSESDPN-SSTNPSE  353



>ref|XP_008452276.1| PREDICTED: uncharacterized protein LOC103493348 isoform X1 [Cucumis 
melo]
Length=382

 Score =   285 bits (729),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 132/150 (88%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GF+LHGSLSHYYYHFCE LFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  218  PLFEFDRTRMFRSGLVGFSLHGSLSHYYYHFCEGLFPFQDWWVVPAKVAFDQTAWSAVWN  277

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  278  SIYFVVLGFLRLESPVSIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  337

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEARISE + +++S+
Sbjct  338  ELIWVTILSTYSNEKSEARISEVATDSSSD  367



>emb|CDP05871.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDRARMFRSGL GFTLHGSLSHYYYHFCEALFP DDWWVVPAKV FDQT WSA+WN
Sbjct  226  PLLEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPSDDWWVVPAKVVFDQTFWSAVWN  285

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ V+G LRLESP SIF ELKATFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  286  SIYYAVVGALRLESPASIFGELKATFWPMLTAGWKLWPFAHLITYGVIPIEQRLLWVDCV  345

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            ELIWVTILSTYSNEKSE+RISE++ E   NP S+
Sbjct  346  ELIWVTILSTYSNEKSESRISEQAAEENVNPASI  379



>ref|XP_008226678.1| PREDICTED: uncharacterized protein LOC103326248 [Prunus mume]
Length=378

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWN
Sbjct  220  PLFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWN  279

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP  IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  280  SIYFTVLGFLRFESPIDIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  339

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            ELIWVTILSTYSNEKSEARISE  VEA S+  +  P
Sbjct  340  ELIWVTILSTYSNEKSEARISEAPVEANSSSSNTSP  375



>ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
 gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma 
cacao]
Length=391

 Score =   284 bits (726),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 142/163 (87%), Gaps = 5/163 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEA-----LFPFDDWWVVPAKVAFDQTVW  593
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE      LFP  DWWVVPAKV FDQT W
Sbjct  224  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEVIILHYLFPSQDWWVVPAKVVFDQTAW  283

Query  592  SAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLL  413
            +A+WNSIYFTVLGFLRLESP SIF+ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLL
Sbjct  284  AAVWNSIYFTVLGFLRLESPISIFNELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLL  343

Query  412  WVDCVELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            WVDCVELIWVTILSTYSNEKSEARI+E   EA S+ P VGPS+
Sbjct  344  WVDCVELIWVTILSTYSNEKSEARIAEAPAEANSSLPPVGPSE  386



>ref|XP_007211442.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
 gb|EMJ12641.1| hypothetical protein PRUPE_ppa007209mg [Prunus persica]
Length=378

 Score =   283 bits (724),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWN
Sbjct  220  PLFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWN  279

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP  IFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  280  SIYFTVLGFLRFESPIDIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  339

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            ELIWVTILSTYSNEKSEARISE  VEA S+  +  P
Sbjct  340  ELIWVTILSTYSNEKSEARISEAPVEANSSSSNTSP  375



>ref|XP_010278296.1| PREDICTED: uncharacterized protein LOC104612557 [Nelumbo nucifera]
Length=379

 Score =   283 bits (723),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF LHGSLSHYYY FCEALFPF +WWVVPAKVAFDQT WSA+WN
Sbjct  222  PLFEFDRARMFRSGLVGFCLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTAWSAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ +LGFLRLESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  282  SIYYVILGFLRLESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEAR SE S+E  S  P  G  +
Sbjct  342  ELIWVTILSTYSNEKSEARNSEASLETKSISPLPGAEE  379



>ref|XP_011029433.1| PREDICTED: mpv17-like protein [Populus euphratica]
Length=370

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSG+ GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WN
Sbjct  212  PIFEFDRTRMFRSGIVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTMWAAAWN  271

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  272  SIYFTVLGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  331

Query  397  ELIWVTILSTYSNEKSEARISEESVEA  317
            ELIWVTILSTYSNEKSEARISE +VEA
Sbjct  332  ELIWVTILSTYSNEKSEARISEATVEA  358



>ref|XP_006650305.1| PREDICTED: peroxisomal membrane protein 2-like [Oryza brachyantha]
Length=238

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/150 (86%), Positives = 139/150 (93%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  84   PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVAFDQTAWSAMWN  143

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESP++ FSELK+TFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  144  SIYFVVLGFLRFESPSTTFSELKSTFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  203

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEAR SE++  A ++
Sbjct  204  ELIWVTILSTYSNEKSEARNSEDASTANAS  233



>ref|XP_006370309.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
 gb|ABK96261.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP66878.1| hypothetical protein POPTR_0001s41510g [Populus trichocarpa]
Length=369

 Score =   281 bits (719),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/147 (90%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE+DR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WN
Sbjct  212  PLFEYDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWN  271

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFT LGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  272  SIYFTALGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  331

Query  397  ELIWVTILSTYSNEKSEARISEESVEA  317
            ELIWVTILSTYSNEKSEARISE +VEA
Sbjct  332  ELIWVTILSTYSNEKSEARISEAAVEA  358



>ref|XP_011042502.1| PREDICTED: uncharacterized protein LOC105138177 [Populus euphratica]
Length=369

 Score =   280 bits (717),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 140/154 (91%), Gaps = 1/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE+DR RMFRSGL GFT HGSLSHYYY FCE LFPF DWWVVPAKVAFDQT+W+A WN
Sbjct  212  PLFEYDRTRMFRSGLVGFTFHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTLWAAAWN  271

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFT LGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  272  SIYFTALGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  331

Query  397  ELIWVTILSTYSNEKSEARISEESVEAT-SNPPS  299
            ELIWVTILSTYSNEKSEARISE +VEA+ S+ PS
Sbjct  332  ELIWVTILSTYSNEKSEARISEAAVEASFSSLPS  365



>ref|NP_001151402.1| mpv17 / PMP22 family protein [Zea mays]
 gb|ACG42715.1| mpv17 / PMP22 family protein [Zea mays]
 tpg|DAA50134.1| TPA: mpv17 / PMP22 family protein [Zea mays]
Length=353

 Score =   279 bits (713),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 4/151 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  199  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTVWSAIWN  258

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I+SELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  259  SIYFVVLGFLRLESPTTIYSELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  318

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            EL+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  319  ELVWVTILSTYSNEKSEARNS----DSTSTP  345



>ref|XP_010060525.1| PREDICTED: uncharacterized protein LOC104448413 [Eucalyptus grandis]
 gb|KCW67301.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=373

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVW+AIWN
Sbjct  214  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYEFCEELFPFQDWWVVPVKVAFDQTVWAAIWN  273

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+T LGFLRLESP +IF+ELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  274  SIYYTALGFLRLESPINIFTELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  333

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   EA     S+ P +
Sbjct  334  ELIWVTILSTYSNEKSEARIAEVPAEANPGAQSLNPPE  371



>ref|XP_002317517.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
 gb|EEE98129.2| hypothetical protein POPTR_0011s12440g [Populus trichocarpa]
Length=370

 Score =   279 bits (714),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSG+ GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT+W+A WN
Sbjct  212  PIFEFDRTRMFRSGVVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTLWAAAWN  271

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIFSEL ATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  272  SIYFTVLGFLRLESPASIFSELTATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  331

Query  397  ELIWVTILSTYSNEKSEARISEESVEA  317
            ELIWVTILSTYSNEKSEARISE +VEA
Sbjct  332  ELIWVTILSTYSNEKSEARISEATVEA  358



>gb|KCW67302.1| hypothetical protein EUGRSUZ_F01090 [Eucalyptus grandis]
Length=381

 Score =   280 bits (715),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVW+AIWN
Sbjct  214  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYEFCEELFPFQDWWVVPVKVAFDQTVWAAIWN  273

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+T LGFLRLESP +IF+ELKATFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  274  SIYYTALGFLRLESPINIFTELKATFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  333

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   EA     S+ P +
Sbjct  334  ELIWVTILSTYSNEKSEARIAEVPAEANPGAQSLNPPE  371



>gb|KDP38924.1| hypothetical protein JCGZ_00681 [Jatropha curcas]
Length=375

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF LHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  217  PLFEFDRARMFRSGLVGFMLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ V+GFLRL+SP +IFSEL+ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  277  SIYYIVVGFLRLDSPATIFSELRATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI E   EA SN  S G ++
Sbjct  337  ELIWVTILSTYSNEKSEARIPETQTEAGSNSLSKGSAE  374



>ref|XP_009378495.1| PREDICTED: uncharacterized protein LOC103966976 isoform X2 [Pyrus 
x bretschneideri]
Length=379

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RM RSGL GFTLHGSLSHYYY  CE L PF DWWVVPAKVAFDQTVW+AIWN
Sbjct  222  PLLEFDRTRMLRSGLVGFTLHGSLSHYYYQLCEELIPFQDWWVVPAKVAFDQTVWAAIWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  282  SIYFTVLGFLRFESPISIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            ELIWVTILSTYSNEKSEARISE   E  S+    GP
Sbjct  342  ELIWVTILSTYSNEKSEARISEAPAEGNSSSSDTGP  377



>ref|XP_009378494.1| PREDICTED: uncharacterized protein LOC103966976 isoform X1 [Pyrus 
x bretschneideri]
Length=380

 Score =   280 bits (715),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RM RSGL GFTLHGSLSHYYY  CE L PF DWWVVPAKVAFDQTVW+AIWN
Sbjct  222  PLLEFDRTRMLRSGLVGFTLHGSLSHYYYQLCEELIPFQDWWVVPAKVAFDQTVWAAIWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIFSELKATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  282  SIYFTVLGFLRFESPISIFSELKATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            ELIWVTILSTYSNEKSEARISE   E  S+    GP
Sbjct  342  ELIWVTILSTYSNEKSEARISEAPAEGNSSSSDTGP  377



>gb|AFW68287.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=294

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 141/153 (92%), Gaps = 4/153 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWN
Sbjct  140  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWN  199

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCV
Sbjct  200  SIYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCV  259

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            EL+WVTILSTYSNEKSEAR S    ++TS P +
Sbjct  260  ELVWVTILSTYSNEKSEARNS----DSTSTPAA  288



>ref|XP_008366686.1| PREDICTED: uncharacterized protein LOC103430324 [Malus domestica]
Length=374

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR+RM RSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQTVW+AIWN
Sbjct  216  PLFEFDRSRMLRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTVWAAIWN  275

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTV+GFLR ESP SIFSEL ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  276  SIYFTVVGFLRFESPISIFSELTATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  335

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            EL+WVTILSTYSNEKSEARISE   E  S+  +  P
Sbjct  336  ELVWVTILSTYSNEKSEARISEAPAEDISSSSNTSP  371



>ref|XP_010924060.1| PREDICTED: uncharacterized protein LOC105046999 isoform X1 [Elaeis 
guineensis]
Length=389

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 0/154 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSG+ GFTLHGSLSHYYY FCE+LFPF DWWVVPAKV FDQT W+AIWN
Sbjct  230  PLFDFDRARMFRSGVVGFTLHGSLSHYYYQFCESLFPFQDWWVVPAKVLFDQTAWAAIWN  289

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  290  SIYYAVLGFLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  349

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            EL+WVTILSTYSNEKSEAR SE   E+ + PP+V
Sbjct  350  ELVWVTILSTYSNEKSEARNSEAMSESNATPPAV  383



>ref|XP_004982515.1| PREDICTED: uncharacterized protein LOC101756875 [Setaria italica]
Length=356

 Score =   278 bits (710),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 4/154 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWN
Sbjct  202  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHVCEALFPFKDWWVVPAKVAFDQTIWSAIWN  261

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I+SELK+TFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  262  SIYFVVLGFLRLESPTTIYSELKSTFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  321

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            ELIWVTILSTYSNEKSEAR S    + TS P ++
Sbjct  322  ELIWVTILSTYSNEKSEARNS----DGTSTPDAL  351



>ref|XP_008800139.1| PREDICTED: uncharacterized protein LOC103714610, partial [Phoenix 
dactylifera]
Length=351

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWN
Sbjct  191  PLFDFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVLFDQTAWAAIWN  250

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  251  SIYYAVLGLLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  310

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            EL+WVTILSTYSNEKSEAR +E   E+ +  PS  P +
Sbjct  311  ELVWVTILSTYSNEKSEARNTEAMSESNAKSPSAIPEE  348



>gb|KJB62714.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=418

 Score =   278 bits (712),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 157/202 (78%), Gaps = 9/202 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ*TDRKPRSGEKIGGRSVCVLL  221
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +   RK    +   G   CV  
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPEAGHRKISQKQ---GEITCV-C  397

Query  220  FLSSDSILFVEGRGFGIYEWRR  155
            ++++   L+V+     +Y WR 
Sbjct  398  YVNAVFCLYVQ----KLYFWRH  415



>ref|XP_006366011.1| PREDICTED: protein SYM1-like [Solanum tuberosum]
Length=335

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+WSAIWN
Sbjct  177  PLLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWSAIWN  236

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLES ++IF EL+ATFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  237  SIYFVVLGFLRLESASNIFGELRATFWPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCV  296

Query  397  ELIWVTILSTYSNEKSEARISEESVEA  317
            EL+WVTILSTYSNEKSEARISEE  EA
Sbjct  297  ELVWVTILSTYSNEKSEARISEELSEA  323



>ref|XP_008681255.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=348

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 4/151 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWN
Sbjct  197  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWN  256

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCV
Sbjct  257  SIYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCV  316

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            EL+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  317  ELVWVTILSTYSNEKSEARNS----DSTSTP  343



>ref|NP_001136458.1| hypothetical protein [Zea mays]
 ref|XP_008681254.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF81975.1| unknown [Zea mays]
 gb|ACR38508.1| unknown [Zea mays]
 gb|ACR38595.1| unknown [Zea mays]
 gb|AFW68288.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
 gb|AFW68289.1| hypothetical protein ZEAMMB73_230689 [Zea mays]
Length=351

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 140/151 (93%), Gaps = 4/151 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWN
Sbjct  197  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWN  256

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I++ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCV
Sbjct  257  SIYFVVLGFLRLESPTTIYNELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCV  316

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            EL+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  317  ELVWVTILSTYSNEKSEARNS----DSTSTP  343



>gb|KHF98025.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=381

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF +LGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVILGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>gb|KJB62727.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=313

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  153  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  212

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  213  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  272

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  273  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  311



>gb|KDO74163.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=257

 Score =   273 bits (697),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  99   PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  158

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  159  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  218

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  219  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  256



>gb|EEC75642.1| hypothetical protein OsI_12389 [Oryza sativa Indica Group]
Length=369

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 141/154 (92%), Gaps = 2/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  201  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  260

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP +I SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  261  SIYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  320

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            ELIWVTILSTYSNEKSEAR SE++  +TSN  +V
Sbjct  321  ELIWVTILSTYSNEKSEARNSEDA--STSNASNV  352



>ref|NP_001050563.1| Os03g0583800 [Oryza sativa Japonica Group]
 gb|AAS07184.1| putative peroxisomal membrane protein [Oryza sativa Japonica 
Group]
 gb|ABF97327.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12477.1| Os03g0583800 [Oryza sativa Japonica Group]
 dbj|BAG89204.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94010.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 139/150 (93%), Gaps = 2/150 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  204  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  263

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP +I SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  264  SIYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  323

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  324  ELIWVTILSTYSNEKSEARNSEDA--STSN  351



>gb|KJB79961.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=345

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWN
Sbjct  188  PLFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWN  247

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIP+EQRLLWVDCV
Sbjct  248  SIYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPIEQRLLWVDCV  307

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E +++A SN  +  P +
Sbjct  308  ELIWVTILSTYSNEKSEARITEPTMDADSNSSNNPPEE  345



>gb|KFK35762.1| hypothetical protein AALP_AA4G033000 [Arabis alpina]
Length=352

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR+ RSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KV FDQTVWSAIWN
Sbjct  198  PLFEIDRARIVRSGLVGFTLHGSLSHYYYQFCEVLFPFQDWWVVPVKVVFDQTVWSAIWN  257

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  258  SIYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  317

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSE RIS+  +E +S  PS
Sbjct  318  ELIWVTILSTYSNEKSETRISDSVIETSSVDPS  350



>ref|XP_002466876.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
 gb|EER93874.1| hypothetical protein SORBIDRAFT_01g015680 [Sorghum bicolor]
Length=367

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 4/151 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYYH CEALFPF DWWVVPAKVAFDQT+WSAIWN
Sbjct  212  PIFDFDRARMFRSGLVGFTLHGSLSHYYYHICEALFPFKDWWVVPAKVAFDQTIWSAIWN  271

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT+I+ ELK+TFWPMLTAGWKLWPFAHL+TYGV+PVEQRLLWVDCV
Sbjct  272  SIYFVVLGFLRLESPTTIYGELKSTFWPMLTAGWKLWPFAHLVTYGVVPVEQRLLWVDCV  331

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            EL+WVTILSTYSNEKSEAR S    ++TS P
Sbjct  332  ELVWVTILSTYSNEKSEARNS----DSTSTP  358



>gb|KDO74161.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=367

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  267  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  326

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  327  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>ref|XP_009334618.1| PREDICTED: uncharacterized protein LOC103927419 [Pyrus x bretschneideri]
Length=379

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RM RSGL GFTLHGSLSHYYY FCE L PF DWWVVPAKVAFDQTVW+AIWN
Sbjct  221  PLFEFDRTRMLRSGLVGFTLHGSLSHYYYQFCEELIPFQDWWVVPAKVAFDQTVWAAIWN  280

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTV+GFLR ESP SIFSEL ATFWPMLTAGWKLWPFAHL+TYGVIPVEQRLLWVDCV
Sbjct  281  SIYFTVVGFLRFESPISIFSELTATFWPMLTAGWKLWPFAHLVTYGVIPVEQRLLWVDCV  340

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGP  290
            EL+WVTILSTYSNEKSEARISE   E  S+  +  P
Sbjct  341  ELVWVTILSTYSNEKSEARISEAPAEDISSSSNTSP  376



>gb|KDO74162.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=368

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  267  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  326

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  327  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>ref|XP_006464706.1| PREDICTED: uncharacterized protein LOC102611604 [Citrus sinensis]
 gb|KDO74156.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74157.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74158.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74159.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
 gb|KDO74160.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=365

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  267  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  326

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  327  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  364



>ref|XP_006447327.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 ref|XP_006491636.1| PREDICTED: uncharacterized protein LOC102614505 isoform X1 [Citrus 
sinensis]
 gb|ESR60567.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=346

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WN
Sbjct  189  PLFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWN  248

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ES  +IFSELK+TFWPMLTAGWKLWPFAHL+TY VIPVEQRLLWVDCV
Sbjct  249  SIYFVVLGFLRFESAANIFSELKSTFWPMLTAGWKLWPFAHLVTYSVIPVEQRLLWVDCV  308

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            ELIWVTILSTYSNEKSEARI E + EA S+  S+
Sbjct  309  ELIWVTILSTYSNEKSEARILEATTEANSDSSSI  342



>gb|KDO40771.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=346

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WN
Sbjct  189  PLFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWN  248

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ES  +IFSELK+TFWPMLTAGWKLWPFAHL+TY VIPVEQRLLWVDCV
Sbjct  249  SIYFVVLGFLRFESAANIFSELKSTFWPMLTAGWKLWPFAHLVTYSVIPVEQRLLWVDCV  308

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI E + EA S+  S+   +
Sbjct  309  ELIWVTILSTYSNEKSEARILEATTEANSDSSSISHEE  346



>ref|XP_009766316.1| PREDICTED: protein SYM1 [Nicotiana sylvestris]
Length=335

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+W+A+WN
Sbjct  177  PLLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWAAVWN  236

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLRLES  +IF ELK TFWPMLTAGWKLWPFAHLITYGVIP+EQRLLWVDC+
Sbjct  237  SIYYVVLGFLRLESAANIFGELKTTFWPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCI  296

Query  397  ELIWVTILSTYSNEKSEARISEESVEA  317
            EL+WVTILSTYSNEKSEARISEES+EA
Sbjct  297  ELVWVTILSTYSNEKSEARISEESLEA  323



>gb|KJB62726.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_010545803.1| PREDICTED: uncharacterized protein LOC104818056 [Tarenaya hassleriana]
Length=377

 Score =   275 bits (704),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARM RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQT WSAIWN
Sbjct  219  PLFEFDRARMLRSGLVGFTLHGSLSHFYYQFCEELFPFRDWWVVPVKVAFDQTAWSAIWN  278

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIF EL+ATF PMLTAGWKLWPFAHLITYG+IP+EQRLLWVDCV
Sbjct  279  SIYFTVLGFLRFESPISIFKELRATFLPMLTAGWKLWPFAHLITYGLIPLEQRLLWVDCV  338

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +++ TS+     PS+
Sbjct  339  ELIWVTILSTYSNEKSEARISEAAIDPTSSSTFTDPSK  376



>gb|KJB62715.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62716.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62717.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62722.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62728.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=382

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_006451942.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451943.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 ref|XP_006451946.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65182.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65183.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65186.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=368

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  210  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  269

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  270  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  329

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  330  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  367



>gb|KJB62719.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
 gb|KJB62725.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=380

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_009397791.1| PREDICTED: uncharacterized protein LOC103982557 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   276 bits (705),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/154 (84%), Positives = 139/154 (90%), Gaps = 2/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GF+LHGSLSHYYYHFCEALFPF DWW VPAKV FDQT WSAIWN
Sbjct  227  PLFDFDRARMFRSGLVGFSLHGSLSHYYYHFCEALFPFQDWWTVPAKVVFDQTAWSAIWN  286

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP +IF+EL+ATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  287  SIYYVVLGILRLESPANIFTELRATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  346

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSV  296
            ELIWVTILSTYSNEKSEAR S+ +++  SN  SV
Sbjct  347  ELIWVTILSTYSNEKSEARNSDATLD--SNVKSV  378



>ref|XP_010921049.1| PREDICTED: uncharacterized protein LOC105044749 [Elaeis guineensis]
Length=391

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 138/158 (87%), Gaps = 6/158 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWN
Sbjct  237  PLFDFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVVFDQTAWAAIWN  296

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ESP +IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  297  SIYYAVLGFLRFESPANIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  356

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            EL+WVTILSTYSNEKSEAR SE      SN PS  P +
Sbjct  357  ELVWVTILSTYSNEKSEARNSE------SNDPSAVPEE  388



>emb|CDY26037.1| BnaC06g05870D [Brassica napus]
Length=352

 Score =   274 bits (701),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  193  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWN  252

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  253  SIYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  312

Query  397  ELIWVTILSTYSNEKSEARISEESVEA-TSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE  +E  +S+   + PS+
Sbjct  313  ELIWVTILSTYSNEKSEARISESVIENPSSSTTPIDPSK  351



>gb|KJB62718.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=391

 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 139/159 (87%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILSTYSNEKSEARISEES-VEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARISE +  EA+S  P VGP +
Sbjct  342  ELIWVTILSTYSNEKSEARISEAAPAEASSILPPVGPPE  380



>ref|XP_009147654.1| PREDICTED: uncharacterized protein LOC103871177 [Brassica rapa]
Length=362

 Score =   274 bits (701),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  203  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWN  262

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF EL+ATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  263  SIYFTVLGFLRLESPLSIFKELEATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  322

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS-VGPSQ  284
            ELIWVTILSTYSNEKSEARISE  +E +S+  + + PS+
Sbjct  323  ELIWVTILSTYSNEKSEARISESVIENSSSSTTPIDPSK  361



>emb|CDY53804.1| BnaA06g01790D [Brassica napus]
Length=373

 Score =   274 bits (701),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  203  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPAKVAFDQTVWSAIWN  262

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  263  SIYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  322

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS-VGPSQ  284
            ELIWVTILSTYSNEKSEAR+SE  +E +S+  + + PS+
Sbjct  323  ELIWVTILSTYSNEKSEARLSESVIENSSSSTTPIDPSK  361



>ref|XP_006451944.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65184.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=380

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  210  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  269

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LRLESP SIFSELKATFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  270  SIYYMVLGLLRLESPFSIFSELKATFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  329

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSEARI+E   E     P + P +
Sbjct  330  ELIWVTILSTYSNEKSEARIAEAPAEVKPCLPDISPPE  367



>gb|KHG05370.1| Peroxisomal membrane 2 [Gossypium arboreum]
Length=362

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSH+YY FCEALFPF+DWWVVPAKV FDQTVW+AIWN
Sbjct  191  PLFDFDRTRMFRSGLVGFTLHGSLSHHYYQFCEALFPFNDWWVVPAKVIFDQTVWAAIWN  250

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDCV
Sbjct  251  SIYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPVEQRLLWVDCV  310

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS----NPPSV  296
            ELIWVTILSTYSNEKSEARI+E  ++A S    NPP V
Sbjct  311  ELIWVTILSTYSNEKSEARITEPMMDADSNSLNNPPEV  348



>ref|XP_010268765.1| PREDICTED: uncharacterized protein LOC104605628 [Nelumbo nucifera]
Length=386

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF+LHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+AIWN
Sbjct  228  PLFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEALFPFQDWWVVPAKVIFDQTAWAAIWN  287

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ +LGFLR ESP++IFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  288  SIYYVILGFLRFESPSNIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  347

Query  397  ELIWVTILSTYSNEKSEARISE  332
            EL+WVTILSTYSNEKSEAR SE
Sbjct  348  ELVWVTILSTYSNEKSEARNSE  369



>ref|XP_003562336.1| PREDICTED: uncharacterized protein LOC100846887 [Brachypodium 
distachyon]
Length=359

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WN
Sbjct  206  PIFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWN  265

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESP +IFSELK+TF+PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  266  SIYFVVLGFLRFESPVTIFSELKSTFFPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  325

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEARIS+ S    S   S
Sbjct  326  ELIWVTILSTYSNEKSEARISDASTSTDSQDNS  358



>ref|XP_006392859.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
 gb|ESQ30145.1| hypothetical protein EUTSA_v10011607mg [Eutrema salsugineum]
Length=359

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV FDQTVWSAIWN
Sbjct  206  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVFDQTVWSAIWN  265

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  266  SIYFTVLGFLRLESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  325

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            ELIWVTILSTYSNEKSEARISE  V+ + +P
Sbjct  326  ELIWVTILSTYSNEKSEARISESVVDTSIDP  356



>ref|XP_011039751.1| PREDICTED: protein SYM1 isoform X1 [Populus euphratica]
Length=352

 Score =   272 bits (696),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WN
Sbjct  192  PIFEFDRTRTFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWN  251

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+  +G LR ESP +IFSELKATFW MLTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  252  SIYYVAIGLLRFESPDNIFSELKATFWLMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCV  311

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEARIS+ ++EA S+
Sbjct  312  ELIWVTILSTYSNEKSEARISDTTLEANSS  341



>ref|XP_006371588.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
 gb|ERP49385.1| hypothetical protein POPTR_0019s13430g [Populus trichocarpa]
Length=349

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 137/150 (91%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R FRSGL GF+LHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WN
Sbjct  192  PIFEFDRTRTFRSGLVGFSLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAALWN  251

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+  LG LR ESP +IFSELKATFW MLTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  252  SIYYVALGLLRFESPDNIFSELKATFWLMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCV  311

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEARIS+ ++EA S+
Sbjct  312  ELIWVTILSTYSNEKSEARISDTTLEANSS  341



>ref|XP_011085340.1| PREDICTED: peroxisomal membrane protein 2 [Sesamum indicum]
Length=333

 Score =   270 bits (691),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 137/153 (90%), Gaps = 1/153 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFP  DWWVVPAKVAFDQ+VW+A+WN
Sbjct  178  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSKDWWVVPAKVAFDQSVWAAVWN  237

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+  LGFLRLESP +IF ELK+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  238  SIYYVALGFLRLESPVNIFGELKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  297

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            E+IWVTILSTYSNEKSE R+SE S +A + P S
Sbjct  298  EIIWVTILSTYSNEKSEMRMSEAS-DAEAGPSS  329



>ref|NP_564615.3| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAG52277.1|AC019018_14 unknown protein; 54928-56750 [Arabidopsis thaliana]
 gb|AAK60317.1|AF385726_1 At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AAN72239.1| At1g52870/F14G24_14 [Arabidopsis thaliana]
 gb|AEE32862.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=366

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  207  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  267  SIYFTVLGFLRFESPISIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  326

Query  397  ELIWVTILSTYSNEKSEARISEESVE  320
            ELIWVTILSTYSNEKSEARISE  +E
Sbjct  327  ELIWVTILSTYSNEKSEARISESVIE  352



>ref|XP_010675607.1| PREDICTED: protein SYM1-like [Beta vulgaris subsp. vulgaris]
Length=337

 Score =   269 bits (687),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 135/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RM RSGL GF LHGSLSHYYY  CEALFPF  WWVVP KVAFDQT+WSAIWN
Sbjct  183  PLFDFDRTRMVRSGLAGFALHGSLSHYYYEVCEALFPFQGWWVVPLKVAFDQTIWSAIWN  242

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG +RLESP SIF ELKATFWP+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  243  SIYFIVLGLMRLESPISIFKELKATFWPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  302

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEAR+SE S E+T + PS
Sbjct  303  ELIWVTILSTYSNEKSEARLSEASSESTISDPS  335



>ref|XP_007043533.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
 gb|EOX99364.1| Peroxisomal membrane 22 kDa family protein [Theobroma cacao]
Length=451

 Score =   273 bits (697),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 137/157 (87%), Gaps = 4/157 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQTVW+AIWN
Sbjct  294  PLFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVVFDQTVWAAIWN  353

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDCV
Sbjct  354  SIYYVVLGFLRFESSANIYRELKATFWPMLTAGWKLWPFAHMITYGVIPVEQRLLWVDCV  413

Query  397  ELIWVTILSTYSNEKSEARI----SEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEARI     EE   ++SNPP 
Sbjct  414  ELIWVTILSTYSNEKSEARILDARLEEDSSSSSNPPK  450



>ref|XP_006841712.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
 gb|ERN03387.1| hypothetical protein AMTR_s00003p00254020 [Amborella trichopoda]
Length=367

 Score =   270 bits (689),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKV FDQT W+A+WN
Sbjct  211  PLFEFDRARMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVLFDQTAWAAVWN  270

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            S+Y+ V+G LR ESP +IF ELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  271  SVYYVVVGLLRFESPANIFGELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  330

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEAR SE   E  +   S
Sbjct  331  ELIWVTILSTYSNEKSEARHSEALSEPNAKSSS  363



>ref|XP_004487310.1| PREDICTED: protein SYM1-like isoform X1 [Cicer arietinum]
Length=359

 Score =   269 bits (687),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN
Sbjct  164  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWN  223

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LRL+S T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  224  SIYFVVLGLLRLDSFTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  283

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNE S++R SEE  E  S+  S
Sbjct  284  ELIWVTILSTYSNENSQSRKSEEVSETMSSTSS  316



>ref|XP_004487311.1| PREDICTED: protein SYM1-like isoform X2 [Cicer arietinum]
Length=321

 Score =   267 bits (683),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN
Sbjct  164  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWN  223

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LRL+S T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  224  SIYFVVLGLLRLDSFTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  283

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNE S++R SEE  E  S+  S
Sbjct  284  ELIWVTILSTYSNENSQSRKSEEVSETMSSTSS  316



>gb|EMT03498.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WN
Sbjct  84   PIFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWN  143

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LGFLR ESP++I+ ELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCV
Sbjct  144  SIYFVALGFLRWESPSTIYKELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDCV  203

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEARI ++S    +   S
Sbjct  204  ELIWVTILSTYSNEKSEARILDDSSTTDTQDNS  236



>ref|XP_010522636.1| PREDICTED: protein SYM1 [Tarenaya hassleriana]
Length=316

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 134/153 (88%), Gaps = 4/153 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQT WSA+WN
Sbjct  162  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTAWSAVWN  221

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IY+ VLG LR ESP +IFSE+K TFWPMLTAGWKLWP AHLITYGVIP++QRLLWVDC+
Sbjct  222  TIYYVVLGLLRFESPANIFSEIKTTFWPMLTAGWKLWPLAHLITYGVIPIDQRLLWVDCI  281

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNE S+AR S    EA S+PPS
Sbjct  282  ELIWVTILSTYSNENSKARTS----EAKSSPPS  310



>ref|XP_010051673.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010051678.1| PREDICTED: uncharacterized protein LOC104440441 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89498.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89499.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
 gb|KCW89500.1| hypothetical protein EUGRSUZ_A01792 [Eucalyptus grandis]
Length=350

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFD  RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV FDQTVW+A+WN
Sbjct  200  PLFEFDPLRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVVFDQTVWAAVWN  259

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ +LG LRLESP +I +ELKATFWPMLTAGWKLWPFAHL+TYGVIP+EQRLLWVDCV
Sbjct  260  SIYYVMLGLLRLESPANILNELKATFWPMLTAGWKLWPFAHLVTYGVIPIEQRLLWVDCV  319

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNP  305
            ELIWVTILS YSN KSEARISE S   + +P
Sbjct  320  ELIWVTILSNYSNGKSEARISETSESNSGSP  350



>ref|XP_008455339.1| PREDICTED: mpv17-like protein [Cucumis melo]
Length=352

 Score =   266 bits (680),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/153 (81%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVVP KVAFDQTVWS +WN
Sbjct  192  PLFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVPVKVAFDQTVWSGVWN  251

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LR ES   I+ ELK+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  252  SIYYVVLGILRSESMNDIYGELKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  311

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSE RI E S       PS
Sbjct  312  ELIWVTILSTYSNEKSEGRIGEASTGENEASPS  344



>dbj|BAJ94190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95841.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=339

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WN
Sbjct  186  PIFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWN  245

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LGFLR ESP +IFSELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVDCV
Sbjct  246  SIYFVALGFLRWESPFTIFSELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDCV  305

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARI ++S
Sbjct  306  ELIWVTILSTYSNEKSEARILDDS  329



>emb|CDP14740.1| unnamed protein product [Coffea canephora]
Length=330

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 134/149 (90%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV  DQT+WSA+WN
Sbjct  182  PLFEFDRQRIFRSGLVGFTLHGSLSHYYYQFCEALFPFNDWWVVPAKVVVDQTLWSAVWN  241

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ES  SIF ELK+TFWPMLTAGWKLWPFAH+ITYGVIPVEQRLLWVDC+
Sbjct  242  SIYYVVLGFLRSESSASIFDELKSTFWPMLTAGWKLWPFAHVITYGVIPVEQRLLWVDCM  301

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILS +SNEKSEAR+SE + + +S
Sbjct  302  ELIWVTILSGFSNEKSEARLSEAAEDDSS  330



>gb|KEH38794.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=367

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/149 (83%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF LHGSLSHYYY FCE LFP+  WWVVP KVAFDQT WSA+WN
Sbjct  214  PLFEFDRARMFRSGLVGFALHGSLSHYYYQFCEELFPYKGWWVVPVKVAFDQTAWSAVWN  273

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+G LR +SP +IF+ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +
Sbjct  274  SIYYTVVGILRFDSPINIFNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDMI  333

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILSTYSNEKSEAR S ES+EA S
Sbjct  334  ELIWVTILSTYSNEKSEARSSSESIEAKS  362



>ref|XP_004248154.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
 ref|XP_010327063.1| PREDICTED: protein SYM1 [Solanum lycopersicum]
Length=335

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAKVAFDQT+WSAIWN
Sbjct  177  PLLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWVVPAKVAFDQTIWSAIWN  236

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLES ++IF EL+ATF PMLTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  237  SIYFVVLGFLRLESASNIFGELRATFLPMLTAGWKLWPFAHLITYGVIPLEQRLLWVDCV  296

Query  397  ELIWVTILSTYSNEKSEARI  338
            EL+WVTILSTYSNEKSEARI
Sbjct  297  ELVWVTILSTYSNEKSEARI  316



>ref|XP_002874865.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51124.1| hypothetical protein ARALYDRAFT_490222 [Arabidopsis lyrata subsp. 
lyrata]
Length=341

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQT+WSAIWN
Sbjct  160  PLFEFDRARVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTIWSAIWN  219

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TFWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  220  SIYFTVLGLLRFQSPADIFSEIKTTFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  279

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEK+EA+ S E+
Sbjct  280  ELIWVTILSTYSNEKAEAQASGET  303



>ref|XP_006305136.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
 gb|EOA38034.1| hypothetical protein CARUB_v10009510mg [Capsella rubella]
Length=366

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/139 (88%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  207  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLRLESP SIF ELKATF+PMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  267  SIYFTVLGFLRLESPISIFKELKATFFPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  326

Query  397  ELIWVTILSTYSNEKSEAR  341
            ELIWVTILSTYSNEKSEAR
Sbjct  327  ELIWVTILSTYSNEKSEAR  345



>ref|XP_010657274.1| PREDICTED: mpv17-like protein [Vitis vinifera]
 emb|CBI28907.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFD  RM RSGL GF+LHGSLSHYYY FCEALFP  DWWVVPAKV  DQTVW+AIWN
Sbjct  201  PLFEFDLTRMLRSGLVGFSLHGSLSHYYYQFCEALFPSKDWWVVPAKVVVDQTVWAAIWN  260

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+  LGFLR ESP +I+ E+K+TFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  261  SIYYVALGFLRRESPANIYGEVKSTFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  320

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILSTYSNEKSEARI+E + EA S
Sbjct  321  ELIWVTILSTYSNEKSEARITEATQEANS  349



>gb|KEH39092.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=318

 Score =   263 bits (672),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN
Sbjct  160  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWN  219

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+
Sbjct  220  TIYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCI  279

Query  397  ELIWVTILSTYSNEKSEARISEESVE-ATSNPPS  299
            ELIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  280  ELIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  313



>gb|EMS63851.1| Peroxisomal membrane protein 2 [Triticum urartu]
Length=238

 Score =   259 bits (663),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYYHFCE+LFPF DWW VP KVAFDQT WSA+WN
Sbjct  84   PIFEFDRTRMFRSGLVGFTLHGSLSHYYYHFCESLFPFKDWWAVPVKVAFDQTAWSALWN  143

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LGFLR ESP++I+ ELKATF+PMLTAGWKLWPFAHLITYGV+P+EQRLLWVD V
Sbjct  144  SIYFVALGFLRWESPSTIYKELKATFFPMLTAGWKLWPFAHLITYGVVPIEQRLLWVDSV  203

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARI ++S
Sbjct  204  ELIWVTILSTYSNEKSEARILDDS  227



>gb|KEH39091.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=339

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN
Sbjct  155  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWN  214

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+
Sbjct  215  TIYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCI  274

Query  397  ELIWVTILSTYSNEKSEARISEESVE-ATSNPPS  299
            ELIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  275  ELIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  308



>gb|EYU26133.1| hypothetical protein MIMGU_mgv1a009627mg [Erythranthe guttata]
Length=336

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+ DR RMFRSGL GFTLHGSLSHYYY FCE LFP+  WWVVP KVAFDQTVWSA+WN
Sbjct  178  PLFDIDRTRMFRSGLVGFTLHGSLSHYYYQFCEVLFPYKGWWVVPVKVAFDQTVWSAVWN  237

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VL  LRLESP  IF+EL+ATFWPMLTAGWKLWPFAH+ITYGV+PVEQRLLWVDC+
Sbjct  238  SIYFVVLALLRLESPVVIFNELRATFWPMLTAGWKLWPFAHVITYGVVPVEQRLLWVDCI  297

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILSTYSNEKSE RIS E+ E  S  PS   S+
Sbjct  298  ELIWVTILSTYSNEKSEVRIS-EAPEGESGSPSNNLSK  334



>gb|AAP40491.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01540.1| hypothetical protein [Arabidopsis thaliana]
Length=317

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  225  SIYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEK+EA+ SEE+
Sbjct  285  ELIWVTILSTYSNEKAEAQASEET  308



>gb|KEH39090.1| peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein [Medicago 
truncatula]
Length=344

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 135/154 (88%), Gaps = 1/154 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  WWVVPAKVAFDQTVWSAIWN
Sbjct  160  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWWVVPAKVAFDQTVWSAIWN  219

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IYF VLG LR +S  +I+ ELK+TF PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+
Sbjct  220  TIYFVVLGLLRFDSLDNIYGELKSTFLPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCI  279

Query  397  ELIWVTILSTYSNEKSEARISEESVE-ATSNPPS  299
            ELIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  280  ELIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  313



>ref|NP_192250.2| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AAU94426.1| At4g03410 [Arabidopsis thaliana]
 gb|AEE82315.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=317

 Score =   262 bits (670),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  225  SIYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEK+EA+ SEE+
Sbjct  285  ELIWVTILSTYSNEKAEAQASEET  308



>ref|NP_974505.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
 gb|AEE82316.1| peroxisomal membrane (Mpv17/PMP22) family protein [Arabidopsis 
thaliana]
Length=361

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TF PMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  225  SIYFTVLGLLRFQSPADIFSEIKTTFLPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEK+EA+ SEE+
Sbjct  285  ELIWVTILSTYSNEKAEAQASEET  308



>ref|XP_010500911.1| PREDICTED: mpv17-like protein [Camelina sativa]
Length=370

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  211  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWN  270

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  271  SIYFTVLGFLRFESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  330

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNEKSE RI
Sbjct  331  ELIWVTILSTYSNEKSETRI  350



>ref|XP_002891718.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67977.1| hypothetical protein ARALYDRAFT_474411 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV FDQTVWSAIWN
Sbjct  201  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVFDQTVWSAIWN  260

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIF ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  261  SIYFTVLGFLRFESPLSIFKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  320

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNEKSEARI
Sbjct  321  ELIWVTILSTYSNEKSEARI  340



>gb|ABR17136.1| unknown [Picea sitchensis]
Length=294

 Score =   260 bits (664),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
            FEF+R RMFRSGL GF+LHGSLSHYYY  CEALFPF  WWVVPAKVAFDQT+W+A+WNSI
Sbjct  135  FEFNRIRMFRSGLVGFSLHGSLSHYYYQLCEALFPFQGWWVVPAKVAFDQTIWAAVWNSI  194

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            YFTVLG LR ESP +IF ELKATFWP+LTAGWKLWPFAHLITYGV+PVEQRLLWVDCVEL
Sbjct  195  YFTVLGLLRFESPANIFGELKATFWPLLTAGWKLWPFAHLITYGVVPVEQRLLWVDCVEL  254

Query  391  IWVTILSTYSNEKSEARISE  332
            IWVTILSTYSNEKSEAR  E
Sbjct  255  IWVTILSTYSNEKSEARSLE  274



>ref|XP_003543349.1| PREDICTED: peroxisomal membrane protein 2 [Glycine max]
Length=322

 Score =   261 bits (666),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  225  SIYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARISE +
Sbjct  285  ELIWVTILSTYSNEKSEARISEAA  308



>ref|XP_010095804.1| Protein SYM1 [Morus notabilis]
 gb|EXB62272.1| Protein SYM1 [Morus notabilis]
Length=349

 Score =   261 bits (668),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 130/140 (93%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEF+R R+FRSGL GF LHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WN
Sbjct  193  PLFEFERTRVFRSGLVGFALHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWN  252

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LR ESP +I SELKATFWP+LTAGWKLWPFAHLITYGVIP+EQRLLWVDCV
Sbjct  253  SIYYFVLGLLRFESPANILSELKATFWPLLTAGWKLWPFAHLITYGVIPIEQRLLWVDCV  312

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNEKSE+RI
Sbjct  313  ELIWVTILSTYSNEKSESRI  332



>gb|KHN04274.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=332

 Score =   261 bits (666),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  225  SIYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARISE +
Sbjct  285  ELIWVTILSTYSNEKSEARISEAA  308



>gb|KHN36615.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=409

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  225  SIYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARISE +
Sbjct  285  ELIWVTILSTYSNEKSEARISEAA  308



>ref|XP_003539526.1| PREDICTED: peroxisomal membrane protein 2-like [Glycine max]
Length=322

 Score =   260 bits (664),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY  CEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQLCEALFPFQEWWVVPAKVAFDQTVWSAIWN  224

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LR ES T+I+ ELK+TF P+LTAGWKLWPFAHLITYGVIPVEQRLLWVDCV
Sbjct  225  SIYFVVLGLLRFESLTNIYGELKSTFLPLLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  284

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            ELIWVTILSTYSNEKSEARISE +
Sbjct  285  ELIWVTILSTYSNEKSEARISEAA  308



>ref|XP_009623041.1| PREDICTED: protein SYM1 [Nicotiana tomentosiformis]
Length=340

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/140 (83%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWW+VP KVAFDQT+W+A+WN
Sbjct  182  PLLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPSNDWWMVPVKVAFDQTIWAAVWN  241

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLRLES  +IF ELK TFWPMLTAGWKLWPFAHLITYGVIP++QRLLWVDC+
Sbjct  242  SIYYVVLGFLRLESAANIFGELKTTFWPMLTAGWKLWPFAHLITYGVIPLDQRLLWVDCI  301

Query  397  ELIWVTILSTYSNEKSEARI  338
            EL+WVTILSTYSNEKSEARI
Sbjct  302  ELVWVTILSTYSNEKSEARI  321



>ref|XP_006396570.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
 gb|ESQ38023.1| hypothetical protein EUTSA_v10028802mg [Eutrema salsugineum]
Length=323

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  171  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  230

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IYFTVLG LR +SP  +FSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  231  TIYFTVLGLLRFQSPAEVFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  290

Query  397  ELIWVTILSTYSNEKSEARISEESVEAT  314
            ELIWVTILSTYSNEK+EA+   E+  +T
Sbjct  291  ELIWVTILSTYSNEKAEAQALGETSSST  318



>gb|KFK30935.1| hypothetical protein AALP_AA6G045100 [Arabis alpina]
Length=316

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  164  PLFEFDRARVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  223

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IY+ VLG LR +SP ++F E+K  FWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  224  TIYYMVLGLLRFQSPANVFGEIKTKFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  283

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEK+EA   EE+  +T++
Sbjct  284  ELIWVTILSTYSNEKAEAGTLEETNSSTNS  313



>ref|XP_010462139.1| PREDICTED: uncharacterized protein LOC104742787 [Camelina sativa]
Length=370

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 125/140 (89%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  211  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWN  270

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SI  ELKATF PMLTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  271  SIYFTVLGFLRFESPLSIVKELKATFLPMLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  330

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNEKSE RI
Sbjct  331  ELIWVTILSTYSNEKSETRI  350



>ref|XP_010479814.1| PREDICTED: uncharacterized protein LOC104758621 [Camelina sativa]
Length=367

 Score =   260 bits (665),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KV +DQTVWSAIWN
Sbjct  208  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVVYDQTVWSAIWN  267

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLGFLR ESP SIF ELKATF+PMLTAGWKLWPFAHLITYGV+PVEQRLLWVDCV
Sbjct  268  SIYFTVLGFLRFESPLSIFKELKATFFPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDCV  327

Query  397  ELIWVTILSTYSNEKSEAR  341
            ELIWVTILSTYSNEKSE R
Sbjct  328  ELIWVTILSTYSNEKSETR  346



>ref|XP_006288235.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
 gb|EOA21133.1| hypothetical protein CARUB_v10001476mg [Capsella rubella]
Length=319

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGS SHYYY FCEALFPF +WWVVPAKVAFDQTVWSAIWN
Sbjct  169  PLFEFDRTRVLRSGLVGFTLHGSFSHYYYQFCEALFPFQEWWVVPAKVAFDQTVWSAIWN  228

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TFWPMLTAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  229  SIYFTVLGLLRFQSPADIFSEIKTTFWPMLTAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  288

Query  397  ELIWVTILSTYSNEKSEARISE  332
            ELIWVTILSTYSNEK EA+ SE
Sbjct  289  ELIWVTILSTYSNEKVEAQASE  310



>ref|XP_004137017.1| PREDICTED: uncharacterized protein LOC101214701 [Cucumis sativus]
 gb|KGN43598.1| hypothetical protein Csa_7G047330 [Cucumis sativus]
Length=353

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVV  KVAFDQTVWS +WN
Sbjct  193  PLFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVLVKVAFDQTVWSGVWN  252

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LR ES T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVD V
Sbjct  253  SIYYVVLGILRSESMTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDSV  312

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSE RIS+ S       PS
Sbjct  313  ELIWVTILSTYSNEKSEERISDASTGENEASPS  345



>ref|XP_009134349.1| PREDICTED: protein SYM1 [Brassica rapa]
Length=317

 Score =   258 bits (660),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 132/151 (87%), Gaps = 1/151 (1%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  167  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWN  226

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IY+TVLG LR +SP  +F E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  227  TIYYTVLGLLRFQSPAKVFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  286

Query  397  ELIWVTILSTYSNEKSEAR-ISEESVEATSN  308
            ELIWVTILSTYSNEK+EA+ I E +  +T +
Sbjct  287  ELIWVTILSTYSNEKAEAQTIGETNSSSTED  317



>ref|XP_010422462.1| PREDICTED: LOW QUALITY PROTEIN: mpv17-like protein [Camelina 
sativa]
Length=363

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 135/159 (85%), Gaps = 6/159 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR+R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAK+AFDQTVWSAIWN
Sbjct  172  PLFEFDRSRVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKIAFDQTVWSAIWN  231

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  232  SIYFTVLGLLRFQSPADIFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  291

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS------NPPS  299
            ELIWVTILSTYSNEK+EA   E++   +S       PPS
Sbjct  292  ELIWVTILSTYSNEKAEAPALEKTNSNSSEVCQLLRPPS  330



>ref|XP_004487676.1| PREDICTED: uncharacterized protein LOC101505712 [Cicer arietinum]
Length=366

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSG+ GF LHGSLSHYYY FCE LFP+ +WWVVP KVAFDQT WSA+WN
Sbjct  213  PLFEFDRARMFRSGIVGFALHGSLSHYYYQFCEELFPYKEWWVVPVKVAFDQTAWSAVWN  272

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+G LRL+SP +IF+EL ATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +
Sbjct  273  SIYYTVVGLLRLDSPINIFNELTATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDMI  332

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILSTYSNEKSEARIS    +  S
Sbjct  333  ELIWVTILSTYSNEKSEARISSVPADVNS  361



>emb|CDY48204.1| BnaCnng15950D [Brassica napus]
Length=331

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  169  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWN  228

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IY+TVLG LR +SP  IF E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  229  TIYYTVLGLLRFQSPDKIFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  288

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILSTYSNEK+EA+   E+  +++
Sbjct  289  ELIWVTILSTYSNEKAEAQTMGETNSSST  317



>ref|XP_010455892.1| PREDICTED: protein SYM1-like [Camelina sativa]
Length=322

 Score =   258 bits (658),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR+R+ RSGL GFTLHGSLSHYYY FCEALFPF +WWVVPAK+AFDQTVWSAIWN
Sbjct  172  PLFEFDRSRVVRSGLVGFTLHGSLSHYYYQFCEALFPFQEWWVVPAKIAFDQTVWSAIWN  231

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYFTVLG LR +SP  IFSE+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  232  SIYFTVLGLLRFQSPADIFSEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  291

Query  397  ELIWVTILSTYSNEKSEA  344
            ELIWVTILSTYSNEK+EA
Sbjct  292  ELIWVTILSTYSNEKAEA  309



>ref|XP_004304121.1| PREDICTED: protein SYM1 [Fragaria vesca subsp. vesca]
Length=341

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GF+LHGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  183  PLLEFDRTRMFRSGLVGFSLHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  242

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LG LR ESP  IF ELKATF PMLTAGWKLWPFAHL+TYG+IP+EQRLLWVDCV
Sbjct  243  SIYFVALGLLRFESPNKIFDELKATFRPMLTAGWKLWPFAHLVTYGLIPLEQRLLWVDCV  302

Query  397  ELIWVTILSTYSNEKSEARISE  332
            ELIWVTILSTYSNEKSEA I E
Sbjct  303  ELIWVTILSTYSNEKSEATILE  324



>ref|XP_007149878.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
 gb|ESW21872.1| hypothetical protein PHAVU_005G106400g [Phaseolus vulgaris]
Length=316

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/140 (85%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRAR+ RSGL GFTLHGSLSHYYY  CEALFPF++WWVVPAKVAFDQTVWSAIWN
Sbjct  159  PLFEFDRARLLRSGLVGFTLHGSLSHYYYQLCEALFPFEEWWVVPAKVAFDQTVWSAIWN  218

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLG LR ES T+I+ ELK+TF+P+LTAGWKLWPFAHLITYG+IPVEQRLLWVDCV
Sbjct  219  SIYFVVLGLLRFESLTNIYGELKSTFFPLLTAGWKLWPFAHLITYGLIPVEQRLLWVDCV  278

Query  397  ELIWVTILSTYSNEKSEARI  338
            EL+WVTILSTYSNEKSE RI
Sbjct  279  ELVWVTILSTYSNEKSETRI  298



>ref|XP_010687649.1| PREDICTED: uncharacterized protein LOC104901742 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   258 bits (659),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P ++FDRARM RSG+TGF LHGS+SH+YY FCEA+FP   WW +P K  FDQT+W+ IWN
Sbjct  214  PLYDFDRARMLRSGITGFALHGSMSHFYYDFCEAVFPVKGWWTIPLKAGFDQTIWTGIWN  273

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
             IYF  LG +R ESP +IF ELKATFWP+L AGWKLWPFAH++TYGVIPVEQRLLWVDCV
Sbjct  274  CIYFIALGLMRFESPATIFKELKATFWPLLRAGWKLWPFAHIVTYGVIPVEQRLLWVDCV  333

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            ELIWVTILSTYSNEKSEARISE S EATS+ PS
Sbjct  334  ELIWVTILSTYSNEKSEARISEASAEATSSDPS  366



>emb|CDX90887.1| BnaA03g25670D [Brassica napus]
Length=328

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVWSAIWN
Sbjct  166  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEALFPFQDWWVVPAKVAFDQTVWSAIWN  225

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IY+TVLG LR +SP  +F E+K TFWPM+TAGWKLWP AHL+TYGVIPV+QRLLWVDC+
Sbjct  226  TIYYTVLGLLRFQSPAKVFGEIKTTFWPMITAGWKLWPLAHLVTYGVIPVDQRLLWVDCI  285

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            ELIWVTILSTYSNEK+EA+   E+  +++
Sbjct  286  ELIWVTILSTYSNEKAEAQTIGETNSSST  314



>ref|XP_008353524.1| PREDICTED: PXMP2/4 family protein 1-like [Malus domestica]
Length=352

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 127/140 (91%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVWSAIWN
Sbjct  194  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWN  253

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH+ITYG+IPVEQRLLWVDCV
Sbjct  254  SIYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVITYGLIPVEQRLLWVDCV  313

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNEK+++ +
Sbjct  314  ELIWVTILSTYSNEKADSSL  333



>ref|XP_004155526.1| PREDICTED: uncharacterized protein LOC101223761 [Cucumis sativus]
Length=375

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 134/166 (81%), Gaps = 4/166 (2%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GF+LHGSLSHYYY FCE LFPF DWWVV  KVAFDQTVWS +WN
Sbjct  193  PLFEFDRARMFRSGLVGFSLHGSLSHYYYQFCEILFPFKDWWVVLVKVAFDQTVWSGVWN  252

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLG LR ES T I+ ELK+TFWPMLTAGWKLWPFAHLITYGV+PVEQRLLWVD V
Sbjct  253  SIYYVVLGILRSESMTDIYGELKSTFWPMLTAGWKLWPFAHLITYGVVPVEQRLLWVDSV  312

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ*TDRKPRS  260
            ELIWVTILST+ NEKSE RIS    +A++      PS  +D+  R 
Sbjct  313  ELIWVTILSTFQNEKSEERIS----DASTGENEASPSSQSDKVSRK  354



>ref|XP_003543260.1| PREDICTED: uncharacterized protein LOC100786706 [Glycine max]
Length=376

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WN
Sbjct  217  PLFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +
Sbjct  277  SIYYTVVALLRLDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTI  336

Query  397  ELIWVTILSTYSNEKSEARISEESV  323
            ELIWVTILST+SNEKSEAR S+  V
Sbjct  337  ELIWVTILSTFSNEKSEARNSQSMV  361



>gb|KHN36788.1| Peroxisomal membrane protein 2 [Glycine soja]
Length=372

 Score =   256 bits (653),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 130/145 (90%), Gaps = 0/145 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WN
Sbjct  213  PLFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWN  272

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +
Sbjct  273  SIYYTVVALLRLDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTI  332

Query  397  ELIWVTILSTYSNEKSEARISEESV  323
            ELIWVTILST+SNEKSEAR S+  V
Sbjct  333  ELIWVTILSTFSNEKSEARNSQSMV  357



>ref|XP_003539587.1| PREDICTED: uncharacterized protein LOC100805057 [Glycine max]
Length=375

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSH+YY FCE LFP+ +WWVVPAKVAFDQT WSA+WN
Sbjct  217  PLFEFDRARMFRSGLVGFTLHGSLSHFYYQFCEELFPYKEWWVVPAKVAFDQTAWSALWN  276

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+  LR + P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD +
Sbjct  277  SIYYTVVALLRRDPPMSILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTI  336

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ  284
            ELIWVTILST+SNEKSEAR S+  V +     SV P +
Sbjct  337  ELIWVTILSTFSNEKSEARNSQSMVPSEVKSTSVYPPE  374



>ref|XP_007149619.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 ref|XP_007149620.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21613.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
 gb|ESW21614.1| hypothetical protein PHAVU_005G085000g [Phaseolus vulgaris]
Length=378

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 135/157 (86%), Gaps = 5/157 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSG+ GFTLHGSLSHYYY+FCE LFP+ +WWVVPAKVAFDQT WSAIWN
Sbjct  219  PLFEFDRARMFRSGIVGFTLHGSLSHYYYYFCEDLFPYKEWWVVPAKVAFDQTAWSAIWN  278

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+TV+  LRL+ P SI +ELKATF+PMLTAGWKLWPFAHLITYGVIPVEQRLLWVD V
Sbjct  279  SIYYTVVALLRLDPPISILNELKATFFPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDTV  338

Query  397  ELIWVTILSTYSNEKSEARISE-----ESVEATSNPP  302
            EL+WVTILST+SNEKSEA+ SE     E +  TS  P
Sbjct  339  ELVWVTILSTFSNEKSEAKSSESMMPTEVISTTSVQP  375



>gb|EMT31197.1| Peroxisomal membrane protein 2 [Aegilops tauschii]
Length=237

 Score =   249 bits (636),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTL GSLSHYYY+ CE++FP  DWW VP K AFDQT WS +WN
Sbjct  84   PIFEFDRARMFRSGLIGFTLQGSLSHYYYNLCESVFPCKDWWAVPVKAAFDQTAWSGLWN  143

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            +IYF  LGFLR ESP++IFSELK+TF+PMLTAGWKLWPFAHLITYGV+PVE RLLWVDCV
Sbjct  144  TIYFVALGFLRWESPSTIFSELKSTFFPMLTAGWKLWPFAHLITYGVVPVEHRLLWVDCV  203

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            E+IWVTILSTYSNEKSEARI ++S
Sbjct  204  EIIWVTILSTYSNEKSEARILDDS  227



>ref|XP_009357078.1| PREDICTED: uncharacterized protein LOC103947838 [Pyrus x bretschneideri]
Length=352

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  +FDR RMFRSGL GFT HGSLSH+YY FCEALFP +DWWVVPAK+AFDQTVWSAIWN
Sbjct  194  PLLDFDRKRMFRSGLVGFTFHGSLSHFYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWN  253

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH++TYG+IPVEQRLLWVDCV
Sbjct  254  SIYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVVTYGLIPVEQRLLWVDCV  313

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILSTYSNE +++ +
Sbjct  314  ELIWVTILSTYSNENADSSL  333



>ref|XP_008230247.1| PREDICTED: mpv17-like protein isoform X1 [Prunus mume]
Length=355

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP  IF ELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  315

Query  397  ELIWVTILSTY  365
            ELIWVTILSTY
Sbjct  316  ELIWVTILSTY  326



>ref|XP_008230248.1| PREDICTED: mpv17-like protein isoform X2 [Prunus mume]
Length=354

 Score =   252 bits (643),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP  IF ELKATFWPMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  315

Query  397  ELIWVTILSTY  365
            ELIWVTILSTY
Sbjct  316  ELIWVTILSTY  326



>ref|XP_008379554.1| PREDICTED: uncharacterized protein LOC103442533 [Malus domestica]
Length=352

 Score =   251 bits (640),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  +FDR RMFRSGL GFT HGSLSH+YY FCEALFP +DWWVVPAK+AFDQTVWSAIWN
Sbjct  194  PLLDFDRKRMFRSGLVGFTFHGSLSHFYYQFCEALFPLEDWWVVPAKIAFDQTVWSAIWN  253

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLR ESPT IF EL+ATF PMLTAGWKLWPFAH++TYG+IPVEQRLLWVDCV
Sbjct  254  SIYFVVLGFLRFESPTKIFDELRATFVPMLTAGWKLWPFAHVVTYGLIPVEQRLLWVDCV  313

Query  397  ELIWVTILSTYSNEKSEARI  338
            ELIWVTILST+SNE +++ +
Sbjct  314  ELIWVTILSTFSNENADSSL  333



>ref|XP_007217251.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
 gb|EMJ18450.1| hypothetical protein PRUPE_ppa007825mg [Prunus persica]
Length=354

 Score =   251 bits (640),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/131 (88%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESPT IF ELKATF PMLTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  256  SIYFVVLGFLRLESPTKIFDELKATFRPMLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  315

Query  397  ELIWVTILSTY  365
            ELIWVTILSTY
Sbjct  316  ELIWVTILSTY  326



>gb|KJB79964.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=348

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWN
Sbjct  188  PLFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWN  247

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIY+ VLGFLR ES  +I+ ELKATFWPMLTAGWKLWPFAH+ITYGVIP+EQRLLWVDCV
Sbjct  248  SIYYVVLGFLRFESSANIYKELKATFWPMLTAGWKLWPFAHVITYGVIPIEQRLLWVDCV  307

Query  397  ELIWVTILSTY  365
            ELIWVTILSTY
Sbjct  308  ELIWVTILSTY  318



>ref|XP_002966359.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
 gb|EFJ32386.1| hypothetical protein SELMODRAFT_66864, partial [Selaginella moellendorffii]
Length=236

 Score =   242 bits (617),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  +F R RM RSGL GF LHGSLSHYYYH CEALFPF +WWVVP KV FDQT+WSA WN
Sbjct  90   PVLDFSRTRMLRSGLVGFCLHGSLSHYYYHVCEALFPFKEWWVVPLKVGFDQTIWSAFWN  149

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            S+YF  LG LRLE+P +I SEL++TF+P+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  150  SVYFITLGLLRLENPVTIVSELRSTFFPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  209

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            EL+WVTILS YSNEK+EAR SE++
Sbjct  210  ELVWVTILSMYSNEKAEARSSEDA  233



>ref|XP_002978201.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
 gb|EFJ20858.1| hypothetical protein SELMODRAFT_56885, partial [Selaginella moellendorffii]
Length=236

 Score =   241 bits (616),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  +F R RM RSGL GF LHGSLSHYYYH CEALFPF +WWVVP KV FDQT+WSA WN
Sbjct  90   PVLDFSRTRMLRSGLVGFCLHGSLSHYYYHVCEALFPFKEWWVVPLKVGFDQTIWSAFWN  149

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            S+YF  LG LRLE+P +I SEL++TF+P+LTAGWKLWPFAHL+TYG+IPVEQRLLWVDCV
Sbjct  150  SVYFITLGLLRLENPVTIVSELRSTFFPLLTAGWKLWPFAHLVTYGLIPVEQRLLWVDCV  209

Query  397  ELIWVTILSTYSNEKSEARISEES  326
            EL+WVTILS YSNEK+EAR SE++
Sbjct  210  ELVWVTILSMYSNEKAEARSSEDA  233



>gb|EMS63743.1| Protein SYM1 [Triticum urartu]
Length=250

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 131/166 (79%), Gaps = 13/166 (8%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCE-------------ALFPFDDWWVVPAK  617
            P FEFDRARMFRSGL GFTL GSLSHYYY+FCE             ++FP+ DWW VP K
Sbjct  84   PIFEFDRARMFRSGLIGFTLQGSLSHYYYNFCEVTDTMNASTFLHQSVFPYKDWWAVPVK  143

Query  616  VAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGV  437
             AFDQTVWS +WN+IYF  LGFLR ESP++IF ELK+TF+PMLTAGWKLWPFAH+ITYGV
Sbjct  144  AAFDQTVWSGLWNTIYFVALGFLRWESPSTIFRELKSTFFPMLTAGWKLWPFAHIITYGV  203

Query  436  IPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            +P+E RLLWVDCVELIWVTILSTYSNEKSEAR  ++S    +   S
Sbjct  204  VPIEHRLLWVDCVELIWVTILSTYSNEKSEARTLDDSSTTDTRDNS  249



>gb|KJB62721.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=351

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF VLGFLRLESP SIF+E KATF PMLTAGWKLWPFAHLITYG IPVEQRLLWVDCV
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLTAGWKLWPFAHLITYGFIPVEQRLLWVDCV  341

Query  397  ELIWVTILST  368
            ELIWVTILST
Sbjct  342  ELIWVTILST  351



>ref|XP_001774069.1| predicted protein [Physcomitrella patens]
 gb|EDQ61121.1| predicted protein [Physcomitrella patens]
Length=268

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 120/148 (81%), Gaps = 0/148 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR+R+ RSGL GF LHG LSH+YYH CE LFPF  WWVVP KVAFDQT+WSA+WN
Sbjct  102  PVLEFDRSRLLRSGLVGFCLHGMLSHHYYHVCEFLFPFQGWWVVPLKVAFDQTIWSAVWN  161

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LG LR ESP  I  +L+ TF+P+LTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  162  SIYFVTLGLLRFESPVRILKDLRETFFPLLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  221

Query  397  ELIWVTILSTYSNEKSEARISEESVEAT  314
            E+IWVTILS +SNEKS+ R+     EA 
Sbjct  222  EIIWVTILSMFSNEKSQKRLESGEGEAV  249



>ref|XP_001765838.1| predicted protein [Physcomitrella patens]
 gb|EDQ69429.1| predicted protein, partial [Physcomitrella patens]
Length=225

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EF R R+ RSGL GF LHGSLSHYYYH CE LFPF  WWVVP KVAFDQT+WSAIWN
Sbjct  89   PVLEFSRVRLLRSGLVGFCLHGSLSHYYYHVCEFLFPFQGWWVVPVKVAFDQTIWSAIWN  148

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF  LG LR ESP  I  +L+ TF+P+LTAGWKLWPFAHLITYG++PVEQRLLWVDCV
Sbjct  149  SIYFITLGLLRFESPVRILKDLRETFFPLLTAGWKLWPFAHLITYGLVPVEQRLLWVDCV  208

Query  397  ELIWVTILSTYSNEKSE  347
            E++WVTILS ++NEK++
Sbjct  209  EILWVTILSVFANEKAQ  225



>dbj|BAD34004.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD36403.1| peroxisomal membrane protein-like [Oryza sativa Japonica Group]
Length=364

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 115/150 (77%), Gaps = 28/150 (19%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  236  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  295

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            SIYF                           AGWKLWPFAHL+TYG++PVEQRLLWVDCV
Sbjct  296  SIYF--------------------------VAGWKLWPFAHLVTYGLVPVEQRLLWVDCV  329

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSN  308
            ELIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  330  ELIWVTILSTYSNEKSEARNSEDA--STSN  357



>ref|XP_008386298.1| PREDICTED: uncharacterized protein LOC103448811 [Malus domestica]
Length=246

 Score =   213 bits (543),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = -3

Query  667  FCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPML  488
              + L PF DWWVVP KVAFDQTVW+AIWNSIYFTVLGFLR ES  SIFSELKATF PML
Sbjct  118  IAQELIPFQDWWVVPVKVAFDQTVWAAIWNSIYFTVLGFLRFESLISIFSELKATFLPML  177

Query  487  TAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSN  308
            TAGWKLWPFAHL+TYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISE   EA S+
Sbjct  178  TAGWKLWPFAHLVTYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEAPAEANSS  237

Query  307  PPSVGP  290
                GP
Sbjct  238  SSDTGP  243



>gb|AAT76331.1| putative peroxisomal membrane protein, 5'-partial [Oryza sativa 
Japonica Group]
Length=122

 Score =   206 bits (523),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 108/117 (92%), Gaps = 2/117 (2%)
 Frame = -3

Query  658  ALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAG  479
            ALFPF DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I SELK+TFWPMLTAG
Sbjct  1    ALFPFKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATISSELKSTFWPMLTAG  60

Query  478  WKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSN  308
            WKLWPFAHL+TYG++PVEQRLLWVDCVELIWVTILSTYSNEKSEAR SE++  +TSN
Sbjct  61   WKLWPFAHLVTYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARNSEDA--STSN  115



>gb|KDO74155.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=327

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = -3

Query  667  FCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPML  488
              + LFPF DWWVVPAKVAFDQT W+A WNSIY+ VLG LRLESP SIFSELKATFWPML
Sbjct  199  IAQELFPFQDWWVVPAKVAFDQTAWAAAWNSIYYMVLGLLRLESPFSIFSELKATFWPML  258

Query  487  TAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSN  308
            TAGWKLWPFAHL+TYG++PVEQRLLWVDCVELIWVTILSTYSNEKSEARI+E   E    
Sbjct  259  TAGWKLWPFAHLVTYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARIAEAPAEVKPC  318

Query  307  PPSVGPSQ  284
             P + P +
Sbjct  319  LPDISPPE  326



>gb|ABR25909.1| mpv17/pmp22 family protein [Oryza sativa Indica Group]
Length=118

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = -3

Query  646  FDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLW  467
            F DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I SELK+TFWPMLTAGWKLW
Sbjct  1    FKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATISSELKSTFWPMLTAGWKLW  60

Query  466  PFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEE-SVEATSNPPSV  296
            PFAHL+TYG++PVEQRLLWVDCVELIWVTILSTYSNEKSEAR SE+ S    SN  S+
Sbjct  61   PFAHLVTYGLVPVEQRLLWVDCVELIWVTILSTYSNEKSEARNSEDASTSNASNDNSI  118



>gb|EEE59413.1| hypothetical protein OsJ_11563 [Oryza sativa Japonica Group]
Length=155

 Score =   178 bits (451),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = -3

Query  700  LHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIF  521
            LH   +H       ALFPF DWWVVPAKV FDQT WSAIWNSIYF VLGFLRLESP +I 
Sbjct  30   LHTLQAHVANRLTAALFPFKDWWVVPAKVVFDQTAWSAIWNSIYFVVLGFLRLESPATIS  89

Query  520  SELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  383
            SELK+TFWPMLTAGWKLWPFAHL+TYG++PVEQRLLWVDCVELIWV
Sbjct  90   SELKSTFWPMLTAGWKLWPFAHLVTYGLVPVEQRLLWVDCVELIWV  135



>gb|EEE59409.1| hypothetical protein OsJ_11557 [Oryza sativa Japonica Group]
Length=195

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  93   PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  152

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP +I SELK+TFWPMLT
Sbjct  153  SIYFVVLGFLRLESPATISSELKSTFWPMLT  183



>gb|ABF97329.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=306

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 83/91 (91%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  204  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  263

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP +I SELK+TFWPMLT
Sbjct  264  SIYFVVLGFLRLESPATISSELKSTFWPMLT  294



>gb|KDO74164.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=314

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  449
            SIY+ VLG LRLESP SIFSELKATFWPMLT G     F HL+
Sbjct  267  SIYYMVLGLLRLESPFSIFSELKATFWPMLTGG----SFGHLL  305



>ref|XP_006451945.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
 gb|ESR65185.1| hypothetical protein CICLE_v10008646mg [Citrus clementina]
Length=317

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  210  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  269

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  449
            SIY+ VLG LRLESP SIFSELKATFWPMLT G     F HL+
Sbjct  270  SIYYMVLGLLRLESPFSIFSELKATFWPMLTGG----SFGHLL  308



>ref|XP_008230249.1| PREDICTED: uncharacterized protein LOC103329543 isoform X3 [Prunus 
mume]
Length=294

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTA  482
            SIYF VLGFLRLESP  IF ELKATFWPMLTA
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLTA  287



>gb|KDO40772.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=293

 Score =   172 bits (435),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 87/104 (84%), Gaps = 4/104 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WN
Sbjct  189  PLFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWN  248

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLIT  446
            SIYF VLGFLR ES  +IFSELK+TFWPMLT G     F HL+T
Sbjct  249  SIYFVVLGFLRFESAANIFSELKSTFWPMLTDG----SFGHLLT  288



>ref|XP_008230251.1| PREDICTED: uncharacterized protein LOC103329543 isoform X5 [Prunus 
mume]
Length=289

 Score =   171 bits (433),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTA  482
            SIYF VLGFLRLESP  IF ELKATFWPMLT+
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLTS  287



>ref|XP_008230252.1| PREDICTED: uncharacterized protein LOC103329543 isoform X6 [Prunus 
mume]
 ref|XP_008230253.1| PREDICTED: uncharacterized protein LOC103329543 isoform X7 [Prunus 
mume]
Length=286

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP  IF ELKATFWPMLT
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLT  286



>ref|XP_008230250.1| PREDICTED: uncharacterized protein LOC103329543 isoform X4 [Prunus 
mume]
Length=290

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/91 (85%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  EFDR RMFRSGL GFT HGSLSHYYY FCEALFP +DWWVVPAK+AFDQTVW+AIWN
Sbjct  196  PLLEFDRKRMFRSGLVGFTFHGSLSHYYYQFCEALFPLEDWWVVPAKIAFDQTVWAAIWN  255

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP  IF ELKATFWPMLT
Sbjct  256  SIYFVVLGFLRLESPAKIFDELKATFWPMLT  286



>gb|KJB79963.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
 gb|KJB79965.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=287

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWN
Sbjct  188  PLFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWN  247

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  449
            SIY+ VLGFLR ES  +I+ ELKATFWPMLT G     F HL+
Sbjct  248  SIYYVVLGFLRFESSANIYKELKATFWPMLTVG----SFGHLL  286



>ref|NP_564616.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
 gb|AAM61632.1| unknown [Arabidopsis thaliana]
 gb|AEE32861.1| peroxisomal membrane Mpv17/PMP22 family protein [Arabidopsis 
thaliana]
Length=306

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 83/103 (81%), Gaps = 4/103 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FE DRAR  RSGL GFTLHGSLSH+YY FCE LFPF DWWVVP KVAFDQTVWSAIWN
Sbjct  207  PLFEIDRARTLRSGLVGFTLHGSLSHFYYQFCEELFPFQDWWVVPVKVAFDQTVWSAIWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  449
            SIYFTVLGFLR ESP SIF ELKATF PMLT G     F HL+
Sbjct  267  SIYFTVLGFLRFESPISIFKELKATFLPMLTVG----SFGHLL  305



>gb|KDO74165.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=316

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVPAKVAFDQT W+A WN
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPAKVAFDQTAWAAAWN  266

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIY+ VLG LRLESP SIFSELKATFWPMLT
Sbjct  267  SIYYMVLGLLRLESPFSIFSELKATFWPMLT  297



>ref|XP_006447326.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
 gb|ESR60566.1| hypothetical protein CICLE_v10015813mg [Citrus clementina]
Length=287

 Score =   167 bits (424),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WN
Sbjct  189  PLFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWN  248

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWP  464
            SIYF VLGFLR ES  +IFSELK+TFWPMLT     +P
Sbjct  249  SIYFVVLGFLRFESAANIFSELKSTFWPMLTVRSSFFP  286



>ref|XP_011039752.1| PREDICTED: uncharacterized protein LOC105136210 isoform X2 [Populus 
euphratica]
Length=291

 Score =   167 bits (423),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 85/103 (83%), Gaps = 4/103 (4%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR R FRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKVAFDQTVW+A+WN
Sbjct  192  PIFEFDRTRTFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVAFDQTVWAAVWN  251

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLI  449
            SIY+  +G LR ESP +IFSELKATFW MLT G     F HL+
Sbjct  252  SIYYVAIGLLRFESPDNIFSELKATFWLMLTDG----SFGHLL  290



>gb|KDO40773.1| hypothetical protein CISIN_1g019056mg [Citrus sinensis]
Length=287

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FD  RMFRSGL GFTLHGSLSHYYY FCEALFPF DWWVVPAKVAFDQTVW+A+WN
Sbjct  189  PLFDFDLQRMFRSGLVGFTLHGSLSHYYYKFCEALFPFQDWWVVPAKVAFDQTVWAAVWN  248

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLR ES  +IFSELK+TFWPMLT
Sbjct  249  SIYFVVLGFLRFESAANIFSELKSTFWPMLT  279



>gb|KJB62720.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=316

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>gb|KJB79962.1| hypothetical protein B456_013G074900 [Gossypium raimondii]
Length=303

 Score =   166 bits (419),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P F+FDR RMFRSGL GFTLHGSLSHYYY FCEALFP DDWWVVPAKV FDQTVW+AIWN
Sbjct  188  PLFDFDRTRMFRSGLVGFTLHGSLSHYYYQFCEALFPSDDWWVVPAKVIFDQTVWAAIWN  247

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIY+ VLGFLR ES  +I+ ELKATFWPMLT
Sbjct  248  SIYYVVLGFLRFESSANIYKELKATFWPMLT  278



>gb|KJB62723.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=317

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>gb|KJB62724.1| hypothetical protein B456_009G432500 [Gossypium raimondii]
Length=339

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE LFPF DWWVVP KVAFDQT W+A+WN
Sbjct  222  PLFEFDRMRMFRSGLVGFTLHGSLSHYYYQFCEELFPFQDWWVVPVKVAFDQTAWAAVWN  281

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIYF VLGFLRLESP SIF+E KATF PMLT
Sbjct  282  SIYFVVLGFLRLESPISIFNEWKATFLPMLT  312



>ref|XP_010051684.1| PREDICTED: uncharacterized protein LOC104440441 isoform X2 [Eucalyptus 
grandis]
Length=292

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFD  RMFRSGL GFTLHGSLSHYYY FCEALFPF+DWWVVPAKV FDQTVW+A+WN
Sbjct  200  PLFEFDPLRMFRSGLVGFTLHGSLSHYYYQFCEALFPFEDWWVVPAKVVFDQTVWAAVWN  259

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
            SIY+ +LG LRLESP +I +ELKATFWPMLT
Sbjct  260  SIYYVMLGLLRLESPANILNELKATFWPMLT  290



>gb|ABF97328.1| peroxisomal membrane protein, putative, expressed [Oryza sativa 
Japonica Group]
Length=301

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVVPAKV FDQT WSAIWN
Sbjct  204  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVPAKVVFDQTAWSAIWN  263

Query  577  SIYFTVLGFLRLESPTSIFSELK  509
            SIYF VLGFLRLESP +I S L+
Sbjct  264  SIYFVVLGFLRLESPATISSRLE  286



>ref|XP_002183832.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44501.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=228

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 96/146 (66%), Gaps = 5/146 (3%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFP----FDDWWVVPAKVAFDQTVWSAIW  581
            + DR R+ RS L G   HG LSH++Y+ C+  F     +  WW    KV  DQT W  IW
Sbjct  83   DLDRGRIVRSMLAGLIGHGPLSHFWYNVCDHFFDNVLHWTAWWSFFPKVVVDQTTWGPIW  142

Query  580  NSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDC  401
            N+ Y  +LG ++LE   +I+S++K T  P++ +G KLWP AH +TYG++PVE RLLWVD 
Sbjct  143  NNTYILLLGLMKLEKLETIWSDMKRTTVPLILSGLKLWPLAHCVTYGLVPVENRLLWVDA  202

Query  400  VELIWVTILSTYSNEK-SEARISEES  326
            VE++WVTIL+T + E  ++A++  +S
Sbjct  203  VEILWVTILATTAAEAHADAKVDTKS  228



>emb|CBJ48801.1| conserved unknown protein [Ectocarpus siliculosus]
Length=283

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF----DDWWVVPAKVAFDQTVWSAIWN  578
             +R R+ RS + G  LHG LSH +Y+ CE LF      D WWV   K+  DQ +W   WN
Sbjct  137  IERQRVVRSAIAGLLLHGPLSHVWYNVCEGLFDIVGWNDYWWVPAPKIITDQLLWGPAWN  196

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
            ++Y   LG L  +S   I+  + +T  P++ AG +LWP AH++TYG++P E RLLWVD V
Sbjct  197  AVYIAFLGVLNKDSSAVIWEAITSTALPLVIAGIRLWPLAHVVTYGLVPKENRLLWVDAV  256

Query  397  ELIWVTILSTYSNEKSEARISEESVEATS  311
            E+IWVTILS+ + E  +AR   E  E+TS
Sbjct  257  EIIWVTILSSQAAE--QARSPAEQEESTS  283



>ref|XP_002176482.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC42532.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=170

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 4/131 (3%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFP----FDDWWVVPAKVAFDQTVWSAIW  581
            + DR R+ RS L G   HG LSH++Y+ C+  F     +  WW    KV  DQT W  IW
Sbjct  38   DLDRGRIVRSMLAGLIGHGPLSHFWYNVCDHFFDNVLHWTAWWSFFPKVVVDQTTWGPIW  97

Query  580  NSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDC  401
            N+ Y  +LG ++LE   +I+S++K T  P++ +G KLWP AH +TYG++PVE RLLWVD 
Sbjct  98   NNTYILLLGLMKLEKLETIWSDMKRTTVPLILSGLKLWPLAHCVTYGLVPVENRLLWVDA  157

Query  400  VELIWVTILST  368
            VE++WVTIL+T
Sbjct  158  VEILWVTILAT  168



>gb|EWM29375.1| peroxisomal membrane 22 kda (mpv17 pmp22) family protein [Nannochloropsis 
gaditana]
Length=430

 Score =   140 bits (352),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 8/154 (5%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF---DDWWVVPAKVAFDQTVWSAIWN  578
            E DR R+ RSG+ GF  HG LSH++Y   E  F +   + WW    K+  DQ VWS IWN
Sbjct  208  EIDRGRVARSGIAGFVGHGPLSHWWYGVSEDFFGWLGWEGWWTTFPKITVDQLVWSPIWN  267

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
              Y  +LG ++ E+   I + +K+T + ++T+G KLWP AH++TYGVIPVE RLLWVD V
Sbjct  268  GCYIFLLGAMKREALGEIVNTVKSTSFSLITSGLKLWPLAHVVTYGVIPVENRLLWVDLV  327

Query  397  ELIWVTILS----TYSNEKSEARISEESVEATSN  308
            E++WVTILS        EK+EA I + +VE  S+
Sbjct  328  EILWVTILSREAANADAEKAEA-IGDVAVEEASS  360



>ref|XP_002294377.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88211.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=211

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 85/130 (65%), Gaps = 4/130 (3%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALF----PFDDWWVVPAKVAFDQTVWSAIW  581
            E DR R+ RS + G   HG +SH +YH  E  F        WW    KV  DQT +  IW
Sbjct  82   EVDRWRVGRSLMAGLIGHGPMSHVWYHVSEDFFDNTLSLHAWWDFIPKVIVDQTFFGPIW  141

Query  580  NSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDC  401
            N+ Y  +LG ++L+SP+ IFS++K T  P++ +G KLWPF H ITYG+IPVE RLLWVD 
Sbjct  142  NNSYILLLGLMQLQSPSQIFSDMKRTTIPLIVSGLKLWPFVHCITYGLIPVENRLLWVDA  201

Query  400  VELIWVTILS  371
            VE++WVTIL+
Sbjct  202  VEIVWVTILA  211



>gb|EJK64618.1| hypothetical protein THAOC_14631 [Thalassiosira oceanica]
Length=347

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF-----DDWWVVPAKVAFDQTVWSAI  584
            + DR R+ RS + G   HG +SH +Y + EA F         WW    KV  DQ V+  +
Sbjct  193  DLDRPRIVRSMIAGLVGHGPMSHLWYRWSEAFFDKVVHLPHAWWDFVPKVCADQLVFGPL  252

Query  583  WNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVD  404
            WN+ +  ++GF++L SP  I+ E++ T  P+L +G KLWPF H++TYGVIPVE RLLWVD
Sbjct  253  WNNTFILLIGFMQLNSPGMIWDEMRRTTVPLLLSGLKLWPFVHIVTYGVIPVENRLLWVD  312

Query  403  CVELIWVTILSTYSNEKSEA----RISEESVE  320
             VE++WVTIL++ +NE  E     R+++E V+
Sbjct  313  AVEIVWVTILASVANEGGEGEEGQRLNQEDVD  344



>ref|XP_002509068.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70326.1| predicted protein [Micromonas sp. RCC299]
Length=384

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWNSIYF  566
            D  R  RSG+ GF +HG L HY+  + E    FD   W +P KV  DQT WS   NS Y 
Sbjct  139  DLKRSLRSGIAGFLIHGPLCHYWLMWTEENLSFDGALWAIPVKVFADQTAWSLFLNSAYT  198

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQRLLWVDCVELI  389
            T +  L+   P  I  E++AT+W  +TAGW+ WPF H++T+  +IP + +LL+VDCVE++
Sbjct  199  TCIMSLQGMGPERIKGEIQATWWNAITAGWRFWPFVHMLTFSPIIPQDFKLLFVDCVEVV  258

Query  388  WVTILSTYSNEKSE  347
            WVTILS   N  SE
Sbjct  259  WVTILSAAVNRDSE  272



>gb|AFK40557.1| unknown [Medicago truncatula]
Length=66

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = -3

Query  493  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEAT  314
            MLTAGWKLWPFAHLITYGVIPVEQRLLWVD +ELIWVTILSTYSNEKSEAR S ES+EA 
Sbjct  1    MLTAGWKLWPFAHLITYGVIPVEQRLLWVDMIELIWVTILSTYSNEKSEARSSSESIEAK  60

Query  313  S  311
            S
Sbjct  61   S  61



>ref|XP_009035372.1| hypothetical protein AURANDRAFT_4597, partial [Aureococcus anophagefferens]
 gb|EGB09882.1| hypothetical protein AURANDRAFT_4597, partial [Aureococcus anophagefferens]
Length=195

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWNSIYF  566
            D AR  RSG  GF  HG L H++  + EA   FD  W+    KV  DQTVWS   N++Y 
Sbjct  56   DLARSARSGAAGFVGHGPLCHFWMVWMEAHLDFDGAWYGTGFKVFADQTVWSLYLNAMYS  115

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQRLLWVDCVELI  389
             ++G   L +P  ++ ++KAT WP L + W+ WPF H I++  ++P++ +LLWVD +E++
Sbjct  116  FLIGSFALRNPRDVWEDVKATSWPALRSSWRFWPFVHTISFSHLVPLDLKLLWVDAMEIV  175

Query  388  WVTILSTYSNEKSEARISEE  329
            WVTILS  +N+   A++ E+
Sbjct  176  WVTILSKVANDDKVAKLDED  195



>gb|AFK33326.1| unknown [Medicago truncatula]
Length=71

 Score =   113 bits (282),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 60/66 (91%), Gaps = 1/66 (2%)
 Frame = -3

Query  493  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE-A  317
            MLTAGWKLWPFAHLITYGV+PVEQRLLWVDC+ELIWVTILSTYSNEKSE+R SEE  E A
Sbjct  1    MLTAGWKLWPFAHLITYGVVPVEQRLLWVDCIELIWVTILSTYSNEKSESRKSEEVSETA  60

Query  316  TSNPPS  299
             S+ PS
Sbjct  61   GSSTPS  66



>ref|XP_002530181.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF32195.1| conserved hypothetical protein [Ricinus communis]
Length=306

 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 0/67 (0%)
 Frame = -3

Query  484  AGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNP  305
            AGWKLWPFAHLITYGV+PVEQRLLWVDCVELIWVTILSTYSNEKSEARI+E   EATS+ 
Sbjct  169  AGWKLWPFAHLITYGVVPVEQRLLWVDCVELIWVTILSTYSNEKSEARIAETPAEATSSS  228

Query  304  PSVGPSQ  284
             S  P++
Sbjct  229  LSKSPAE  235



>ref|XP_003061699.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54329.1| predicted protein [Micromonas pusilla CCMP1545]
Length=427

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 83/134 (62%), Gaps = 2/134 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWNSIYF  566
            D  R  RSG+ GF +HG L HY+  + EA   FD  W+  P K+  DQT WS   NS Y 
Sbjct  187  DLKRSARSGVAGFLIHGPLCHYWLMWTEANLSFDGAWYGTPVKIIADQTAWSLFLNSAYT  246

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY-GVIPVEQRLLWVDCVELI  389
            T +  L+   P  I +E++AT++  ++AGWK WPF H  T+  +IP + +LL+VDCVE+I
Sbjct  247  TCIMSLQGFGPRRIKNEIQATWYNAISAGWKFWPFVHAFTFSSIIPQDFKLLFVDCVEVI  306

Query  388  WVTILSTYSNEKSE  347
            WVTILS   N  +E
Sbjct  307  WVTILSAAVNRDAE  320



>gb|AFK44918.1| unknown [Lotus japonicus]
Length=70

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/58 (88%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  493  MLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE  320
            MLTAGWKLWPF HL+TYGVIPVEQRLLWVD VELIWVTILSTYSNEKSE RISE   E
Sbjct  1    MLTAGWKLWPFVHLVTYGVIPVEQRLLWVDSVELIWVTILSTYSNEKSETRISEAGSE  58



>ref|XP_010924061.1| PREDICTED: uncharacterized protein LOC105046999 isoform X2 [Elaeis 
guineensis]
Length=328

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/61 (84%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = -3

Query  478  WKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVEATSNPPS  299
            WKLWPFAHLITYGVIPVEQRLLWVDCVEL+WVTILSTYSNEKSEAR SE   E+ + PP+
Sbjct  262  WKLWPFAHLITYGVIPVEQRLLWVDCVELVWVTILSTYSNEKSEARNSEAMSESNATPPA  321

Query  298  V  296
            V
Sbjct  322  V  322


 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF  644
            P F+FDRARMFRSG+ GFTLHGSLSHYYY FC  L+PF
Sbjct  230  PLFDFDRARMFRSGVVGFTLHGSLSHYYYQFCWKLWPF  267



>emb|CBJ27831.1| conserved unknown protein [Ectocarpus siliculosus]
Length=315

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 79/141 (56%), Gaps = 2/141 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD-WWVVPAKVAFDQTVWSAIWNSI  572
            + D  R  RS   G  +HG L H++    +    FD  WW    KV  DQTVWS   N+ 
Sbjct  136  DMDLMRTARSATAGLLIHGPLCHFWIELMQTYLDFDGAWWNFIPKVIADQTVWSVFLNAA  195

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY-GVIPVEQRLLWVDCVE  395
            Y T++  L+      ++ E+K+  WP LT+ W+ WP  H  ++   IP + +LL++DC+E
Sbjct  196  YSTMIMSLQGLPKEEVWGEVKSKAWPALTSSWRFWPLIHCCSFSNAIPKDLKLLFIDCME  255

Query  394  LIWVTILSTYSNEKSEARISE  332
            +IWVTILST +N   +A  +E
Sbjct  256  IIWVTILSTVANGDRQADPAE  276



>gb|EWM27713.1| peroxisomal membrane 22 kda (mpv17 pmp22) family protein [Nannochloropsis 
gaditana]
Length=570

 Score =   107 bits (267),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 90/153 (59%), Gaps = 5/153 (3%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
             +FD AR  R+GL G  + G L HYYY + + + P +       K+  DQ+V+     S 
Sbjct  221  LDFDLARTARNGLIG-AMFGPLVHYYYDWSDYILPMEVPVNRVLKLLMDQSVYFVAKCSA  279

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            Y  ++G LR ++P  +  ++K    P++  GW+ WP AH++TYGVIP   R+LWV+ ++L
Sbjct  280  YIALVGLLRGDTPAVVAQDVKERIQPVVFRGWRFWPLAHVVTYGVIPPRHRVLWVNMLDL  339

Query  391  IWVTILSTYSNEKSEARISEESVEATSNPPSVG  293
            +W +IL++ ++++ E    E++  A+S  P  G
Sbjct  340  LWSSILASLASKEGE----EDASTASSPVPETG  368



>gb|ACJ84917.1| unknown [Medicago truncatula]
Length=64

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -3

Query  472  LWPFAHLITYGVIPVEQRLLWVDCVELIWVTILSTYSNEKSEARISEESVE-ATSNPPS  299
            LWPFAHLITYGV+PVEQRLLWVDC+ELIWVTILSTYSNEKSE+R SEE  E A S+ PS
Sbjct  1    LWPFAHLITYGVVPVEQRLLWVDCIELIWVTILSTYSNEKSESRKSEEVSETAGSSTPS  59



>ref|XP_005783132.1| hypothetical protein EMIHUDRAFT_46294, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD30703.1| hypothetical protein EMIHUDRAFT_46294, partial [Emiliania huxleyi 
CCMP1516]
Length=173

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWV-VPAKVAFDQTVWSAIWNSI  572
             FD  R  RS L GF  HG   HY+  F +A          + AK+  DQTV+S   N +
Sbjct  41   RFDLRRAARSTLAGFVSHGPQLHYWCLFLDAQVRLGSAAATLVAKIVLDQTVFSLYLNGV  100

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            Y  ++  L+   P +++  ++A   P L + W+ WP+ H +TY V+P+  R+LWVDCVE+
Sbjct  101  YCALVEALKGAPPAAVWRRVRAAALPSLVSSWRFWPWVHALTYSVVPLHLRVLWVDCVEV  160

Query  391  IWVTILSTYSNE  356
            +WV+IL+T +++
Sbjct  161  VWVSILATCTSK  172



>gb|EAZ27617.1| hypothetical protein OsJ_11561 [Oryza sativa Japonica Group]
Length=332

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 58/102 (57%), Gaps = 20/102 (20%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFD---------  605
            P FEFDRARMFRSGL GFTLHGSLSHYYYHFCEALFPF DWWVV  K             
Sbjct  201  PIFEFDRARMFRSGLVGFTLHGSLSHYYYHFCEALFPFKDWWVVSRKRLCSIRRPGLRYG  260

Query  604  --QTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLT  485
               T WS  W S  +       +E+P          FWPMLT
Sbjct  261  TVSTSWS--WGSFVWNHRPLFPIEAPN-------PRFWPMLT  293



>ref|XP_002177278.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51741.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=226

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 74/134 (55%), Gaps = 2/134 (1%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDW-WVVPAKVAFDQTVWSAIWNS  575
             +FD +R  R+G  G    G L H YY F + + P +   W    K+  DQT++  +  S
Sbjct  94   LDFDASRTLRNGFIGLCF-GPLVHEYYQFSDHILPVEGGIWNRVEKILMDQTIYLTVKCS  152

Query  574  IYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  395
            +Y + +G L+ +  +++   +K     ++   WK WP  H ITY VIP + R+LWV+ V+
Sbjct  153  VYISAVGLLQGDDWSTVKQTVKHRIGGIVFTAWKFWPLVHCITYSVIPAQHRILWVNSVD  212

Query  394  LIWVTILSTYSNEK  353
            LIW  IL++ S ++
Sbjct  213  LIWNAILASMSQKE  226



>emb|CBN79011.1| peroxisomal membrane protein-related [Ectocarpus siliculosus]
Length=203

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 79/155 (51%), Gaps = 4/155 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  ++D  R  R G  G  +HG   HY+Y   +A  P      V +KVA DQT+W+ I+ 
Sbjct  41   PEDDYDFMRTLRLGTFGALVHGPTGHYFYGMLDAKLPGTKPMTVASKVAIDQTIWNPIFG  100

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
             ++FT LG    +S   I  ++K      +   W +W  AH I +  +P  QRLL+++ +
Sbjct  101  VMFFTYLGLAEGKSVDDIQKKIKNDLATAVMGSWTVWIPAHTINFKFVPTSQRLLYINTI  160

Query  397  ELIWVTILSTYSNEKSEARISEESVEATSNPPSVG  293
            ++ +   LS   N+K++    ++SV++   P   G
Sbjct  161  QIGYNIFLSFLGNKKAD----DDSVKSALVPADAG  191



>ref|XP_002183376.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45076.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=185

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 72/139 (52%), Gaps = 0/139 (0%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            +D  R FR G  GF LHG+  HY+Y F ++  P      V +KVA DQT+W+ I+  ++F
Sbjct  46   YDPMRTFRMGSFGFLLHGTTGHYFYGFLDSKLPGTAPMTVASKVAIDQTIWNPIFGCMFF  105

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
              L  +  +S     +++K      +   W +W  AH I +  +P  QRLL+++ +++ +
Sbjct  106  GYLNLMEGKSLDDYTTKIKTDLKTAVMGSWAVWVPAHTINFAFVPPAQRLLYINTIQIGY  165

Query  385  VTILSTYSNEKSEARISEE  329
               LS   N+  E    +E
Sbjct  166  NVFLSFLGNKSVEEEPKKE  184



>ref|XP_002287745.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED95188.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=217

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 5/132 (4%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAF----DQTVWSAI  584
             +FD AR  ++G  G    G   H YY F + + P D   +     AF    DQT++ +I
Sbjct  87   LDFDAARTLKNGFVGMCF-GPAVHEYYEFSDWILPVDGVTLGITNRAFKILMDQTIYLSI  145

Query  583  WNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVD  404
              SIY   +G L  ++  +    +K    P++   WK WP  H +TYG+IP   R+LWV+
Sbjct  146  KCSIYIMAIGVLNGDTVGNASQNVKNRIKPIMFTAWKFWPLVHCVTYGLIPARHRILWVN  205

Query  403  CVELIWVTILST  368
             V+L+W  IL++
Sbjct  206  SVDLVWNAILAS  217



>ref|XP_005707552.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
 gb|EME31032.1| peroxisomal membrane MPV17/PMP22-like protein [Galdieria sulphuraria]
Length=289

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (55%), Gaps = 1/135 (1%)
 Frame = -3

Query  733  RMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLG  554
            R+ R  L GF +HG   H +Y   +   P  + W V  KVA DQ +W+ I+  I+F  L 
Sbjct  155  RLLRMALFGFLIHGPTGHIFYTQLDKAIPGTEAWKVACKVAIDQVLWAPIFALIFFGFLA  214

Query  553  FLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTIL  374
             L  +S     ++L+  +   + A WK+WP AH I +  IP  QRLL+++ V++ +   L
Sbjct  215  VLERQSFKQFEAKLRQDWKTAIFASWKVWPLAHAINFRFIPSHQRLLYINAVQIFYNVFL  274

Query  373  STYSNEKSE-ARISE  332
            S   N++++  R+S+
Sbjct  275  SIIGNKRTQIPRVSK  289



>ref|XP_002287363.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94806.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=173

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 73/140 (52%), Gaps = 0/140 (0%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            +D  R  R G  GF +HG+  HY+Y F ++ FP      V  KV  DQT+W+ I+  ++F
Sbjct  30   YDVMRTVRLGSFGFFIHGTTGHYFYGFLDSKFPGTKPLTVATKVLIDQTIWNPIFGLMFF  89

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
              L  +  +S     +++KA     +   W +W  AH I +  IP +QRLL+++ +++ +
Sbjct  90   GYLNVMEGKSFEDYKNKIKADLKTAVMGSWAVWVPAHTINFAFIPPQQRLLYINSIQIGY  149

Query  385  VTILSTYSNEKSEARISEES  326
               LS   N+K E    ++ 
Sbjct  150  NVFLSFLGNKKVEGDAEKKE  169



>emb|CBN79193.1| conserved unknown protein [Ectocarpus siliculosus]
Length=295

 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 0/131 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             F  AR+ R    GF  HG++SH++Y+  ++  P      V  KV  DQ  W+ I+  I+
Sbjct  165  SFSYARLARMAAFGFLFHGTISHFFYNALDSALPGTAAMTVIQKVIIDQVFWAPIFTLIF  224

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            FT +G     SP+ I +++K+     +   W +WP AH I +  +P EQRLL+++ +++ 
Sbjct  225  FTWIGVTSGASPSEIVAKVKSDLVQGVVGSWTVWPLAHTINFKFVPTEQRLLYINSIQIF  284

Query  388  WVTILSTYSNE  356
            +   LS   ++
Sbjct  285  YNVFLSIIGSK  295



>ref|XP_005707818.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 ref|XP_005707819.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
 gb|EME31298.1| peroxisomal membrane MPV17/PMP22-like protein isoform 2 [Galdieria 
sulphuraria]
 gb|EME31299.1| peroxisomal membrane MPV17/PMP22-like protein isoform 1 [Galdieria 
sulphuraria]
Length=186

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 72/139 (52%), Gaps = 4/139 (3%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFD---DWWVVPAKVAFDQTVWSAIWNSI  572
            D  R  R    G  +HG + HY+Y F +     +       V  K A DQ +W+ I+ SI
Sbjct  47   DYMRTARFSAFGLCIHGPIGHYWYQFLDRTVMTNAPKSGLAVATKTAIDQLLWAPIFTSI  106

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +F+ +  +    P  +  E+K   WP +   W +WP AHLI +  +P  QR+L+++ V++
Sbjct  107  FFSFMKTVE-GHPDQVTEEVKTKLWPTMKVNWGVWPLAHLINFRFVPSSQRILYINSVQI  165

Query  391  IWVTILSTYSNEKSEARIS  335
             + T LST +  K++  +S
Sbjct  166  GYNTFLSTMAASKTKEEVS  184



>emb|CBJ27540.1| conserved unknown protein [Ectocarpus siliculosus]
Length=297

 Score = 88.2 bits (217),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 69/132 (52%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            E D  R+ +    G  +HGS  H++Y+F ++  P      V  KV  DQ +W+ I+  ++
Sbjct  166  EIDLPRLLKLASFGALIHGSSGHFFYNFLDSKIPGTAALTVAKKVFIDQVLWNPIFGCMF  225

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  +G +    P+ I  ++K   W  +   W +WP AH I + +IP  QRLL+++ +++ 
Sbjct  226  FGYMGAVDGMGPSGISEKIKNNLWTSVKGSWTVWPVAHAINFRMIPTSQRLLYINTIQIF  285

Query  388  WVTILSTYSNEK  353
            +   LS  +  +
Sbjct  286  YNCFLSVIAQRE  297



>gb|EJK58198.1| hypothetical protein THAOC_21696, partial [Thalassiosira oceanica]
Length=416

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 71/140 (51%), Gaps = 5/140 (4%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAF----DQTVWSAI  584
             +FD  R  R+GL G    G   H YY F + + P D   +     AF    DQ+++ ++
Sbjct  216  LDFDAGRTLRNGLIGACF-GPAVHEYYEFSDWILPVDGSTLGVTNRAFKILMDQSLYLSV  274

Query  583  WNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVD  404
              SIY   +G L  E        ++    P++   WK WP  H +TYG+IP   R+LWV+
Sbjct  275  KCSIYILAVGVLSGEGLEDSAENVRTRIKPIMFTAWKFWPLVHCVTYGLIPARHRILWVN  334

Query  403  CVELIWVTILSTYSNEKSEA  344
             V+L+W  IL+ ++++  + 
Sbjct  335  SVDLVWNAILAGFASDDEDG  354



>emb|CBJ31093.1| conserved unknown protein [Ectocarpus siliculosus]
Length=402

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 1/130 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            EFD  R  R+GL G    G + H+YY+F + + P       P K+  DQ+++     ++Y
Sbjct  237  EFDLQRTLRNGLIGACF-GPVVHFYYNFSDWVLPPSVPINRPFKIMLDQSIYFCSKCAVY  295

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
              ++  LR +S       +K     ++T GW+ WPF H+ TY +IP   R+LWV+CV+L+
Sbjct  296  ILLVSLLRGDSFEEARGTVKKKLKGVVTTGWRFWPFVHIFTYFLIPPRHRVLWVNCVDLL  355

Query  388  WVTILSTYSN  359
            W +IL+  ++
Sbjct  356  WSSILAGMTS  365



>ref|XP_005535986.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79700.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=312

 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 69/132 (52%), Gaps = 0/132 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            + D+ R+FR    GF +HGS  HY+Y F + +        V +KVA DQ +W+ I+ +I+
Sbjct  154  KLDKKRLFRMMSFGFLIHGSTGHYWYQFLDQMIKGTGVREVVSKVALDQLLWAPIFTAIF  213

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
                  L   S      ++KA  +  + A W +WP AH I +  +P  QRLL+++ +++ 
Sbjct  214  LGYTSLLSGASTEETVKKIKADTFTGVRASWSVWPVAHAINFRFVPPSQRLLYINSIQIA  273

Query  388  WVTILSTYSNEK  353
            +   LS  +  +
Sbjct  274  YNMFLSILATSR  285



>gb|EWM28134.1| mpv17-like protein [Nannochloropsis gaditana]
Length=289

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (51%), Gaps = 0/130 (0%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            D  R+ +    G  +HG   HY+Y F +   P      V +KVA DQ +W+ I+ +++F 
Sbjct  146  DLKRLLKLAFFGLLVHGPTGHYFYGFLDGKMPGTSAVTVASKVAIDQLLWNPIFGTMFFG  205

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  383
             LG    ++   I + ++   W  +   W +WP AH I +  IP  QRLL+++ V++ + 
Sbjct  206  WLGLTEGQNLEGIKNRIEKDLWASVKGSWTVWPIAHAINFRFIPNSQRLLYINSVQIGYN  265

Query  382  TILSTYSNEK  353
              LS  +N  
Sbjct  266  MFLSFLANRN  275



>ref|XP_005855482.1| hypothetical protein NGA_0131200 [Nannochloropsis gaditana CCMP526]
 gb|EKU20884.1| hypothetical protein NGA_0131200 [Nannochloropsis gaditana CCMP526]
Length=154

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (71%), Gaps = 5/85 (6%)
 Frame = -3

Query  550  LRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILS  371
            ++ E+   I + +K+T + ++T+G KLWP AH++TYGVIPVE RLLWVD VE++WVTILS
Sbjct  1    MKREALGEIVNTVKSTSFSLITSGLKLWPLAHVVTYGVIPVENRLLWVDLVEILWVTILS  60

Query  370  ----TYSNEKSEARISEESVEATSN  308
                    EK+EA I + +VE  S+
Sbjct  61   REAANADAEKAEA-IGDVAVEEASS  84



>gb|ACJ84916.1| unknown [Medicago truncatula]
Length=205

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPA  620
            P FEFDRAR+FRSGL GFTLHGSLSHYYY  CEALFPF  W   P 
Sbjct  160  PIFEFDRARLFRSGLVGFTLHGSLSHYYYQLCEALFPFQQWVGCPC  205



>gb|EJK66898.1| hypothetical protein THAOC_12131, partial [Thalassiosira oceanica]
Length=173

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 68/138 (49%), Gaps = 0/138 (0%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            +D  R  R G  GF +HG+  HY+Y F ++  P      V  KV  DQT+W+ I+  ++F
Sbjct  35   YDPMRTLRLGSFGFFVHGTTGHYFYGFLDSKLPGTKPQTVATKVLIDQTMWNPIFGLMFF  94

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
              L     +S      ++KA     +   W +W  AH I +  +P  QRLL+++ +++ +
Sbjct  95   GYLNVCEGKSFEEYTKKVKADLKTAVMGSWAVWVPAHTINFAFVPPSQRLLYINSIQIGY  154

Query  385  VTILSTYSNEKSEARISE  332
               LS   N+K +    E
Sbjct  155  NIFLSFLGNKKVDGEDKE  172



>gb|EWM28728.1| Mpv17/PMP22 [Nannochloropsis gaditana]
Length=254

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 68/132 (52%), Gaps = 0/132 (0%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
             D  R+ R    G  +HG + H++Y   +  FP  D   V  KV  DQ +W+ ++  I+F
Sbjct  123  LDVKRLLRLASFGLAVHGPVGHFFYGALDEKFPKKDAQTVAIKVLIDQVLWAPVFTVIFF  182

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
              +  L+      I  ++       +TA WK+WP  H+I +  IP +QRLL+++ +++ +
Sbjct  183  AWIEVLQGAGLQKIKQKINQDLVRGVTASWKVWPLVHVINFRFIPPQQRLLYINTIQIGY  242

Query  385  VTILSTYSNEKS  350
               LS  ++ K+
Sbjct  243  NVFLSMLASRKA  254



>ref|XP_005776476.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
 gb|EOD24047.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
Length=273

 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 71/135 (53%), Gaps = 0/135 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            +FD  R+FR    GF +HG+ SH++Y   ++  P      V  KV  DQ +W+ I   ++
Sbjct  138  DFDWYRLFRLASFGFLVHGTSSHWFYGMLDSAIPGKGAQPVFTKVFIDQVLWNPILGIMF  197

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F+ +  L  +    +  + +      +T  WK+WP AH I +  IP  QR+L+++ +++ 
Sbjct  198  FSYVACLEWKGLQYVIDKTRNELLRQVTGSWKVWPLAHAINFRFIPSSQRVLYINSIQIG  257

Query  388  WVTILSTYSNEKSEA  344
            +   LS  SN  +EA
Sbjct  258  YNCFLSLISNRDAEA  272



>gb|AAD11583.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAD14469.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB77826.1| hypothetical protein [Arabidopsis thaliana]
Length=236

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  529  SIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTILST  368
            ++   L   ++    AGWKLWP AHL+TYGVIPV+QRLLWVDC+ELIWVTILST
Sbjct  183  TLHGSLSHYYYQFCEAGWKLWPLAHLVTYGVIPVDQRLLWVDCIELIWVTILST  236


 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/34 (82%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEA  656
            P FEFDR R+ RSGL GFTLHGSLSHYYY FCEA
Sbjct  165  PLFEFDRTRVLRSGLVGFTLHGSLSHYYYQFCEA  198



>ref|XP_005706778.1| peroxisomal membrane protein-related protein [Galdieria sulphuraria]
 gb|EME30258.1| peroxisomal membrane protein-related protein [Galdieria sulphuraria]
Length=288

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 68/132 (52%), Gaps = 1/132 (1%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
            F ++  R F  G  GF   G   H +Y   E LFP    W    K+  DQT  +A +N  
Sbjct  157  FHWNIRRTFALGFWGFIFMGPFFHNWYLILERLFP-SGRWAFLKKIILDQTFAAAFFNIT  215

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +F   GFL   +   I  +L+  FWP + A W++WP    IT+ VIP+  R+LWV+ V +
Sbjct  216  FFLGTGFLEGHNWHLIVDKLRHKFWPTMYANWRVWPLVQCITFTVIPLTFRVLWVNVVTV  275

Query  391  IWVTILSTYSNE  356
            +WV   S+ ++ 
Sbjct  276  MWVIYFSSLAHS  287



>ref|XP_005538717.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82681.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=187

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 72/142 (51%), Gaps = 4/142 (3%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCE-ALFP--FDDWWVVPAKVAFDQTVWSAIWNSI  572
            D AR  R    G  LHG + HY+Y F +  + P        V +K+A DQ +W+ ++ S+
Sbjct  47   DAARTARMASFGLVLHGPIGHYWYEFLDRTIMPQASKSTAAVVSKMAIDQLLWAPVFTSL  106

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +F+ +       P      ++   WP L   W +WP AHLI +  IP  QR+L+++ V++
Sbjct  107  FFSYMQAAE-GKPERAPEVVREKLWPTLKVNWTVWPLAHLINFRFIPSSQRILYINTVQV  165

Query  391  IWVTILSTYSNEKSEARISEES  326
             +   LST +  K+   + + S
Sbjct  166  GYNAFLSTMAAAKTSVPVEKTS  187



>ref|XP_004359177.1| pmp22 family protein [Dictyostelium fasciculatum]
 gb|EGG21327.1| pmp22 family protein [Dictyostelium fasciculatum]
Length=194

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 67/137 (49%), Gaps = 0/137 (0%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
            FE+D  R       G    G + H++Y   + +F  +   VV  K+A DQ +++    S+
Sbjct  58   FEWDIGRTMTMSGVGLCFSGPVLHFWYRKLDRVFKGEGKIVVAKKLACDQLLFAPCVISV  117

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +  ++  L  +SP SI   +K    P L   W LWP A  +T+ VIP   R+L+V  V +
Sbjct  118  FMGIMDTLNHKSPNSILPRIKRDLPPALLVNWSLWPLAQTVTFSVIPPHLRVLFVSIVSV  177

Query  391  IWVTILSTYSNEKSEAR  341
             W   LS   N+K + +
Sbjct  178  FWNIFLSQLGNKKDDQQ  194



>ref|NP_001090480.1| uncharacterized protein LOC779393 [Xenopus laevis]
 gb|AAI23161.1| MGC154358 protein [Xenopus laevis]
Length=200

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 74/147 (50%), Gaps = 1/147 (1%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            +D  R  R G  GF +HG   HY+Y + +   P      V  KVA DQ +W+  +  ++F
Sbjct  48   YDLMRTVRLGSFGFLVHGPTGHYFYSWLDKQIPGTAMKTVATKVAIDQLLWNPCFGVMFF  107

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
            + LG    +S   I +++K      +   W +W  AH + +  +P  QRLL+++ +++ +
Sbjct  108  SYLGLAEGKSFADIQTKIKNDLTTAVVGSWTVWIPAHFVNFRFVPSSQRLLYINSIQIGY  167

Query  385  VTILSTYSNEK-SEARISEESVEATSN  308
               LS   N+K  E  + +E+  A ++
Sbjct  168  NIFLSFLGNKKVDEPEVVKEAEAAVTS  194



>gb|EWM26132.1| mpv17-like protein [Nannochloropsis gaditana]
 gb|EWM26133.1| mpv17-like protein [Nannochloropsis gaditana]
Length=190

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 0/133 (0%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            +D  R  R G  GF +HG   H++Y + +   P      V  KVA DQ +W+  +  ++F
Sbjct  48   YDLMRTVRLGSFGFLVHGPTGHFFYGWLDKQIPGTAMKTVATKVAIDQLLWNPCFGVMFF  107

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
            + LG    +S T I +++K      +   W +W  AH I +  +P  QRLL+++ +++ +
Sbjct  108  SYLGLAEGKSFTDIQAKIKNDLATAVVGSWTVWIPAHFINFRFVPSNQRLLYINSIQIGY  167

Query  385  VTILSTYSNEKSE  347
               LS   N+K +
Sbjct  168  NIFLSFLGNKKVD  180



>ref|XP_002291546.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED91653.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=131

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 70/131 (53%), Gaps = 0/131 (0%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            D  R+      GF  HG   HY+Y++ +   P  D   V +KVA DQ  W  I+ S++FT
Sbjct  1    DWKRLATLSFFGFIYHGPSGHYFYNWLDKKVPGTDAIPVFSKVAIDQLFWCPIFMSVFFT  60

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  383
             LG +  +S ++I ++++          WK+WP  HLI +  +P + R+ +++ V++ + 
Sbjct  61   YLGLVNGDSLSTIGNKIRNDLLTACKGSWKVWPIVHLINFKFVPNKWRIPYINAVQIAFN  120

Query  382  TILSTYSNEKS  350
              LS   ++K+
Sbjct  121  MFLSLLGSKKA  131



>ref|XP_009039118.1| hypothetical protein AURANDRAFT_29752, partial [Aureococcus anophagefferens]
 gb|EGB06165.1| hypothetical protein AURANDRAFT_29752, partial [Aureococcus anophagefferens]
Length=157

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            D AR  R    G   HG   HY+Y F + + P      V  KV  DQ  W+ I+  ++FT
Sbjct  1    DVARTARMATFGLLWHGPSGHYFYGFLDRMLPGTSMQTVFQKVGIDQIAWNPIFGVVFFT  60

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVE  395
             LG +  +S   I  ++KA     +T  W  W  AH + +  IP EQRLL+++   
Sbjct  61   SLGLMEGKSTDQIQDKIKADLPTAVTGSWAYWVPAHFVNFRFIPGEQRLLYINGAR  116



>ref|XP_005788772.1| hypothetical protein EMIHUDRAFT_122535 [Emiliania huxleyi CCMP1516]
 gb|EOD36343.1| hypothetical protein EMIHUDRAFT_122535 [Emiliania huxleyi CCMP1516]
Length=417

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/161 (30%), Positives = 77/161 (48%), Gaps = 24/161 (15%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPA-----------KVAFDQT  599
             D  R  R+   GF LHG L  ++ +  E   P  D    PA           K+A DQT
Sbjct  209  LDLRRCARNAALGFGLHGPLVFWWINVLEG--PLADLLGEPAGAAERWGGLLLKIALDQT  266

Query  598  VWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYG-VIPVEQ  422
             +SA+ N +Y ++ G L  +     F+  +    P + + W+ WP   LI+Y  ++P++ 
Sbjct  267  FFSALINLLYASLNGLLSGDGAVEAFARARRVLVPAMVSSWRFWPAVQLISYSPLVPLDF  326

Query  421  RLLWVDCVELIWVTILSTYSNEK----------SEARISEE  329
            +LLW+D +E++WV  LS   N             EAR++EE
Sbjct  327  KLLWIDTMEILWVAYLSATVNSAPGSEPEAVPWGEARLAEE  367



>ref|XP_009039064.1| hypothetical protein AURANDRAFT_29835, partial [Aureococcus anophagefferens]
 gb|EGB06108.1| hypothetical protein AURANDRAFT_29835, partial [Aureococcus anophagefferens]
Length=171

 Score = 77.4 bits (189),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/133 (29%), Positives = 71/133 (53%), Gaps = 1/133 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            +FD  R+ +    GF LHG+  HY+Y+F +++        V AKVA DQT+W+  +  ++
Sbjct  40   DFDLKRLVKMASFGFLLHGTTGHYFYNFLDSVMAGATPAFVAAKVAIDQTLWAPCFMVMF  99

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            FT +  L   +P  I ++ K   +  +   W  W  AH I +  +P + RLL+++ +++ 
Sbjct  100  FTYM-MLFDGTPELIATKCKNDIFTAVKGSWMTWIPAHTINFAFVPSDMRLLYINAIQIF  158

Query  388  WVTILSTYSNEKS  350
            +   +S   N+ +
Sbjct  159  FNMFMSVIGNKSA  171



>gb|KIY95774.1| Protein SYM1 [Monoraphidium neglectum]
Length=168

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 74/144 (51%), Gaps = 4/144 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCE-ALFPFD--DWWVVPAKVAFDQTVWSA  587
            P   FD  R+ R GL G  L G L   +Y + E A+FP    +   V AK   DQ V+++
Sbjct  14   PGAGFDVLRVARLGLYGLCLDGPLGSAWYDWLEGAVFPNSPTEAKAVAAKTLLDQVVYAS  73

Query  586  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  407
            I   ++F V+  L    P    S + A FWP L A W +WP AH++ +  +P + R+ + 
Sbjct  74   IGTGLFFAVITALE-GHPELAPSVVAAKFWPTLAANWAIWPAAHIVNFRFVPSQFRIAYN  132

Query  406  DCVELIWVTILSTYSNEKSEARIS  335
            + V + W+ +LS  ++    + I+
Sbjct  133  NVVAIGWLALLSAITHSHGPSLIN  156



>ref|XP_004345890.1| PXMP2/4 family protein 3, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR21346.1| PXMP2/4 family protein 3, putative [Acanthamoeba castellanii 
str. Neff]
Length=191

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 71/132 (54%), Gaps = 3/132 (2%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPF-DDWWVVPAKVAFDQTVWSAIWNSIY  569
             D  R++R    G  L   +SHY + + E LF F      V  K+A DQ V+  I+N ++
Sbjct  62   LDVGRLWRFTALGLLLS-PVSHYKFLWLENLFRFARGKTAVYGKLAIDQLVFGPIFNVLF  120

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            + ++  L  + P+++   +K+ FWP     WK+WP A  I++  +P E R+L+V+ V   
Sbjct  121  YVLMAILEGQ-PSAMGGLIKSNFWPTTVNSWKVWPIASFISFNYVPAELRVLFVNVVAFF  179

Query  388  WVTILSTYSNEK  353
            WV ILS  +  K
Sbjct  180  WVIILSGIAARK  191



>gb|KIY95410.1| Protein sym1 [Monoraphidium neglectum]
Length=293

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 77/152 (51%), Gaps = 4/152 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDD---WWVVPAKVAFDQTVWSA  587
            P    D  R+ R G  G  + G L   +Y + EA    D+      V  K A DQ V+++
Sbjct  137  PGASLDALRVLRLGAYGLCIDGPLGALWYDWLEANISPDNPKAMSTVLVKTALDQVVYAS  196

Query  586  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  407
            +  +++F+V+  +    P ++ + + A F P L A + +WP AHLI +  +P   R+ + 
Sbjct  197  VGTALFFSVITLME-GRPGAVPAVVAAKFLPTLAANYAIWPLAHLINFRFVPAPYRIAYN  255

Query  406  DCVELIWVTILSTYSNEKSEARISEESVEATS  311
            + V + W+T+LS  ++ K  + ++     ATS
Sbjct  256  NVVAIGWLTLLSAITHSKGSSVLTHLVGHATS  287



>ref|XP_007233539.1| PREDICTED: peroxisomal membrane protein 2-like [Astyanax mexicanus]
Length=194

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 69/130 (53%), Gaps = 0/130 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWN  578
            P  E D     R  + G  + G +SHY+YH  EALFP  + + +  ++  ++ V++  + 
Sbjct  62   PAKEVDIHGPVRFAVYGLVITGPISHYFYHLLEALFPAAEPYCMLKRLLLERLVFAPAFL  121

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
             ++FTV+  L  +S   +  ++K+ +WP L   WK+W     +    +PV+ R+L+ + +
Sbjct  122  MLFFTVMNALEGKSTAELQDKVKSRYWPALKMNWKVWTPFQFVNINFVPVQFRVLFANMI  181

Query  397  ELIWVTILST  368
             L W   L++
Sbjct  182  ALFWYAYLAS  191



>ref|XP_502197.1| YALI0C23815p [Yarrowia lipolytica]
 sp|Q6CAW5.1|SYM1_YARLI RecName: Full=Protein SYM1 [Yarrowia lipolytica CLIB122]
 emb|CAG82519.1| YALI0C23815p [Yarrowia lipolytica CLIB122]
Length=202

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 67/133 (50%), Gaps = 6/133 (5%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYF  566
            ++  R  R+G+       +++ ++    +   P      V AKVA DQ V++      YF
Sbjct  40   YEPMRTARAGIYACAFAPAMTAWFRFLGQQQLP------VIAKVAIDQAVFAPSSIGYYF  93

Query  565  TVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIW  386
            +V+G L  +SP +I+  LK  +W  L  GW +WP   L  +G++P   R+L  +C  L+W
Sbjct  94   SVMGLLEGKSPDTIWQSLKNQYWDTLKCGWMIWPAFQLFNFGIVPPNFRVLASNCCGLVW  153

Query  385  VTILSTYSNEKSE  347
             T L+  +  K E
Sbjct  154  NTFLAYQNANKME  166



>ref|XP_009040828.1| hypothetical protein AURANDRAFT_15607, partial [Aureococcus anophagefferens]
 gb|EGB04441.1| hypothetical protein AURANDRAFT_15607 [Aureococcus anophagefferens]
Length=168

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 62/126 (49%), Gaps = 0/126 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            ++D  R  R    G  +HG+ SH++Y   +   P      V +KV  DQ +W+ I+  ++
Sbjct  41   KYDIWRTIRFSSFGLLVHGTTSHWFYGKLDGKIPGTGAGAVASKVGIDQVLWNPIFGIMF  100

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  +G           +++K      +T  W +WP AH I +  IP  QR+L+++ +++ 
Sbjct  101  FGYMGIFEGSGVGGTITKIKNDLLTQVTGSWTVWPIAHAINFKFIPNSQRVLYINTIQIF  160

Query  388  WVTILS  371
            +   LS
Sbjct  161  YNCFLS  166



>ref|XP_005535923.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM79637.1| similar to peroxisomal membrane protein PMP22 [Cyanidioschyzon 
merolae strain 10D]
Length=330

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = -3

Query  709  GFTLHGSLSHYYYHFCEALF-----PFDDWWVVPAKVAFDQTVWSAIWNSIYFTVLGFLR  545
            G  + G + HY++ F + +            VV AKV  DQ ++S  +N++YF ++G L 
Sbjct  115  GLAIRGPIVHYFHQFLDRVVFARVTNQTQIAVVIAKVIIDQFIFSPPYNALYFLIIGLLE  174

Query  544  LESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVTIL  374
              S   I  +++   W ++   W +W  A++I+Y  IP+E R+LW + V +IW  IL
Sbjct  175  DRSLAEIGRKIRRELWGVMKTNWIVWTPANIISYYAIPLELRVLWGNLVGIIWTAIL  231



>ref|XP_005782690.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
 gb|EOD30261.1| putative peroxisomal membrane protein [Emiliania huxleyi CCMP1516]
Length=346

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 84/178 (47%), Gaps = 8/178 (4%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            +FD  R+FR    GF +HG+ SH++Y   ++  P      V  KV  DQ +W+ I+  ++
Sbjct  138  DFDWYRLFRLASFGFLVHGTSSHWFYGMLDSAIPGKGAQPVFTKVFIDQVLWNPIFGIMF  197

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F+ +  L  +    +  + +      +T  WK+WP AH I +  IP  QR+L+++ +++ 
Sbjct  198  FSYVACLEWKGLQYVIDKTRNELMTQVTGSWKVWPLAHAINFRFIPSSQRVLYINSIQM-  256

Query  388  WVTILSTYSNEKSEARISEESVEATSNPPSVGPSQ*TDRKPRSGEKIGGRSVCVLLFL  215
              T  S+ S+  +  R       ++    +  P   T    RS  K    S C+ L L
Sbjct  257  -ATTASSPSSRTATPRRRRLGGASSRGRRAAAP---TGTASRSSAKP---SACLRLRL  307



>gb|EJK54998.1| hypothetical protein THAOC_25323 [Thalassiosira oceanica]
Length=238

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 67/131 (51%), Gaps = 0/131 (0%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            D  R+      GF  HG   HY+Y++ ++  P  D   V  KVA DQ  W  I+ S++FT
Sbjct  108  DYKRLATLSFFGFIYHGPSGHYFYNWLDSKIPGTDAAPVFTKVAIDQLFWCPIFMSVFFT  167

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  383
             LG +  +S  +I +++K          WK+WP  HLI +  +  + R+ +++ V++ + 
Sbjct  168  YLGVVNGDSLATIGNKIKNDLLTACQGSWKVWPIVHLINFRFVSNKWRIPYINAVQIAFN  227

Query  382  TILSTYSNEKS  350
              LS   ++ +
Sbjct  228  MFLSLLGSKSA  238



>ref|XP_005186741.1| PREDICTED: mpv17-like protein 2 [Musca domestica]
Length=196

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            DR R     ++G T+ G + HY+Y   ++  P     +V  K+  DQ + S ++ S +F 
Sbjct  68   DRTRTSHMAVSGMTV-GVICHYWYQILDSRLPGRSLQMVMKKIVLDQLICSPVYISAFFI  126

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
             LG L  +S   +F E+K   W +  A W +WP A  + +  +P++ R+ + + + L
Sbjct  127  TLGILERKSKEEVFEEMKQKAWKLYAAEWMIWPVAQFVNFYWLPLKYRIFYDNIISL  183



>ref|XP_006298370.1| hypothetical protein CARUB_v10014441mg [Capsella rubella]
 gb|EOA31268.1| hypothetical protein CARUB_v10014441mg [Capsella rubella]
Length=258

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (44%), Gaps = 0/146 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             +D  R  R G  G  + G   HY+++F   LFP  D      K+A  QT++      I+
Sbjct  112  SYDLVRTARMGGYGLVVLGPTLHYWFNFMSRLFPKKDLITTFKKIAMGQTIYGPTMTFIF  171

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F++   L+ ES + I   LK    P+L  G   WP    IT+   PV  + L  +    +
Sbjct  172  FSLNASLQGESGSDILGRLKRDLVPVLCNGVMYWPSCDFITFRFFPVHLQPLVTNSFSYV  231

Query  388  WVTILSTYSNEKSEARISEESVEATS  311
            W+   +  +N K    IS  + +  S
Sbjct  232  WIIYTTYMANRKKPDEISNRNTQICS  257



>ref|XP_003760802.1| PREDICTED: mpv17-like protein 2 [Sarcophilus harrisii]
Length=162

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 64/126 (51%), Gaps = 7/126 (6%)
 Frame = -3

Query  739  RARMFRSGLTGFTLHGSLSHYYYHFCEALFP---FDDWWVVPAKVAFDQTVWSAIWNSIY  569
            RARMF  G +     G   HY+Y + + LFP   F D   +  KV  DQ V S +  + Y
Sbjct  22   RARMFAMGCS----MGPFLHYWYQWLDRLFPAVGFKDIGTILKKVLVDQLVASPLLGAWY  77

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  +G L  +S  +   EL+  FW    A W +WP A L+ +  +P   R+++V+ + L 
Sbjct  78   FLGMGCLEGQSLDTSCQELQDKFWEFYKADWCVWPAAQLVNFLYVPTSYRVMYVNSMTLG  137

Query  388  WVTILS  371
            W T LS
Sbjct  138  WDTYLS  143



>ref|XP_001649412.1| AAEL004577-PA [Aedes aegypti]
 gb|EAT44056.1| AAEL004577-PA [Aedes aegypti]
Length=190

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 1/130 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            DR R  +  ++G T+ G   H +Y+F +  FP     +V  KV  DQTV S I   ++F 
Sbjct  54   DRTRTRQMSISGMTV-GIFCHNWYNFMDRRFPGRTLGIVLKKVMIDQTVASPIVIFLFFA  112

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWV  383
             LG LR  +      E+K  F  + TA W +WP A L  + ++P   R+L+ + + L + 
Sbjct  113  TLGVLRKATIDETIQEMKDKFIRLYTAEWVVWPPAQLFNFYLLPNRYRVLYDNTISLGYD  172

Query  382  TILSTYSNEK  353
               S   NEK
Sbjct  173  VYTSYVINEK  182



>ref|XP_005645051.1| hypothetical protein COCSUDRAFT_67394 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20507.1| hypothetical protein COCSUDRAFT_67394 [Coccomyxa subellipsoidea 
C-169]
Length=217

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/135 (30%), Positives = 68/135 (50%), Gaps = 6/135 (4%)
 Frame = -3

Query  745  FDRARMFRSGLTGFTLHGSLSHYYYHFCEALF----PFDDWWVVPAKVAFDQTVWSAIWN  578
            FD  R  R    G T+ G + H +Y+F +       P  +  VV  K+  DQ +W+  ++
Sbjct  80   FDVFRCLRLLAFGVTMDGPVGHVWYNFLDKNIMPKEPTSNKAVV-LKMLADQLLWAPFFS  138

Query  577  SIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCV  398
             I+F     L    P +    ++    PM+ A + +WP AHLI +  IP +QR+L+++C+
Sbjct  139  CIFFAFTNTL-AGHPEATIPAIQNKLIPMMLANFAVWPIAHLINFKFIPSQQRILYINCI  197

Query  397  ELIWVTILSTYSNEK  353
            ++ W   LS  S  +
Sbjct  198  QVAWSAYLSNLSAAR  212



>gb|EYE96729.1| putative integral membrane protein, Mpv17/PMP22 family [Aspergillus 
ruber CBS 135680]
Length=185

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = -3

Query  622  AKVAFDQTVWSAIWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY  443
            AK+A DQ +  A+  ++Y   LG LR ++   I ++L+  F+P++ AG+KLWP   ++ +
Sbjct  98   AKIAIDQIIGGALSTALYIVTLGTLRGQNYDVITTQLQNDFYPLMIAGFKLWPLVSILNF  157

Query  442  GVIPVEQRLLWVDCVELIWVTILSTYSN  359
             VIP ++RLL    V ++W   LS  S 
Sbjct  158  TVIPADKRLLVGSLVGVVWAVYLSLLSG  185



>ref|XP_001691305.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP05038.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=187

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 64/133 (48%), Gaps = 4/133 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPA---KVAFDQTVWSA  587
            P F +D  R  R    G  +   + H ++ F +     D    +PA   K+  DQ V S 
Sbjct  55   PAFVYDLGRTARLVAYGVVVSTPVGHLWFKFLDTSVMPDAMTSMPAVVTKMVLDQLVMSP  114

Query  586  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  407
            +  +++F V+       P   F  ++    P L A + LWP AH+I + ++P  QR+L+ 
Sbjct  115  LSTALFFMVMRAWE-GHPQDAFRYMRGKMVPTLKANYLLWPLAHIINFALVPPSQRILYC  173

Query  406  DCVELIWVTILST  368
            + V LIW  ILST
Sbjct  174  NAVGLIWTVILST  186



>dbj|GAM22026.1| hypothetical protein SAMD00019534_052010, partial [Acytostelium 
subglobosum LB1]
Length=204

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/135 (29%), Positives = 64/135 (47%), Gaps = 0/135 (0%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
            FE D  R       G    G L H++Y   + L   +   VV  K+A DQ  ++ +  S 
Sbjct  61   FEVDVRRALTMTGVGAFFSGPLLHFWYKRLDILVRGEGALVVVKKLALDQLAFAPVVISA  120

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +  ++G L  ++P+     ++   +  L A W LWP A+ I + +IP   R+L+V  V +
Sbjct  121  FIGLMGTLNGKTPSQCIQAIQNDLFFALKANWTLWPLANAINFALIPPSLRVLYVSTVSV  180

Query  391  IWVTILSTYSNEKSE  347
             W   LS   N+K +
Sbjct  181  FWNIFLSNLGNKKHD  195



>ref|XP_002071155.1| GK25287 [Drosophila willistoni]
 gb|EDW82141.1| GK25287 [Drosophila willistoni]
Length=231

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 63/132 (48%), Gaps = 1/132 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             FD+ R      +G T+ G + HY+Y   +   P     VV  K+  DQ + S ++ S++
Sbjct  100  RFDKTRTTHMATSGVTV-GVICHYWYQMLDKRMPGRSMRVVAKKIILDQLICSPVYISVF  158

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  LG L  +    ++ E+K   W +  A W +WP A  I +  IP   R+ + + + L 
Sbjct  159  FVTLGLLENKDRHEVWEEIKDKAWKLYAAEWTVWPLAQFINFYWIPTHYRIFYDNIISLG  218

Query  388  WVTILSTYSNEK  353
            +  + S   ++K
Sbjct  219  YDVLTSKVKHKK  230



>ref|XP_001978274.1| GG17779 [Drosophila erecta]
 gb|EDV47201.1| GG17779 [Drosophila erecta]
Length=245

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             F+  R     ++G T+ G + HY+Y   +   P     VV  K+  DQ + S I+ S +
Sbjct  106  RFESTRTAHMAISGVTV-GVICHYWYKMLDKRMPGRSMRVVAKKIVLDQLICSPIYISAF  164

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  LG L  ++   ++ E+K   W +  A W +WP A  + +  IP   R+ + + + L 
Sbjct  165  FVTLGLLERKTKNEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLG  224

Query  388  WVTILSTYSNEKSEARISE  332
            +  + S   +++S + + +
Sbjct  225  YDVLTSKVKHKQSHSHLKK  243



>gb|KDO74166.1| hypothetical protein CISIN_1g017634mg [Citrus sinensis]
Length=244

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALF  650
            P FEFDR RMFRSGL GFTLHGSLSHYYY FCE + 
Sbjct  207  PLFEFDRTRMFRSGLVGFTLHGSLSHYYYQFCEVII  242



>ref|XP_002180247.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC48438.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=179

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 60/123 (49%), Gaps = 0/123 (0%)
 Frame = -3

Query  739  RARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFTV  560
            R R     + GF  HG   HY+Y++ +          V  KV  DQ +W  I+ +++FT 
Sbjct  52   RTRFVTLSVFGFIYHGPSGHYFYNWLDGKIKGTRAQDVALKVGIDQILWCPIFMTVFFTY  111

Query  559  LGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELIWVT  380
            LG    +S  +I +++K          WK+WP  H + +  I  + RL++++ V++ +  
Sbjct  112  LGLCNGDSFNTIGNKIKNDLLSACQGSWKVWPIVHAVNFKFISSKHRLVFINAVQVAFNM  171

Query  379  ILS  371
             LS
Sbjct  172  FLS  174



>gb|ADE76561.1| unknown [Picea sitchensis]
Length=287

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 62/141 (44%), Gaps = 1/141 (1%)
 Frame = -3

Query  751  FEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSI  572
             EFD++R  R    G  L G   H +++      P  D      K+   Q V+     ++
Sbjct  145  LEFDKSRTLRMAGYGLVLSGPTLHLWFNLLSKTLPKRDLISTAKKMVLGQIVYGPSITAV  204

Query  571  YFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
            +F+V   L+ ES + IF+ LK    P  T+G   WP    ITY  +PV  + L  +    
Sbjct  205  FFSVNACLQGESGSEIFARLKRDMIPTFTSGLMFWPLCDFITYRYVPVHLQPLVSNSFAF  264

Query  391  IWVTILSTYSNEKSEARISEE  329
            IW T+  TY     +  I E+
Sbjct  265  IW-TVYLTYMASLKKVNIGEQ  284



>ref|XP_002042933.1| GM11631 [Drosophila sechellia]
 ref|XP_002106857.1| GD17122 [Drosophila simulans]
 gb|EDW49023.1| GM11631 [Drosophila sechellia]
 gb|EDX17825.1| GD17122 [Drosophila simulans]
Length=245

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             F+  R     ++G T+ G + HY+Y   +   P     VV  K+  DQ + S I+ S +
Sbjct  106  RFESTRTAHMAISGVTV-GVICHYWYKMLDKRMPGRSMRVVAKKIVLDQLICSPIYISAF  164

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  LG L  ++   ++ E+K   W +  A W +WP A  + +  IP   R+ + + + L 
Sbjct  165  FVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLG  224

Query  388  WVTILSTYSNEKSEARISE  332
            +  + S   +++S + + +
Sbjct  225  YDVLTSKVKHKQSHSHLKK  243



>ref|XP_004350783.1| pmp22 family protein [Dictyostelium fasciculatum]
 gb|EGG14075.1| pmp22 family protein [Dictyostelium fasciculatum]
Length=198

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 69/127 (54%), Gaps = 0/127 (0%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            +FD  R F+  + GF + G   H++YH  +  FP   +  V  K A DQ + + I+++++
Sbjct  67   KFDYVRAFKFSVFGFVITGPTFHFWYHILDTSFPKKVFSHVIIKAALDQIICAPIFDAVF  126

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  +G L  +S   I+++LK  +         +WP  +++++  I  +QR+L+++ V + 
Sbjct  127  FMGMGVLDGKSKEDIYTKLKNDWLRTYLVDCAVWPICNIVSFRYISNKQRVLFMNIVNIG  186

Query  388  WVTILST  368
            W   L++
Sbjct  187  WAAFLAS  193



>gb|EPS65622.1| hypothetical protein M569_09156, partial [Genlisea aurea]
Length=188

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 1/128 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
            E++ AR  R    G  L G   HY+Y+F   +FP  D      K+A  QT++     +++
Sbjct  53   EYNIARTLRVAGYGMLLLGPSLHYWYNFMSRIFPRCDLLSTFQKIALGQTIYGPAMTALF  112

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F++ G  R E+ + I + LK    P L  G   WP    +T+  IPV  + L  +    +
Sbjct  113  FSINGAFRGENGSEIAARLKRDLLPTLINGAMYWPLCDFVTFKFIPVHLQPLVTNSFSFL  172

Query  388  WVTILSTY  365
            W TI  TY
Sbjct  173  W-TIYLTY  179



>gb|EPS28576.1| hypothetical protein PDE_03522 [Penicillium oxalicum 114-2]
Length=194

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 2/87 (2%)
 Frame = -3

Query  619  KVAFDQTVWSAIWNSIYFT-VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITY  443
            KV  DQT+  A WN++ F   +G LR      +  +++  FWP+++AG+KLWPF  ++ +
Sbjct  108  KVVIDQTI-GATWNTVLFLFTMGLLRGHHYDEVLVQIRQEFWPIMSAGFKLWPFVSVLCF  166

Query  442  GVIPVEQRLLWVDCVELIWVTILSTYS  362
             V+PVEQRLL      +IW   LS  S
Sbjct  167  TVVPVEQRLLVGSLFGVIWAVCLSLMS  193



>ref|XP_001845069.1| sym-1 [Culex quinquefasciatus]
 gb|EDS39085.1| sym-1 [Culex quinquefasciatus]
Length=175

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 60/117 (51%), Gaps = 1/117 (1%)
 Frame = -3

Query  742  DRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIYFT  563
            DR R  +  ++G T+ G   H +Y+F +  FP     VV  KV  DQ + S I   ++F 
Sbjct  54   DRQRTHQMSISGLTV-GVFCHNWYNFMDRKFPGRTLRVVLKKVLIDQAIASPIVIFMFFA  112

Query  562  VLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVEL  392
             LG LR  S      E+K  F  + TA W +WP A L  + ++P + R+L+ + + L
Sbjct  113  TLGVLRKASVDETIQEMKDKFVRLYTAEWVVWPPAQLFNFYLLPTKYRVLYDNTISL  169



>ref|XP_002100466.1| GE17073 [Drosophila yakuba]
 gb|EDX01574.1| GE17073 [Drosophila yakuba]
Length=246

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 67/139 (48%), Gaps = 1/139 (1%)
 Frame = -3

Query  748  EFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFPFDDWWVVPAKVAFDQTVWSAIWNSIY  569
             F+  R     ++G T+ G + HY+Y   +   P     VV  K+  DQ + S I+ S +
Sbjct  107  RFESTRTAHMAISGVTV-GVICHYWYKMLDKRMPGRSMRVVAKKIVLDQLICSPIYISAF  165

Query  568  FTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWVDCVELI  389
            F  LG L  ++   ++ E+K   W +  A W +WP A  + +  IP   R+ + + + L 
Sbjct  166  FVTLGLLERKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLG  225

Query  388  WVTILSTYSNEKSEARISE  332
            +  + S   +++S + + +
Sbjct  226  YDVLTSKVKHKQSHSHLKK  244



>ref|XP_009470234.1| PREDICTED: mpv17-like protein 2 [Nipponia nippon]
Length=270

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 78/167 (47%), Gaps = 5/167 (3%)
 Frame = -3

Query  757  PXFEFDRARMFRSGLTGFTLHGSLSHYYYHFCEALFP---FDDWWVVPAKVAFDQTVWSA  587
            P  E   AR  R    G ++ G L HY+Y + +A FP         V  KV  DQ V S 
Sbjct  49   PDTEPQVARTGRMFAVGCSM-GPLMHYWYVWLDAAFPARGVRGLKTVLKKVLIDQLVASP  107

Query  586  IWNSIYFTVLGFLRLESPTSIFSELKATFWPMLTAGWKLWPFAHLITYGVIPVEQRLLWV  407
            +  + YF  +G L  +S    + ELK  FW    A W +WP A L+ +  +P + R++++
Sbjct  108  VLGAWYFFGMGSLEGQSLQESWEELKEKFWEFYKADWCIWPAAQLLNFLFVPPKYRVVYI  167

Query  406  DCVELIWVTILSTYSNEKSEARISE-ESVEATSNPPSVGPSQ*TDRK  269
            + + L W T LS   +       +E +S   +  PP   P+Q  D K
Sbjct  168  NVITLGWDTYLSYLKHRPGSPPSAEHDSPRESPAPPGGEPAQGRDVK  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470