BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032E08

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770718.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    233   2e-70   Nicotiana sylvestris
ref|XP_009783881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    233   3e-70   Nicotiana sylvestris
ref|XP_009626648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    233   3e-70   Nicotiana tomentosiformis
ref|XP_006360666.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    231   3e-69   Solanum tuberosum [potatoes]
ref|XP_004240130.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    230   5e-69   Solanum lycopersicum
ref|XP_006361583.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    229   7e-69   Solanum tuberosum [potatoes]
ref|XP_009616437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    229   1e-68   Nicotiana tomentosiformis
ref|XP_004242864.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    226   1e-67   Solanum lycopersicum
emb|CBI40665.3|  unnamed protein product                                224   1e-67   Vitis vinifera
ref|XP_009770720.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    225   3e-67   Nicotiana sylvestris
ref|XP_010263306.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    225   5e-67   Nelumbo nucifera [Indian lotus]
ref|XP_011094065.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    223   2e-66   Sesamum indicum [beniseed]
ref|XP_002265606.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    223   2e-66   Vitis vinifera
ref|XP_009616439.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    223   2e-66   
emb|CDP20190.1|  unnamed protein product                                223   2e-66   Coffea canephora [robusta coffee]
ref|XP_011094071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    223   4e-66   Sesamum indicum [beniseed]
gb|EYU25735.1|  hypothetical protein MIMGU_mgv1a007058mg                221   8e-66   Erythranthe guttata [common monkey flower]
ref|XP_009616433.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    221   1e-65   
ref|XP_009616438.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    220   2e-65   Nicotiana tomentosiformis
ref|XP_009616436.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    221   2e-65   
ref|XP_002526236.1|  conserved hypothetical protein                     219   2e-65   
gb|KDP45833.1|  hypothetical protein JCGZ_17440                         219   7e-65   Jatropha curcas
ref|XP_011017741.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    219   9e-65   Populus euphratica
ref|XP_010106955.1|  Ethanolamine-phosphate cytidylyltransferase        218   1e-64   Morus notabilis
ref|XP_007014459.1|  Phosphorylethanolamine cytidylyltransferase ...    218   1e-64   
gb|ABX10445.1|  ethanolamine-phosphate cytidylyltransferase 1           215   1e-63   Gossypium hirsutum [American cotton]
ref|XP_002325231.2|  hypothetical protein POPTR_0018s13260g             216   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002308992.1|  hypothetical protein POPTR_0006s07030g             215   2e-63   
ref|XP_010688423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    215   2e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG01776.1|  Ethanolamine-phosphate cytidylyltransferase             214   3e-63   Gossypium arboreum [tree cotton]
gb|KJB23397.1|  hypothetical protein B456_004G096200                    214   5e-63   Gossypium raimondii
gb|KJB83345.1|  hypothetical protein B456_013G242400                    213   1e-62   Gossypium raimondii
ref|XP_011020099.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    212   3e-62   Populus euphratica
ref|XP_006428518.1|  hypothetical protein CICLE_v10011809mg             211   6e-62   Citrus clementina [clementine]
ref|XP_004163014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    211   9e-62   
ref|XP_004503546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    210   1e-61   Cicer arietinum [garbanzo]
ref|XP_010553187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    210   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_008453525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   3e-61   Cucumis melo [Oriental melon]
ref|XP_007222601.1|  hypothetical protein PRUPE_ppa006288mg             209   3e-61   Prunus persica
ref|XP_008223819.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    209   4e-61   Prunus mume [ume]
gb|KJB23398.1|  hypothetical protein B456_004G096200                    208   9e-61   Gossypium raimondii
ref|XP_004299778.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    208   1e-60   Fragaria vesca subsp. vesca
gb|KDO54355.1|  hypothetical protein CISIN_1g0144871mg                  206   4e-60   Citrus sinensis [apfelsine]
ref|XP_007160226.1|  hypothetical protein PHAVU_002G303400g             206   6e-60   Phaseolus vulgaris [French bean]
ref|XP_003525313.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    206   6e-60   Glycine max [soybeans]
ref|XP_010529959.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    204   2e-59   Tarenaya hassleriana [spider flower]
gb|ACJ85759.1|  unknown                                                 204   3e-59   Medicago truncatula
ref|XP_003630619.1|  Ethanolamine-phosphate cytidylyltransferase        204   3e-59   Medicago truncatula
ref|XP_003630620.1|  Ethanolamine-phosphate cytidylyltransferase        204   4e-59   
ref|XP_006293474.1|  hypothetical protein CARUB_v10023288mg             204   4e-59   Capsella rubella
ref|XP_006663169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    197   4e-59   Oryza brachyantha
ref|XP_009133281.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    203   6e-59   Brassica rapa
gb|ABA91254.1|  phosphoethanolamine cytidylyltransferase, putativ...    201   6e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010048543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    203   7e-59   Eucalyptus grandis [rose gum]
gb|EEE51553.1|  hypothetical protein OsJ_32765                          201   8e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003530503.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    203   8e-59   Glycine max [soybeans]
ref|XP_010505515.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   8e-59   
ref|XP_009342823.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    202   1e-58   Pyrus x bretschneideri [bai li]
emb|CCW28789.1|  putative cytidylyltransferase                          202   1e-58   Arachis duranensis
gb|EEC67567.1|  hypothetical protein OsI_34911                          201   3e-58   Oryza sativa Indica Group [Indian rice]
ref|NP_001066024.1|  Os12g0121300                                       201   4e-58   
ref|XP_008351357.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   4e-58   
ref|XP_010517175.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010509160.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009143367.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    201   7e-58   Brassica rapa
ref|XP_009341732.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    200   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_002450173.1|  hypothetical protein SORBIDRAFT_05g001470          200   1e-57   Sorghum bicolor [broomcorn]
emb|CDP06353.1|  unnamed protein product                                199   1e-57   Coffea canephora [robusta coffee]
ref|XP_008355786.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   2e-57   
ref|XP_004302493.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    199   2e-57   Fragaria vesca subsp. vesca
ref|XP_009606107.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    199   3e-57   Nicotiana tomentosiformis
gb|KFK36771.1|  hypothetical protein AALP_AA4G168400                    199   3e-57   Arabis alpina [alpine rockcress]
ref|XP_011101976.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    199   3e-57   Sesamum indicum [beniseed]
ref|NP_181401.1|  ethanolamine-phosphate cytidylyltransferase           198   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007140015.1|  hypothetical protein PHAVU_008G077100g             198   6e-57   Phaseolus vulgaris [French bean]
ref|XP_004977412.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    198   7e-57   Setaria italica
ref|XP_010931423.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    198   8e-57   Elaeis guineensis
ref|XP_006411085.1|  hypothetical protein EUTSA_v10016709mg             198   8e-57   Eutrema salsugineum [saltwater cress]
ref|XP_008788034.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    197   1e-56   Phoenix dactylifera
emb|CDY07710.1|  BnaA03g18010D                                          198   1e-56   Brassica napus [oilseed rape]
emb|CDY14442.1|  BnaC03g21530D                                          197   2e-56   Brassica napus [oilseed rape]
gb|EMS66153.1|  Ethanolamine-phosphate cytidylyltransferase             194   2e-56   Triticum urartu
ref|XP_009801689.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    196   3e-56   Nicotiana sylvestris
ref|XP_008679350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    196   3e-56   Zea mays [maize]
ref|NP_001170703.1|  hypothetical protein                               196   3e-56   Zea mays [maize]
ref|XP_002879759.1|  hypothetical protein ARALYDRAFT_903103             196   3e-56   Arabidopsis lyrata subsp. lyrata
gb|AFW57038.1|  hypothetical protein ZEAMMB73_658422                    196   3e-56   
ref|XP_006664291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    196   3e-56   Oryza brachyantha
gb|EMT02889.1|  Ethanolamine-phosphate cytidylyltransferase             194   6e-56   
ref|XP_006362326.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   1e-55   Solanum tuberosum [potatoes]
ref|XP_004249014.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   1e-55   Solanum lycopersicum
ref|XP_008244222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   1e-55   Prunus mume [ume]
ref|XP_010913784.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    195   1e-55   Elaeis guineensis
ref|XP_010922838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   2e-55   Elaeis guineensis
emb|CDX91484.1|  BnaC04g06660D                                          194   2e-55   
ref|XP_008804653.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   3e-55   Phoenix dactylifera
ref|XP_010928770.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   3e-55   
ref|XP_009337844.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   3e-55   Pyrus x bretschneideri [bai li]
ref|XP_003552337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   3e-55   Glycine max [soybeans]
ref|XP_007207330.1|  hypothetical protein PRUPE_ppa006076mg             194   3e-55   Prunus persica
gb|EPS71148.1|  hypothetical protein M569_03610                         192   4e-55   Genlisea aurea
emb|CDX74894.1|  BnaA05g06400D                                          194   4e-55   
ref|XP_009141755.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    193   4e-55   Brassica rapa
ref|XP_008370315.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    193   5e-55   
ref|XP_010928769.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    194   5e-55   Elaeis guineensis
dbj|BAD03428.1|  putative phosphoethanolamine cytidylyltransferase      193   6e-55   Oryza sativa Japonica Group [Japonica rice]
gb|KJB27590.1|  hypothetical protein B456_005G001400                    193   7e-55   Gossypium raimondii
ref|XP_009370855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    193   7e-55   Pyrus x bretschneideri [bai li]
ref|XP_009381352.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   7e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003577861.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   1e-54   Brachypodium distachyon [annual false brome]
ref|XP_006659222.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   1e-54   Oryza brachyantha
ref|XP_004978492.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   1e-54   Setaria italica
ref|XP_004972545.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    193   1e-54   
ref|XP_009410481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006842638.1|  hypothetical protein AMTR_s00077p00187820          192   2e-54   
ref|XP_008358193.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    192   2e-54   
ref|XP_010278899.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    191   3e-54   Nelumbo nucifera [Indian lotus]
ref|XP_009384337.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    191   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP21814.1|  hypothetical protein JCGZ_00601                         191   3e-54   Jatropha curcas
gb|AAO43227.1|  phosphoethanolamine cytidylyltransferase                191   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04174.1|  predicted protein                                      191   5e-54   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003533643.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    190   6e-54   Glycine max [soybeans]
dbj|BAJ86064.1|  predicted protein                                      190   1e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010036047.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    189   2e-53   Eucalyptus grandis [rose gum]
ref|XP_003573570.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    189   3e-53   Brachypodium distachyon [annual false brome]
ref|XP_010684667.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    189   3e-53   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC66861.1|  hypothetical protein OsI_33354                          187   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_006429675.1|  hypothetical protein CICLE_v10011843mg             188   3e-53   Citrus clementina [clementine]
ref|XP_006587893.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    187   3e-53   Glycine max [soybeans]
gb|EYU26697.1|  hypothetical protein MIMGU_mgv1a007403mg                188   4e-53   Erythranthe guttata [common monkey flower]
gb|EPS64234.1|  hypothetical protein M569_10547                         187   1e-52   Genlisea aurea
dbj|BAJ95410.1|  predicted protein                                      187   1e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010036048.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    187   1e-52   
gb|KHN29458.1|  Ethanolamine-phosphate cytidylyltransferase             187   1e-52   Glycine soja [wild soybean]
ref|XP_003564627.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    186   2e-52   
ref|XP_004137664.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    187   2e-52   Cucumis sativus [cucumbers]
ref|XP_004972544.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    187   2e-52   
ref|XP_002323699.2|  hypothetical protein POPTR_0016s15020g             186   2e-52   Populus trichocarpa [western balsam poplar]
ref|XP_002990148.1|  hypothetical protein SELMODRAFT_131236             186   3e-52   
ref|NP_001064493.1|  Os10g0387000                                       186   3e-52   
gb|EAZ15919.1|  hypothetical protein OsJ_31340                          186   3e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002992541.1|  hypothetical protein SELMODRAFT_162424             186   3e-52   Selaginella moellendorffii
ref|XP_008442303.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    186   3e-52   Cucumis melo [Oriental melon]
ref|XP_003579008.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    186   4e-52   Brachypodium distachyon [annual false brome]
ref|XP_008781724.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    186   4e-52   Phoenix dactylifera
ref|XP_004972543.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    186   8e-52   
emb|CDM85025.1|  unnamed protein product                                183   3e-51   Triticum aestivum [Canadian hard winter wheat]
gb|KEH23310.1|  ethanolamine-phosphate cytidylyltransferase             180   4e-51   Medicago truncatula
ref|XP_002519980.1|  Ethanolamine-phosphate cytidylyltransferase,...    182   5e-51   Ricinus communis
emb|CBI31131.3|  unnamed protein product                                181   7e-51   Vitis vinifera
ref|XP_011018911.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    182   7e-51   Populus euphratica
ref|XP_001759318.1|  predicted protein                                  182   7e-51   
gb|EMT24851.1|  Ethanolamine-phosphate cytidylyltransferase             182   1e-50   
ref|XP_008442304.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    180   2e-50   Cucumis melo [Oriental melon]
ref|XP_002265169.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    181   3e-50   Vitis vinifera
emb|CAQ58636.1|  Ethanolamine-phosphate cytidylyltransferase            180   4e-50   Vitis vinifera
ref|XP_004972546.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    181   4e-50   
ref|XP_003623695.1|  Ethanolamine-phosphate cytidylyltransferase        179   9e-50   
gb|AES79913.2|  ethanolamine-phosphate cytidylyltransferase             179   9e-50   Medicago truncatula
gb|AFK43034.1|  unknown                                                 179   9e-50   Medicago truncatula
ref|XP_001780359.1|  predicted protein                                  179   1e-49   
ref|XP_004972542.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    181   1e-49   
gb|EEC68755.1|  hypothetical protein OsI_37278                          179   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008442302.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    180   2e-49   Cucumis melo [Oriental melon]
ref|XP_004492610.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    178   3e-49   Cicer arietinum [garbanzo]
emb|CDY18374.1|  BnaA04g22130D                                          177   3e-49   Brassica napus [oilseed rape]
gb|EMS51700.1|  Ethanolamine-phosphate cytidylyltransferase             174   1e-47   Triticum urartu
ref|XP_006381291.1|  hypothetical protein POPTR_0006s11470g             172   6e-47   
ref|XP_009151252.1|  PREDICTED: uncharacterized protein LOC103874581    174   6e-47   Brassica rapa
ref|XP_011006223.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    172   7e-47   Populus euphratica
gb|AFK45455.1|  unknown                                                 158   4e-45   Medicago truncatula
ref|XP_004149674.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    157   1e-44   
emb|CDY48653.1|  BnaC07g27560D                                          166   1e-43   Brassica napus [oilseed rape]
gb|ABX10446.1|  ethanolamine-phosphate cytidylyltransferase 2           157   1e-41   Gossypium hirsutum [American cotton]
ref|XP_010505513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    149   2e-41   
ref|XP_010113033.1|  Ethanolamine-phosphate cytidylyltransferase        154   2e-40   
ref|XP_005538734.1|  phosphoethanolamine cytidylyltransferase           153   8e-40   Cyanidioschyzon merolae strain 10D
ref|XP_005714716.1|  Ethanolamine-phosphate cytidylyltransferase,...    152   2e-39   Chondrus crispus [carageen]
ref|XP_004171635.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    142   7e-39   
gb|EIE92478.1|  hypothetical protein RO3G_17000                         148   8e-39   Rhizopus delemar RA 99-880
ref|XP_008355152.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    142   9e-39   
ref|XP_005845984.1|  hypothetical protein CHLNCDRAFT_25204              144   1e-38   Chlorella variabilis
emb|CEG84347.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    148   2e-38   Rhizopus microsporus
emb|CEG75719.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    148   2e-38   Rhizopus microsporus
emb|CEG66905.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    148   2e-38   Rhizopus microsporus
emb|CEI95984.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    143   2e-38   Rhizopus microsporus
emb|CEG75718.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    147   3e-38   Rhizopus microsporus
ref|XP_005647873.1|  CTP-phosphoethanolamine cytidylyltransferase       147   2e-37   Coccomyxa subellipsoidea C-169
gb|KDO54356.1|  hypothetical protein CISIN_1g0144871mg                  145   2e-37   Citrus sinensis [apfelsine]
gb|KDO54357.1|  hypothetical protein CISIN_1g0144871mg                  145   2e-37   Citrus sinensis [apfelsine]
emb|CEP18288.1|  hypothetical protein                                   145   3e-37   Parasitella parasitica
emb|CEI99016.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    142   1e-36   Rhizopus microsporus
gb|EPB91886.1|  ethanolamine-phosphate cytidylyltransferase             142   2e-36   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002950808.1|  hypothetical protein VOLCADRAFT_109104             142   5e-36   Volvox carteri f. nagariensis
gb|EIE76135.1|  hypothetical protein RO3G_00839                         141   7e-36   Rhizopus delemar RA 99-880
dbj|GAN05681.1|  phosphoethanolamine-cytidyltransferase                 141   8e-36   Mucor ambiguus
dbj|GAN03222.1|  phosphoethanolamine-cytidyltransferase                 141   8e-36   Mucor ambiguus
emb|CEP15035.1|  hypothetical protein                                   141   9e-36   Parasitella parasitica
ref|XP_001008378.1|  cytidyltransferase-related domain containing...    142   1e-35   Tetrahymena thermophila SB210
gb|EPB89151.1|  ethanolamine-phosphate cytidylyltransferase             139   3e-35   Mucor circinelloides f. circinelloides 1006PhL
gb|EMT25098.1|  Ethanolamine-phosphate cytidylyltransferase             139   5e-35   
gb|AAK13093.1|AC078839_9  Putative phospholipid cytidylyltransferase    141   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004353870.1|  phosphoethanolamine-cytidyltransferase             137   2e-34   Cavenderia fasciculata
ref|XP_004368196.1|  CTP:ethanolaminephosphate cytidylyltransferase     136   5e-34   Acanthamoeba castellanii str. Neff
ref|XP_002672471.1|  predicted protein                                  136   6e-34   Naegleria gruberi strain NEG-M
ref|XP_003283291.1|  phosphoethanolamine-cytidyltransferase             135   1e-33   Dictyostelium purpureum
emb|CEF71025.1|  Ethanolamine-phosphate cytidylyltransferase            135   2e-33   Strongyloides ratti
gb|KFH72676.1|  ethanolamine-phosphate cytidylyltransferase             135   2e-33   Mortierella verticillata NRRL 6337
ref|XP_001692963.1|  CDP-Ethanolamine synthase                          135   2e-33   Chlamydomonas reinhardtii
emb|CDS08410.1|  hypothetical protein LRAMOSA09772                      132   3e-33   Lichtheimia ramosa
gb|EPZ32625.1|  Rossmann-like alpha/beta/alpha sandwich fold doma...    134   3e-33   Rozella allomycis CSF55
ref|XP_004032276.1|  hypothetical protein IMG5_125800                   134   4e-33   Ichthyophthirius multifiliis
gb|KIZ02908.1|  ethanolamine-phosphatecytidylyltransferase              135   4e-33   Monoraphidium neglectum
dbj|GAM28819.1|  hypothetical protein SAMD00019534_119950               132   1e-32   Acytostelium subglobosum LB1
ref|XP_646687.1|  hypothetical protein DDB_G0270298                     132   2e-32   Dictyostelium discoideum AX4
ref|XP_002060439.1|  GJ14912                                            127   2e-32   
emb|CDS08409.1|  hypothetical protein LRAMOSA09772                      132   3e-32   Lichtheimia ramosa
ref|XP_011398757.1|  Ethanolamine-phosphate cytidylyltransferase        132   3e-32   Auxenochlorella protothecoides
emb|CDH52899.1|  ethanolamine-phosphate cytidylyltransferase-like       131   4e-32   Lichtheimia corymbifera JMRC:FSU:9682
gb|EFA80421.1|  phosphoethanolamine-cytidyltransferase                  130   6e-32   Heterostelium album PN500
ref|XP_002155934.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    130   1e-31   Hydra vulgaris
ref|XP_002611477.1|  hypothetical protein BRAFLDRAFT_113520             130   1e-31   Branchiostoma floridae
gb|AAL25522.1|  SD08668p                                                126   1e-31   Drosophila melanogaster
ref|XP_002782897.1|  Choline-phosphate cytidylyltransferase A, pu...    124   2e-31   Perkinsus marinus ATCC 50983
ref|XP_004527209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    130   2e-31   Ceratitis capitata [medfly]
ref|XP_004527208.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    130   2e-31   Ceratitis capitata [medfly]
emb|CDH58540.1|  ethanolamine-phosphate cytidylyltransferase            129   2e-31   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH58541.1|  ethanolamine-phosphate cytidylyltransferase-like       129   2e-31   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS11051.1|  Putative Ethanolamine-phosphatecytidylyltransferase    129   2e-31   Lichtheimia ramosa
ref|XP_002423231.1|  Ethanolamine-phosphate cytidylyltransferase,...    130   2e-31   Pediculus humanus corporis [human body lice]
ref|XP_005181836.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Musca domestica
ref|XP_011188405.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005181838.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Musca domestica
ref|XP_001851245.1|  ethanolamine-phosphate cytidylyltransferase        129   3e-31   Culex quinquefasciatus
ref|XP_008904899.1|  hypothetical protein PPTG_11355                    130   3e-31   Phytophthora parasitica INRA-310
ref|XP_001969670.1|  GG23821                                            129   3e-31   Drosophila erecta
ref|XP_011188404.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   3e-31   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_001623420.1|  predicted protein                                  129   4e-31   Nematostella vectensis
ref|XP_011202026.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   4e-31   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002002855.1|  GI17607                                            129   4e-31   Drosophila mojavensis
ref|XP_011202025.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    129   4e-31   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002767684.1|  Choline-phosphate cytidylyltransferase A, pu...    125   5e-31   Perkinsus marinus ATCC 50983
ref|XP_787725.3|  PREDICTED: ethanolamine-phosphate cytidylyltran...    124   6e-31   
gb|EFX78214.1|  hypothetical protein DAPPUDRAFT_305267                  127   8e-31   Daphnia pulex
gb|ESA12672.1|  hypothetical protein GLOINDRAFT_347240                  127   1e-30   
gb|ETI47683.1|  hypothetical protein F443_08147                         128   1e-30   Phytophthora parasitica P1569
ref|XP_009513920.1|  hypothetical protein PHYSODRAFT_348782             128   1e-30   Phytophthora sojae
ref|XP_966534.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...    127   1e-30   Tribolium castaneum [rust-red flour beetle]
ref|XP_002896776.1|  ethanolamine-phosphate cytidylyltransferase,...    128   1e-30   Phytophthora infestans T30-4
gb|EXX58968.1|  ethanolamine-phosphate cytidylyltransferase             126   2e-30   Rhizophagus irregularis DAOM 197198w
ref|XP_004343166.1|  phosphoethanolamine-cytidyltransferase             127   2e-30   Capsaspora owczarzaki ATCC 30864
ref|XP_001651208.1|  AAEL005651-PA                                      126   2e-30   Aedes aegypti
ref|XP_002060442.1|  GJ14914                                            126   2e-30   
ref|XP_002042126.1|  GM10235                                            126   2e-30   Drosophila sechellia
ref|NP_723791.2|  phosphoethanolamine cytidylyltransferase, isofo...    126   2e-30   Drosophila melanogaster
gb|EPY30399.1|  ethanolamine-phosphate cytidylyltransferase             125   3e-30   Angomonas deanei
ref|NP_609613.2|  phosphoethanolamine cytidylyltransferase, isofo...    126   3e-30   Drosophila melanogaster
ref|XP_011006224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    126   3e-30   Populus euphratica
ref|XP_001988302.1|  GH11091                                            126   3e-30   Drosophila grimshawi
ref|XP_002057708.1|  GJ17952                                            126   3e-30   
ref|XP_002600903.1|  hypothetical protein BRAFLDRAFT_263711             126   3e-30   Branchiostoma floridae
ref|XP_002088547.1|  pect                                               126   3e-30   Drosophila yakuba
ref|NP_723790.2|  phosphoethanolamine cytidylyltransferase, isofo...    126   3e-30   Drosophila melanogaster
ref|XP_001962647.1|  GF15564                                            126   3e-30   Drosophila ananassae
ref|NP_723789.2|  phosphoethanolamine cytidylyltransferase, isofo...    126   3e-30   Drosophila melanogaster
ref|XP_002079297.1|  GD23872                                            126   3e-30   Drosophila simulans
ref|XP_011304879.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   5e-30   Fopius arisanus
ref|XP_320056.4|  AGAP009264-PA                                         125   5e-30   Anopheles gambiae str. PEST
ref|XP_001011315.1|  cytidyltransferase-related domain containing...    126   5e-30   Tetrahymena thermophila SB210
ref|XP_002021799.1|  GL26305                                            125   6e-30   Drosophila persimilis
gb|ELU08724.1|  hypothetical protein CAPTEDRAFT_162811                  122   6e-30   Capitella teleta
gb|ESL06891.1|  ethanolamine-phosphate cytidylyltransferase             125   7e-30   Trypanosoma rangeli SC58
gb|EPY35339.1|  ethanolamine-phosphate cytidylyltransferase             124   7e-30   Angomonas deanei
ref|XP_829470.1|  ethanolamine-phosphate cytidylyltransferase           125   8e-30   Trypanosoma brucei brucei TREU927
ref|XP_011304878.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    124   9e-30   Fopius arisanus
ref|XP_008615950.1|  ethanolamine-phosphate cytidylyltransferase        125   1e-29   Saprolegnia diclina VS20
ref|XP_002782885.1|  Ethanolamine-phosphate cytidylyltransferase,...    124   1e-29   Perkinsus marinus ATCC 50983
ref|XP_001430341.1|  hypothetical protein                               125   1e-29   Paramecium tetraurelia strain d4-2
gb|KDO33642.1|  hypothetical protein SPRG_01610                         125   1e-29   Saprolegnia parasitica CBS 223.65
ref|XP_009027596.1|  hypothetical protein HELRODRAFT_107813             124   2e-29   
ref|XP_002065671.1|  GK14544                                            124   2e-29   
ref|XP_009308303.1|  putative ethanolamine-phosphate cytidylyltra...    124   2e-29   
gb|KFM68067.1|  Ethanolamine-phosphate cytidylyltransferase             124   2e-29   
gb|ETN61926.1|  ethanolamine-phosphate cytidylyltransferase             124   3e-29   
ref|XP_002607683.1|  hypothetical protein BRAFLDRAFT_82871              123   3e-29   
emb|CEJ00776.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    122   3e-29   
gb|EPY43438.1|  ethanolamine-phosphate cytidylyltransferase             123   3e-29   
emb|CEJ03656.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    122   3e-29   
emb|CEG66906.1|  Putative Ethanolamine-phosphate cytidylyltransfe...    122   4e-29   
gb|ENN72223.1|  hypothetical protein YQE_11086                          123   4e-29   
gb|EHJ66000.1|  putative ethanolamine-phosphate cytidylyltransferase    122   4e-29   
ref|XP_001423999.1|  hypothetical protein                               123   5e-29   
ref|XP_010143924.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   6e-29   
ref|XP_004559465.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   6e-29   
ref|XP_005989106.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    122   7e-29   
ref|XP_002784285.1|  Ethanolamine-phosphate cytidylyltransferase,...    122   8e-29   
gb|ACO12188.1|  Ethanolamine-phosphate cytidylyltransferase             122   1e-28   
emb|CCC54014.1|  putative ethanolamine-phosphate cytidylyltransfe...    122   1e-28   
ref|XP_002775089.1|  Ethanolamine-phosphate cytidylyltransferase,...    119   1e-28   
ref|XP_010143917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   1e-28   
ref|XP_004559464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   1e-28   
ref|XP_011503865.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_010870922.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_007236102.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   2e-28   
ref|XP_010774781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   2e-28   
ref|XP_011414849.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_011414848.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_011335797.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   2e-28   
ref|XP_004559463.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   2e-28   
ref|XP_002294596.1|  phospholid cytidylyltransferase                    120   2e-28   
ref|XP_010728353.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   3e-28   
ref|XP_008301525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    121   3e-28   
gb|EPY23528.1|  ethanolamine-phosphate cytidylyltransferase             120   3e-28   
dbj|BAE02335.1|  unnamed protein product                                118   3e-28   
ref|XP_008886557.1|  Phosphoethanolamine-cytidyltransferase             124   3e-28   
gb|KFH13180.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
gb|KFH02413.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
gb|KFG65783.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
gb|KFG44559.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
gb|KFG40824.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
gb|EPR60847.1|  Phosphoethanolamine-cytidyltransferase                  124   3e-28   
ref|XP_002364274.1|  phosphoethanolamine cytidylyltransferase, pu...    124   3e-28   
ref|XP_010201094.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-28   
ref|XP_006635464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   3e-28   
ref|XP_011335781.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   3e-28   
ref|XP_819288.1|  ethanolamine-phosphate cytidylyltransferase           120   3e-28   
ref|XP_001951262.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   3e-28   
ref|XP_008920033.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   4e-28   
ref|XP_010127567.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   4e-28   
ref|XP_011153206.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   4e-28   
ref|XP_010080655.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   4e-28   
ref|XP_003701917.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   4e-28   
ref|XP_008327791.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   5e-28   
ref|XP_003964731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   5e-28   
ref|XP_011420114.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   5e-28   
ref|XP_011262173.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   5e-28   
ref|XP_004071464.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    120   6e-28   
ref|XP_004894622.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
gb|KFO84331.1|  Ethanolamine-phosphate cytidylyltransferase             119   6e-28   
gb|EHB09343.1|  Ethanolamine-phosphate cytidylyltransferase             119   6e-28   
ref|XP_004861030.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
ref|XP_005597109.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   6e-28   
ref|XP_008939759.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   6e-28   
gb|EKG04727.1|  ethanolamine-phosphate cytidylyltransferase, puta...    119   6e-28   
emb|CCC95928.1|  unnamed protein product                                119   6e-28   
ref|XP_004367772.1|  cytidyltransferaserelated domain containing ...    118   7e-28   
ref|XP_009874095.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   7e-28   
ref|XP_004894621.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   7e-28   
ref|XP_010769178.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   8e-28   
ref|XP_010127566.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   
gb|ABX10447.1|  ethanolamine-phosphate cytidylyltransferase 3           117   8e-28   
ref|XP_009080963.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   
ref|XP_003450120.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   
ref|XP_008920032.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   8e-28   
ref|XP_010282190.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   9e-28   
gb|KFP25915.1|  Ethanolamine-phosphate cytidylyltransferase             115   9e-28   
ref|XP_005597108.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   9e-28   
ref|XP_004861028.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   9e-28   
ref|XP_009987641.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   1e-27   
ref|XP_008468835.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
gb|EKF33174.1|  ethanolamine-phosphate cytidylyltransferase, puta...    119   1e-27   
ref|XP_008864068.1|  hypothetical protein H310_02362                    120   1e-27   
ref|XP_009944224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   1e-27   
ref|XP_005144256.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|XP_009092525.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   1e-27   
ref|XP_009485599.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_009465225.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_009930965.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_009642454.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_003931691.2|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|XP_008408685.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|NP_001167040.1|  Ethanolamine-phosphate cytidylyltransferase        119   1e-27   
ref|XP_004861027.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
gb|KHN82689.1|  Ethanolamine-phosphate cytidylyltransferase             119   1e-27   
ref|XP_003931692.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   1e-27   
ref|XP_004177012.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    118   1e-27   
ref|XP_010019461.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_009926039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   1e-27   
ref|XP_009557287.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_009667071.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_005144257.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_005011600.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_007570241.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   2e-27   
gb|KDD76579.1|  hypothetical protein H632_c175p1                        119   2e-27   
ref|XP_972618.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...    118   2e-27   
ref|XP_005350939.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_009824288.1|  hypothetical protein H257_02379                    119   2e-27   
ref|XP_005530696.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_008327790.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    119   2e-27   
ref|XP_004931531.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_009926038.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_005585333.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_002414532.1|  glycerol-3-phosphate cytidylyltransferase, p...    118   2e-27   
ref|XP_009189750.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
gb|KFV14382.1|  Ethanolamine-phosphate cytidylyltransferase             116   2e-27   
ref|XP_010411684.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_010719650.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_005056300.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_005429859.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_008492788.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_010282186.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_005495710.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_010311275.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_004931530.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_009926037.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_002502198.1|  predicted protein                                  118   2e-27   
ref|NP_001278895.1|  ethanolamine-phosphate cytidylyltransferase        118   2e-27   
ref|XP_005585334.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_009987640.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
gb|KFQ30887.1|  Ethanolamine-phosphate cytidylyltransferase             114   2e-27   
gb|KFP79007.1|  Ethanolamine-phosphate cytidylyltransferase             114   2e-27   
ref|XP_003211513.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_010209813.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
gb|EHH58431.1|  hypothetical protein EGM_08284                          118   2e-27   
ref|XP_010282187.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_005585331.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_009574039.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   2e-27   
ref|XP_003489672.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   2e-27   
ref|XP_009944209.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009814381.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009277662.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009642437.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009485598.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009930949.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_008574518.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_006987734.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   3e-27   
ref|XP_009704648.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_009465224.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_010769177.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   3e-27   
ref|XP_009667070.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_005495709.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_011062228.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_005801499.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_005350938.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    118   3e-27   
ref|XP_006038731.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_008518630.1|  PREDICTED: LOW QUALITY PROTEIN: ethanolamine...    117   3e-27   
emb|CDW78916.1|  ethanolamine-phosphate cytidylyltransferase-like       118   3e-27   
ref|XP_006886376.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_001744354.1|  hypothetical protein                               117   3e-27   
ref|XP_011247510.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    114   3e-27   
ref|XP_003831150.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   3e-27   
ref|XP_004432926.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_005530695.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_001567455.1|  ethanolamine-phosphate cytidylyltransferase        117   4e-27   
ref|XP_006987733.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_005350937.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_003913624.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
gb|KFW79202.1|  Ethanolamine-phosphate cytidylyltransferase             117   4e-27   
ref|XP_005585332.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
gb|KFP88627.1|  Ethanolamine-phosphate cytidylyltransferase             117   4e-27   
gb|EGI60734.1|  Ethanolamine-phosphate cytidylyltransferase             117   4e-27   
ref|XP_011335791.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_011335816.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_008153350.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_003400920.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
dbj|BAG52690.1|  unnamed protein product                                116   4e-27   
ref|XP_010743291.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|NP_001243364.1|  ethanolamine-phosphate cytidylyltransferase ...    116   4e-27   
ref|XP_011062227.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_005801498.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
emb|CCD12240.1|  unnamed protein product                                117   4e-27   
ref|XP_011157855.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_005925138.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_004040835.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   4e-27   
gb|KFP38725.1|  Ethanolamine-phosphate cytidylyltransferase             116   4e-27   
ref|XP_005801497.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_008574516.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   4e-27   
ref|XP_009930958.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_003768669.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_005925137.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_005585330.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_003455812.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_001602017.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_009944216.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_006270716.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_006621260.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_006790764.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_009861143.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_009861144.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   5e-27   
ref|XP_007482915.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   5e-27   
gb|KDR12653.1|  Ethanolamine-phosphate cytidylyltransferase             117   6e-27   
ref|XP_003831149.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   6e-27   
ref|XP_010701782.1|  ethanolamine-phosphate cytidylyltransferase,...    117   6e-27   
ref|XP_002129881.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   6e-27   
ref|XP_004040834.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   6e-27   
dbj|BAH12702.1|  unnamed protein product                                117   6e-27   
ref|XP_006753085.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   6e-27   
ref|NP_001269133.1|  ethanolamine-phosphate cytidylyltransferase ...    116   6e-27   
ref|XP_010175405.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   6e-27   
ref|XP_009861142.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   7e-27   
ref|XP_011262174.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   7e-27   
ref|XP_624319.1|  PREDICTED: ethanolamine-phosphate cytidylyltran...    116   7e-27   
ref|XP_004639529.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   7e-27   
ref|XP_008058604.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   7e-27   
ref|XP_005735765.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   7e-27   
ref|XP_004539072.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    117   7e-27   
ref|XP_008544243.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   8e-27   
ref|XP_005283125.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    115   8e-27   
ref|XP_008011481.1|  PREDICTED: ethanolamine-phosphate cytidylylt...    116   8e-27   
ref|NP_001243363.1|  ethanolamine-phosphate cytidylyltransferase ...    116   8e-27   



>ref|XP_009770718.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009770719.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana sylvestris]
Length=426

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D T+S +RG QYPLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTISELRGHQYPLMNLHERSLSVLACRYVDEVIIGAP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIESPKDITTTSVAQ  393

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRNAKKEASEKKYYAEK+YVSG+
Sbjct  394  RIIANHEIYVKRNAKKEASEKKYYAEKQYVSGD  426


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_009783881.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
 ref|XP_009783882.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
sylvestris]
Length=429

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVGIY D TVS +RG QYPLMNL+ERSLSVLA RYVDEVIIGAP
Sbjct  277  GHVEILRRARQLGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLSVLACRYVDEVIIGAP  336

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNIS+VVHGTVSESNS ++   DPYAVPKSMGIF++I+SPKDITTTSV Q
Sbjct  337  WEVTQDMITTFNISVVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIESPKDITTTSVAQ  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KK ASEKKYYA++KYVSG+
Sbjct  397  RIIANHEIYVKRNTKKAASEKKYYAQRKYVSGD  429


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISSAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEEFMNRLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_009626648.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626649.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
 ref|XP_009626650.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nicotiana 
tomentosiformis]
Length=429

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 128/153 (84%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVGIY D TVS +RG QYPLMNL+ERSLSVLA RYVDEVIIG+P
Sbjct  277  GHVEILRRARQLGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLSVLACRYVDEVIIGSP  336

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTVSESNS ++   DPYAVPKSMGIF++I+SPKDITTTSV Q
Sbjct  337  WEVTQDMITTFNISLVVHGTVSESNSSMEGGQDPYAVPKSMGIFQVIESPKDITTTSVAQ  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  397  RIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISSAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEEFMNRLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_006360666.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=427

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFL VG+Y D T+S +RG QYPL+NLHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILRSARQLGDFLFVGVYTDETISELRGHQYPLLNLHERSLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFRII+SPKDITTTSV Q
Sbjct  335  WEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRIIESPKDITTTSVAQ  394

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN+KKEASEKKYYAEK+YVSG+
Sbjct  395  RIIANHEIYVKRNSKKEASEKKYYAEKQYVSGD  427


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A++LGD L+VG+  D  +   +G   P++ + ER   +   ++VDEVI  AP
Sbjct  79   GHANAIRQAKELGDELIVGVVSDEEIVANKGP--PVLCMEERLALISGLKWVDEVIANAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    + T   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFTEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_004240130.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010321543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=427

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D T+S +RG QYPLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILRSARQLGDFLLVGVYTDETISELRGHQYPLMNLHERSLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+SPKDI TTSV Q
Sbjct  335  WEVTHDMVTTFNISVVVHGTVSERNSSTGEEHDPYAVPKNMGIFRVIESPKDIITTSVAQ  394

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KKEASEKKYYAEK+YVSG+
Sbjct  395  RIIANHEIYVKRNTKKEASEKKYYAEKRYVSGD  427


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A++LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKELGDELIVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    + T   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFTEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_006361583.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006361584.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=429

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/153 (83%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQ GDFLLVGIY D TVS +RG QYPLMNL+ERSL VLA RYVDEVIIGAP
Sbjct  277  GHVEILRSARQHGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLGVLACRYVDEVIIGAP  336

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTVSESNS  +   DPYAVPKSMGIF++I+SPKDITT+SV Q
Sbjct  337  WEVTQDMITTFNISLVVHGTVSESNSSTEGGQDPYAVPKSMGIFQVIESPKDITTSSVAQ  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  397  RIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (55%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISSAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEYKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  194  DIVGRILS  201



>ref|XP_009616437.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Nicotiana tomentosiformis]
Length=426

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D TVS +RG QYPLMNLHERSLSVLA RYVDEVIIG+P
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIGSP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSVAQ  393

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KKEASEKKYYAEK+YVSG+
Sbjct  394  RIIANHEIYVKRNTKKEASEKKYYAEKQYVSGD  426


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_004242864.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
 ref|XP_010323368.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=429

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/153 (82%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+SARQ GDFLLVGIY D TVS +RG QYPLMNL+ERSL VLA RYVDEVIIGAP
Sbjct  277  GHVEILKSARQHGDFLLVGIYPDQTVSELRGHQYPLMNLYERSLGVLACRYVDEVIIGAP  336

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTVSESN   +   DPYAVPKSMGIF++I+SPKDITT+SV Q
Sbjct  337  WEVTQDMITTFNISLVVHGTVSESNFSTEGGQDPYAVPKSMGIFQVIESPKDITTSSVAQ  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRN KK ASEKKYYAE+KYVSG+
Sbjct  397  RIIANHEIYVKRNTKKAASEKKYYAERKYVSGD  429


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 70/128 (55%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIATKGP--PVLCMEERLALVSGLKWVDEVISSAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNHLFNEYKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  194  DIVGRILS  201



>emb|CBI40665.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILKNARQLGDFLLVGIHTDQTVSEHRGAHYPIMHLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W++TKDMITTFNISLVVHGTV+ESNS L    DPY VPKSMGIF +++SPKDITTTSV Q
Sbjct  270  WDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLESPKDITTTSVAQ  329

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE Y+KRN KK  SEKKYYAEKKYVSGE
Sbjct  330  RIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  362


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  11   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIANAP  68

Query  556  WEITKD-MITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  M T FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  69   YAITEQFMDTLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  125

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  126  DIVGRILS  133



>ref|XP_009770720.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana sylvestris]
Length=418

 Score =   225 bits (574),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D T+S +RG QYPLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTISELRGHQYPLMNLHERSLSVLACRYVDEVIIGAP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVSE NS   +  DPYAVPK+MGIFR+I+SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSERNSSTGERHDPYAVPKNMGIFRVIESPKDITTTSVAQ  393

Query  376  RIIANHEIYV  347
            RIIANHEIYV
Sbjct  394  RIIANHEIYV  403


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_010263306.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
 ref|XP_010263307.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Nelumbo 
nucifera]
Length=432

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+SARQ GDFLLVGI+ D TVS  RGTQYP+M+LHERSLSVLA RYVDEVIIG+P
Sbjct  280  GHVEILKSARQFGDFLLVGIHSDETVSEHRGTQYPIMDLHERSLSVLACRYVDEVIIGSP  339

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMI TFNISLVVHGTV+ES + L D  DPYA PKSMGIFR+I+SPKDITT+SV +
Sbjct  340  WEVTKDMIITFNISLVVHGTVAESTNFLNDDADPYAAPKSMGIFRMIESPKDITTSSVAK  399

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE+Y KRNAKK  SEK+YYAEKKYVSG+
Sbjct  400  RIIANHEVYKKRNAKKVESEKRYYAEKKYVSGD  432


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  82   GHANALRQAKALGDILVVGVVSDEEIIANKGP--PVLSMEERLTLVSGLKWVDEVITNAP  139

Query  556  WEIT-KDMITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT K M   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  140  YAITEKFMDKLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  197  DIVGRILSS  205



>ref|XP_011094065.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094066.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D TVS +RG  +PLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILKRARQLGDFLLVGIYADQTVSELRGNHFPLMNLHERSLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHGT++E N +L    DPY VPKSMGIF++++SP+DITTTS+ +
Sbjct  335  WEVTKDMITTFNISLVVHGTIAEKNPLLNGESDPYVVPKSMGIFQMLESPEDITTTSIAE  394

Query  376  RIIANHEIYVKRN  338
            RIIANHEIY+KRN
Sbjct  395  RIIANHEIYLKRN  407


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIISNKGP--PVLSMQERLALVSGLKWVDEVIPNAP  136

Query  556  WEITKDMITTF----NISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ +        I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  137  YEITEEFMNRLFKEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  193

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  194  DIVGRILS  201



>ref|XP_002265606.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656673.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 ref|XP_010656675.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
Length=431

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  279  GHVEILKNARQLGDFLLVGIHTDQTVSEHRGAHYPIMHLHERSLSVLACRYVDEVIIGAP  338

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W++TKDMITTFNISLVVHGTV+ESNS L    DPY VPKSMGIF +++SPKDITTTSV Q
Sbjct  339  WDVTKDMITTFNISLVVHGTVAESNSFLNGARDPYEVPKSMGIFHMLESPKDITTTSVAQ  398

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE Y+KRN KK  SEKKYYAEKKYVSGE
Sbjct  399  RIIANHEAYMKRNVKKAESEKKYYAEKKYVSGE  431


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 73/128 (57%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIANAP  137

Query  556  WEITKD-MITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  M T FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  138  YAITEQFMDTLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  194

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  195  DIVGRILS  202



>ref|XP_009616439.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Nicotiana tomentosiformis]
Length=416

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D TVS +RG QYPLMNLHERSLSVLA RYVDEVIIG+P
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIGSP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSVAQ  393

Query  376  RIIANHEIYVK  344
            RIIANHEIYVK
Sbjct  394  RIIANHEIYVK  404


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>emb|CDP20190.1| unnamed protein product [Coffea canephora]
Length=429

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLG+FLLVGIY D+TVS +RG+ +PLMNLHERSLSVL+ RYVDEVIIGAP
Sbjct  277  GHVEILKTARQLGEFLLVGIYSDHTVSELRGSHFPLMNLHERSLSVLSCRYVDEVIIGAP  336

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DMI TFNIS VVHGTV+ES+S L    DPYAVPKSMGIFR+++SPK ITT+SV Q
Sbjct  337  WEVTNDMIKTFNISFVVHGTVAESSSALNGKSDPYAVPKSMGIFRVLESPKTITTSSVAQ  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHEIYVKRNAKKEASEKKYY EKKYVSG+
Sbjct  397  RIIANHEIYVKRNAKKEASEKKYYEEKKYVSGD  429


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI+ AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIVKAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ +   FN   I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  137  YAITEEFMNQLFNKHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+A+
Sbjct  194  DIVGRILAS  202



>ref|XP_011094071.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
 ref|XP_011094072.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Sesamum 
indicum]
Length=427

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+SA+QLGDFLLVGIY D+TVS +RG  +PLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILKSAKQLGDFLLVGIYADHTVSELRGINFPLMNLHERSLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHGT++E N +     DPYAVPK+MGIF++I+SPKDITTTS+ +
Sbjct  335  WEVTKDMITTFNISLVVHGTIAEKNPLSIGKSDPYAVPKNMGIFQMIESPKDITTTSIAR  394

Query  376  RIIANHEIYVKRN  338
            RIIANHEIY+KRN
Sbjct  395  RIIANHEIYLKRN  407


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIISNKGP--PVLSMQERLALVSGLKWVDEVIPNAP  136

Query  556  WEITKDMITTF----NISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+D +        I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  137  YEITEDFMNRLFKEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  193

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  194  DIVGRILS  201



>gb|EYU25735.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25736.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
 gb|EYU25737.1| hypothetical protein MIMGU_mgv1a007058mg [Erythranthe guttata]
Length=421

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+SARQLGDFLLVG+Y D+TVS +RG+ +PLMNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILKSARQLGDFLLVGVYADHTVSELRGSHFPLMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHGT+SE+N  L    DPYA+PKS GIF+++ SPKDIT+TS+ +
Sbjct  329  WEVTKDMITTFNISLVVHGTISENNPFLNGKSDPYALPKSTGIFQMLDSPKDITSTSIAR  388

Query  376  RIIANHEIYVKRN  338
            RIIANHEIY KRN
Sbjct  389  RIIANHEIYEKRN  401


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 72/128 (56%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMPERLALVSGLKWVDEVIPNAP  136

Query  556  WEITKDMITTF----NISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ +        I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  137  YEITEEFMNRLFKEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  193

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  194  DIVGRILS  201



>ref|XP_009616433.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616434.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009616435.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Nicotiana tomentosiformis]
Length=442

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D TVS +RG QYPLMNLHERSLSVLA RYVDEVIIG+P
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIGSP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSVAQ  393

Query  376  RIIANHEIYVK  344
            RIIANHEIYV+
Sbjct  394  RIIANHEIYVE  404


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_009616438.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Nicotiana tomentosiformis]
Length=424

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D TVS +RG QYPLMNLHERSLSVLA RYVDEVIIG+P
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIGSP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSVAQ  393

Query  376  RIIANHEIYV  347
            RIIANHEIYV
Sbjct  394  RIIANHEIYV  403


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_009616436.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Nicotiana tomentosiformis]
Length=434

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG+Y D TVS +RG QYPLMNLHERSLSVLA RYVDEVIIG+P
Sbjct  274  GHVEILRSARQLGDFLLVGVYTDQTVSELRGHQYPLMNLHERSLSVLACRYVDEVIIGSP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNIS+VVHGTVS+ N+   +  DPYAVPK+MGIFR+I SPKDITTTSV Q
Sbjct  334  WEVTQDMVTTFNISVVVHGTVSDRNTSTGERHDPYAVPKNMGIFRVIDSPKDITTTSVAQ  393

Query  376  RIIANHEIYV  347
            RIIANHEIYV
Sbjct  394  RIIANHEIYV  403


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  79   GHANAIRQAKALGDELVVGVVSDEEIVANKGP--PVLCMEERLALVSGLKWVDEVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKQAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_002526236.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36133.1| conserved hypothetical protein [Ricinus communis]
Length=377

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVGI+ D  VS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  225  GHVEILRSARQLGDFLLVGIHTDQIVSEHRGEHYPIMHLHERSLSVLACRYVDEVIIGAP  284

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E NS+L    DPYAVPKSMGIFR ++SPK+I T+SV Q
Sbjct  285  WEVSKDMITTFNISLVVHGTVAECNSLLAGISDPYAVPKSMGIFRTLESPKNIITSSVAQ  344

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y+KRN+KK  SEKKYYAEK YVSG+
Sbjct  345  RIVANHEAYMKRNSKKAKSEKKYYAEKVYVSGD  377


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  34   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIANAP  91

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  92   YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKRAGRYKQIKRTEGVSST  148

Query  388  SVGQRII  368
             +  RI+
Sbjct  149  DIVGRIL  155



>gb|KDP45833.1| hypothetical protein JCGZ_17440 [Jatropha curcas]
Length=425

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVGI+ D  VS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRCARQLGDFLLVGIHTDQIVSEHRGKNYPIMHLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT++E NS+L    DPYAVPKSMGIF+I++SPK+ITTTSV Q
Sbjct  333  WEVSKDMITTFNISLVVHGTIAECNSLLAGIPDPYAVPKSMGIFQILESPKNITTTSVAQ  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y+KRNAKK  SEKKYYAEK YVSG+
Sbjct  393  RIVANHEAYMKRNAKKAESEKKYYAEKVYVSGD  425


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 71/128 (55%), Gaps = 9/128 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  +P
Sbjct  82   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIANSP  139

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + T FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  140  YAITEQFMNTLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKRAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIA  365
             +  RI++
Sbjct  197  DIVGRILS  204



>ref|XP_011017741.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
 ref|XP_011017742.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVGI+ D  VS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDM+TTFNI+LVVHGTV+E NS+L    DPYAVPKSMGIFR+++SPK ITTTSV Q
Sbjct  331  WEVTKDMVTTFNITLVVHGTVAEKNSLLAGEPDPYAVPKSMGIFRMLESPKTITTTSVAQ  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y+KRNAKK  +EKKYYAEK YVSG+
Sbjct  391  RIVANHEAYLKRNAKKAENEKKYYAEKVYVSGD  423


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIANAP  136

Query  556  WEIT-KDMITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT K M + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEKFMNSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_010106955.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC12837.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=421

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVG++DD+TVS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILKNARQLGDFLLVGMHDDHTVSEHRGKHYPIMHLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKD+I TFNISLVVHGT+SES+S L    DPY+VPKSMGIF++++SPK+ITTTSV Q
Sbjct  329  WEVTKDVIATFNISLVVHGTISESDSPLTRETDPYSVPKSMGIFQLLESPKNITTTSVAQ  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE Y KRNAKK  SEKKYYAEKKYVSG+
Sbjct  389  RIIANHEAYTKRNAKKAESEKKYYAEKKYVSGD  421


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLSLVSGLKWVDEVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEQFMNKLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKRAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_007014459.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 ref|XP_007014460.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32078.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
 gb|EOY32079.1| Phosphorylethanolamine cytidylyltransferase 1 isoform 1 [Theobroma 
cacao]
Length=424

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D  VS  RGT YP+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  272  GHVEILKRARQLGDFLLVGIHTDQIVSEHRGTPYPVMHLHERNLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHGTV+ESN++L    DPYAVPKSMGIFR+++SPK ITT+SV Q
Sbjct  332  WEVTKDMITTFNISLVVHGTVAESNTLLAGETDPYAVPKSMGIFRLLESPKRITTSSVAQ  391

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y+KRN
Sbjct  392  RIVANHEAYMKRN  404


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VD+VI  AP
Sbjct  81   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLAMEERLALVSGLKWVDQVIANAP  138

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +++ FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  139  YAITEQFMSSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  196  DIVGRILSS  204



>gb|ABX10445.1| ethanolamine-phosphate cytidylyltransferase 1 [Gossypium hirsutum]
Length=384

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D+ V   RG  YP+M++HERSLSVLA RYVDEVIIGAP
Sbjct  232  GHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIGAP  291

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++SPK +TT+SV Q
Sbjct  292  WEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSVSQ  351

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SE KYY EK YV+GE
Sbjct  352  RIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  384


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/122 (32%), Positives = 67/122 (55%), Gaps = 9/122 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VD+VI  AP
Sbjct  41   GHANALRQAKTLGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIANAP  98

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  99   YAITEQFMNSLFNEHKIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  155

Query  388  SV  383
             +
Sbjct  156  DI  157



>ref|XP_002325231.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
 gb|EEF03796.2| hypothetical protein POPTR_0018s13260g [Populus trichocarpa]
Length=423

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVGI+ D  VS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDM+TTFNI+LVVHGTV+E+NS+L    DPYAVPKSM IFR++ SPK ITTTSV Q
Sbjct  331  WEVTKDMVTTFNITLVVHGTVAENNSLLAGEPDPYAVPKSMRIFRMLDSPKTITTTSVAQ  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  +EKKYYAEK YVSG+
Sbjct  391  RIVANHEAYVKRNAKKAENEKKYYAEKVYVSGD  423


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIADAP  136

Query  556  WEIT-KDMITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT K M + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEKFMNSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_002308992.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
 gb|EEE92515.1| hypothetical protein POPTR_0006s07030g [Populus trichocarpa]
Length=395

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVGI+ D  VS  RG  +P+M+LHERSLSVLA  YVDEVIIGAP
Sbjct  243  GHVEILRSARQLGDFLLVGIHTDQIVSEHRGKGHPIMHLHERSLSVLACSYVDEVIIGAP  302

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNISLVVHGTV+ESNS+L    DPYAVPKSMGIF ++ SPK+ITTTSV Q
Sbjct  303  WEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSPKNITTTSVAQ  362

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y+KRNAKK  SEKKYYAEK +VSG+
Sbjct  363  RIVANHEAYLKRNAKKAESEKKYYAEKVHVSGD  395


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 68/122 (56%), Gaps = 9/122 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIANAP  136

Query  556  WEIT-KDMITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT K M + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEKFMNSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SV  383
             +
Sbjct  194  DI  195



>ref|XP_010688423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Beta 
vulgaris subsp. vulgaris]
Length=428

 Score =   215 bits (548),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR+ARQLGDFLLVGIY D  VS +RG  YPLMNLHERSLSVL  RYVDE+I+GAP
Sbjct  276  GHVEILRAARQLGDFLLVGIYTDQAVSDIRGLGYPLMNLHERSLSVLGCRYVDEIIMGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMI TFNI LVVHGTVSE+N ++    DPY VPKSMGIFR+I+SPK+ITT+SV  
Sbjct  336  WEVTKDMIKTFNICLVVHGTVSEANPLVNGDTDPYRVPKSMGIFRMIESPKNITTSSVAH  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE+Y KRNAKK  SEKKYY +K YVSG+
Sbjct  396  RIITNHEVYKKRNAKKVESEKKYYDQKTYVSGD  428


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEILANKGP--PVLSMEERLALVGGLKWVDEVIPNAP  136

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + T    + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEQFMKTLFKEYKIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRII  368
             +  RI+
Sbjct  194  DIVGRIL  200



>gb|KHG01776.1| Ethanolamine-phosphate cytidylyltransferase [Gossypium arboreum]
Length=425

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D+ V   RG  YP+M++HERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++SPK +TT+SV Q
Sbjct  333  WEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSVSQ  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SE KYY EK YV+GE
Sbjct  393  RIVANHEAYVKRNAKKAQSEMKYYEEKTYVAGE  425


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VD+VI  AP
Sbjct  82   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIANAP  139

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  140  YAITEQFMNSLFNEHKIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIAN  362
             +  RI+ +
Sbjct  197  DIVGRILCS  205



>gb|KJB23397.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
 gb|KJB23399.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=424

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D+ V   RG  YP+M++HERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++SPK +TT+SV Q
Sbjct  332  WEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSVSQ  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRN KK  SE KYY EK YV+GE
Sbjct  392  RIVANHEAYVKRNVKKAQSEMKYYEEKTYVAGE  424


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VD+VI  AP
Sbjct  81   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIANAP  138

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  139  YAITEQFMNSLFNEHKIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+ +
Sbjct  196  DIVGRILCS  204



>gb|KJB83345.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
 gb|KJB83346.1| hypothetical protein B456_013G242400 [Gossypium raimondii]
Length=424

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D  VS  RG  YP+M+L ER+LSVLA RYVDEVIIGAP
Sbjct  272  GHVEILKKARQLGDFLLVGIYPDYIVSEQRGMPYPVMHLLERTLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHGTV+ESNS L    DPYA+PKSMGIFR+++SPK ITT+SV Q
Sbjct  332  WEVTKDMITTFNISLVVHGTVAESNSSLPGETDPYAIPKSMGIFRLLESPKSITTSSVAQ  391

Query  376  RIIANHEIYVKRN  338
            RI+ NHE+Y+KRN
Sbjct  392  RIVTNHEVYMKRN  404


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 74/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VD+VI  AP
Sbjct  81   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PILSMEERLALVSGLKWVDQVIANAP  138

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + + FN   I  V+HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  139  YAITEEFMNSLFNEHKIDYVIHG---DDPCLLPDGSDAYALAKIAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  196  DIVGRILSS  204



>ref|XP_011020099.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Populus 
euphratica]
Length=423

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++ D  VS  RG  +P+M+LHERSLSVLA  YVDEVIIGAP
Sbjct  271  GHVEILRSARQLGDFLLVGVHTDQIVSEHRGKGHPIMHLHERSLSVLACSYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DM+TTFNISLVVHGTV+ESNS+L    DPYAVPKSMGIF ++ SPK+ TTTSV Q
Sbjct  331  WEVTRDMVTTFNISLVVHGTVAESNSLLAGEPDPYAVPKSMGIFWMLDSPKNTTTTSVAQ  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y+KRNAKK  SEKKYYAEK +VSG+
Sbjct  391  RIVANHEAYLKRNAKKTESEKKYYAEKVHVSGD  423


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVIANAP  136

Query  556  WEIT-KDMITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT K M + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEKFMNSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             + +RI+++
Sbjct  194  DIVERILSS  202



>ref|XP_006428518.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 ref|XP_006491802.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491803.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Citrus sinensis]
 gb|ESR41758.1| hypothetical protein CICLE_v10011809mg [Citrus clementina]
 gb|KDO54353.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
 gb|KDO54354.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=423

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D  VS  RG+ +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNI LVVHGTVSE+N+ L    DPY V KSMGIF++++SPK ITTTSV Q
Sbjct  331  WEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLESPKSITTTSVAQ  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE Y+KRNAKK  SEKKYY +K +VSG+
Sbjct  391  RIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  423


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIANAP  137

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  138  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  194

Query  388  SVGQRIIANHE  356
             +  RI+++ E
Sbjct  195  DIVGRILSSME  205



>ref|XP_004163014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN65519.1| hypothetical protein Csa_1G434170 [Cucumis sativus]
Length=423

 Score =   211 bits (537),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+EIL+ ARQLGDFLLVGI++D TVS +RG Q+P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  272  GHIEILKIARQLGDFLLVGIHNDQTVSNLRGKQFPIMHLHERSLSVLGCRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYAVPKSMGIF++++SPK ITTTS+ +
Sbjct  332  WEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYAVPKSMGIFKLLESPKTITTTSIAK  390

Query  376  RIIANHEIYVKRN  338
            RI+ANH+ + KRN
Sbjct  391  RIVANHDAFKKRN  403


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  82   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIANAP  139

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  140  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  197  DIVGRILSS  205



>ref|XP_004503546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=421

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE+L+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEVLKRARELGDFLLVGIHSDETVSENRGKHYPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEITKDMITTFNISLVVHGTV+E +  L    DPY VPKSMGIFR+++SP+D+TT+SV Q
Sbjct  331  WEITKDMITTFNISLVVHGTVAEKS--LYSETDPYEVPKSMGIFRLLESPRDLTTSSVAQ  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  389  RIMANHEAYVKRNAKKAQSEKRYYEERKYVSGD  421


 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 76/140 (54%), Gaps = 12/140 (9%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  82   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITDAP  139

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      +NI  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  140  YAITEKFLNRLFHEYNIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIANHE---IYVKRN  338
             +  RI+++ E   I+  RN
Sbjct  197  DIVGRIMSSLEEQKIHEDRN  216



>ref|XP_010553187.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Tarenaya 
hassleriana]
Length=421

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+DD TV   RG  +P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRVARELGDFLLVGIHDDQTVRAERGAHHPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+ESN  LK+  +PYAVP  MGIFRI++SP DITT+++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTVAESNDFLKEKDNPYAVPIRMGIFRILKSPLDITTSTIIK  388

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  389  RIVANHEAYQKRN  401


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  70   GHCNALRQARALGDQLVVGVISDEEIIANKGP--PVTPLHERLIMVKAVKWVDEVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEDFMRRLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_008453525.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453526.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
 ref|XP_008453527.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
melo]
Length=423

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 119/133 (89%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+EIL+ ARQLGDFLLVGI++D  VS +RG Q+P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  272  GHIEILKIARQLGDFLLVGIHNDQIVSKLRGKQFPIMHLHERSLSVLGCRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYAVPKSMGIF++++SPK+ITTTS+ +
Sbjct  332  WEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYAVPKSMGIFKLLESPKNITTTSIAK  390

Query  376  RIIANHEIYVKRN  338
            RI+ANH+ + KRN
Sbjct  391  RIVANHDAFKKRN  403


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  82   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDEVIANAP  139

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  140  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  196

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  197  DIVGRILSS  205



>ref|XP_007222601.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
 gb|EMJ23800.1| hypothetical protein PRUPE_ppa006288mg [Prunus persica]
Length=419

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI++D TVS  RG  +P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  268  GHVEILKNARQLGDFLLVGIHNDETVSEHRG-HHPIMHLHERSLSVLGCRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DM+TTFNISLVVHGTVSE NS+     DPY+VPKSMGIF++++SPK+ITTTSV Q
Sbjct  327  WEVTMDMVTTFNISLVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLESPKNITTTSVSQ  386

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  387  RIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 74/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPKAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+  ++  FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEQFMSRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>ref|XP_008223819.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Prunus 
mume]
Length=419

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI++D TVS  RG  +P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  268  GHVEILKNARQLGDFLLVGIHNDETVSEHRG-HHPIMHLHERSLSVLGCRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DM+TTFNISLVVHGTVSE NS+     DPY+VPKSMGIF++++SPK+ITTTSV Q
Sbjct  327  WEVTMDMVTTFNISLVVHGTVSEYNSLFPGESDPYSVPKSMGIFKLLESPKNITTTSVSQ  386

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  387  RIIANHDAYMKRNAKKAESEKKYYAQKTYVSGD  419


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  79   GHANALRQAKGLGDELVVGVVSDEEIIANKGP--PVLSMEERLVLVSGLKWVDEVIPKAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+  ++  FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEQFMSRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>gb|KJB23398.1| hypothetical protein B456_004G096200 [Gossypium raimondii]
Length=423

 Score =   208 bits (530),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 129/153 (84%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D+ V   RG  YP+M++HERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILKKARQLGDFLLVGIHTDHIVREHRGMPYPVMHVHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNIS+VVHGTV+ESNS+L    DPYA PKSMGIFR+++SPK +TT+SV Q
Sbjct  332  WEVTKDMITTFNISIVVHGTVAESNSLLPGETDPYAFPKSMGIFRLLESPKSLTTSSVSQ  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KK  SE KYY EK YV+GE
Sbjct  392  RIVANHEAY-KRNVKKAQSEMKYYEEKTYVAGE  423


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VD+VI  AP
Sbjct  81   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLPMEERLALVSGLKWVDQVIANAP  138

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  + + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  139  YAITEQFMNSLFNEHKIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+ +
Sbjct  196  DIVGRILCS  204



>ref|XP_004299778.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011464712.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=415

 Score =   208 bits (529),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI++D TVS  RG ++P+M+LHERSL VL  RYVDEVIIGAP
Sbjct  264  GHVEILKNARQLGDFLLVGIHNDYTVSEHRG-KHPIMHLHERSLGVLGCRYVDEVIIGAP  322

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEIT DMITTFNISLVVHGTVSE NS      DPY+VPKSMGIF++++SPK+ITTTSV Q
Sbjct  323  WEITMDMITTFNISLVVHGTVSEYNSSFTGESDPYSVPKSMGIFQVLESPKEITTTSVAQ  382

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y+KRNA+K ASEKKYY +KKYVSG+
Sbjct  383  RIIANHDAYLKRNARKTASEKKYYEQKKYVSGD  415


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VD+VI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLALVSGLKWVDQVIANAP  136

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+  +   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEQFMNKLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>gb|KDO54355.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=420

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D  V   RG+ +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILKKARQLGDFLLVGIYTDQIV---RGSYHPIMHLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNI LVVHGTVSE+N+ L    DPY V KSMGIF++++SPK ITTTSV Q
Sbjct  328  WEVTKDMITTFNICLVVHGTVSETNTPLTGQSDPYEVAKSMGIFQLLESPKSITTTSVAQ  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANHE Y+KRNAKK  SEKKYY +K +VSG+
Sbjct  388  RIIANHEAYMKRNAKKAVSEKKYYEQKMFVSGD  420


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIANAP  137

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  138  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  194

Query  388  SVGQRIIANHE  356
             +  RI+++ E
Sbjct  195  DIVGRILSSME  205



>ref|XP_007160226.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 ref|XP_007160227.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32220.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
 gb|ESW32221.1| hypothetical protein PHAVU_002G303400g [Phaseolus vulgaris]
Length=420

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIG+P
Sbjct  270  GHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIGSP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEITKDMITTFNISLVVHGTV+E +  L    DPY VPK MGIFR+++SPKDITT +V Q
Sbjct  330  WEITKDMITTFNISLVVHGTVAEKS--LNCEQDPYEVPKIMGIFRLLESPKDITTATVAQ  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SE++YY EKK+VSG+
Sbjct  388  RIMANHEAYVKRNAKKARSEQRYYEEKKFVSGD  420


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  ++  +G   P++++ ER + V   ++VDEVI  AP
Sbjct  81   GHANALRQAKALGDELVVGLVSDEEIAATKGP--PVLSMSERLVLVSGLKWVDEVITDAP  138

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      + I  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  139  YAITEQFLNRLFHEYKIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  196  DIVGRILSS  204



>ref|XP_003525313.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Glycine max]
 ref|XP_006580492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Glycine max]
 gb|KHM99852.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIG+P
Sbjct  270  GHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIGSP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEIT DMITTFNIS+VVHGTVSE +  L    DPY +PKSMGIFR+++SPKDITT +V Q
Sbjct  330  WEITNDMITTFNISVVVHGTVSEKS--LNCELDPYEIPKSMGIFRLLESPKDITTATVAQ  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SE++YY EKKYVSG+
Sbjct  388  RIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  81   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVITDAP  138

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      + I  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  139  YAITEQFLNRLFHEYKIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  196  DIVGRILSS  204



>ref|XP_010529959.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Tarenaya hassleriana]
Length=422

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRVARELGDFLLVGIHNDQTISAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+ES+  LK+  +PYAVP SMGIF I++SP D+TT+++ +
Sbjct  330  WEVSKDMITTFNISLVVHGTVAESSDFLKEKDNPYAVPISMGIFTILESPLDLTTSTIIK  389

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  390  RIVANHEAYQKRN  402


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  71   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPDAP  128

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  129  YAITEDFMKRLFVEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  185

Query  388  SVGQRII  368
             +  R++
Sbjct  186  DIVGRML  192



>gb|ACJ85759.1| unknown [Medicago truncatula]
 gb|AFK45819.1| unknown [Medicago truncatula]
Length=418

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV++L+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLASRYVDEVIIGAP
Sbjct  268  GHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++SPKDITTTSV Q
Sbjct  328  LEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSVAQ  385

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  386  RIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITDAP  136

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      +NI  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  137  YAITETFLNRLFHEYNIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRIMSS  202



>ref|XP_003630619.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
 gb|AET05095.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=418

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV++L+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLASRYVDEVIIGAP
Sbjct  268  GHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++SPKDITTTSV Q
Sbjct  328  LEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSVAQ  385

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  386  RIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  418


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 71/129 (55%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITDAP  136

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      +NI  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  137  YAITETFLNRLFHEYNIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRIMSS  202



>ref|XP_003630620.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=431

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 132/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV++L+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLASRYVDEVIIGAP
Sbjct  281  GHVQMLKRARELGDFLLVGIHSDETVSENRGNHYPIMHLHERSLSVLASRYVDEVIIGAP  340

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             EITKDMITTFNISLVVHGTV+E +  L    DPY VPKS+GIFR+++SPKDITTTSV Q
Sbjct  341  LEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYEVPKSIGIFRLLESPKDITTTSVAQ  398

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  399  RIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  431


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 66/122 (54%), Gaps = 9/122 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMDERLALVSGLKWVDEVITDAP  136

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      +NI  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  137  YAITETFLNRLFHEYNIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  193

Query  388  SV  383
             +
Sbjct  194  DI  195



>ref|XP_006293474.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
 gb|EOA26372.1| hypothetical protein CARUB_v10023288mg [Capsella rubella]
Length=420

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++SP DITT+++ +
Sbjct  328  WEVSKDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILESPLDITTSTIIR  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  388  RIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  420


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   ++I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEEFMKKLFDEYDIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_006663169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=188

 Score =   197 bits (500),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  36   GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  95

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+  ++SP DITT+++ +
Sbjct  96   WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLESPLDITTSTIIR  155

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  156  RIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  188



>ref|XP_009133281.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=418

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVSG RG Q+P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++SP DI+T+++ +
Sbjct  326  WEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTIIK  385

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  386  RIVANHEAYQKRN  398


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVNAVKWVDEVIPDAP  124

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  125  YAITEEFMKRLFDEYQIDYIIHG---DGPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>gb|ABA91254.1| phosphoethanolamine cytidylyltransferase, putative, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  192  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  251

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ +
Sbjct  252  WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIR  311

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  312  RIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  344


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 9/103 (9%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  73   GHCNALRQARALGDELIVGVVSDHEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  130

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPK  440
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K
Sbjct  131  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAK  170



>ref|XP_010048543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 ref|XP_010048546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Eucalyptus 
grandis]
 gb|KCW80818.1| hypothetical protein EUGRSUZ_C02186 [Eucalyptus grandis]
Length=418

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVG++ D  VS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILKRARQLGDFLLVGLHTDYIVSEHRGKHHPIMHLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT++ESN +     DPYAVPKSMGIFR+++S  +ITT+S+ Q
Sbjct  326  WEVSKDMITTFNISLVVHGTIAESNPLALVGIDPYAVPKSMGIFRLLESSNNITTSSIAQ  385

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y+KRN
Sbjct  386  RIVANHEAYMKRN  398


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++ + ER   V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLTMEERLALVSGLKWVDEVIPNAP  137

Query  556  WEITKD-MITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  M + FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  138  YAITEQFMKSLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  194

Query  388  SVGQRII  368
             +  RI+
Sbjct  195  DIVGRIL  201



>gb|EEE51553.1| hypothetical protein OsJ_32765 [Oryza sativa Japonica Group]
Length=362

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ +
Sbjct  270  WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIR  329

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  330  RIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  362


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  11   GHCNALRQARALGDELIVGVVSDHEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  68

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G F+ I+  + ++TT
Sbjct  69   YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRFKQIKRTEGVSTT  125

Query  388  SVGQRII  368
             +  R++
Sbjct  126  DIVGRML  132



>ref|XP_003530503.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
 ref|XP_006584793.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
 gb|KHN16693.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=420

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR+LGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA RYVDEVIIG+P
Sbjct  270  GHVEILKRARELGDFLLVGIHSDETVSEHRGNHYPIMHLHERSLSVLACRYVDEVIIGSP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEIT DMITTFNIS+VVHGTV+E    L    DPY VPKSMGIF +++SPKDITT +V Q
Sbjct  330  WEITNDMITTFNISVVVHGTVAEKT--LNCELDPYEVPKSMGIFHLLESPKDITTATVAQ  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE YVKRNAKK  SE++YY EKKYVSG+
Sbjct  388  RIMANHEAYVKRNAKKTRSEQRYYEEKKYVSGD  420


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 70/129 (54%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  81   GHANALRQAKALGDELVVGLVSDEEIVANKGP--PVLSMEERLALVSGLKWVDEVITDAP  138

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +      + I  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  139  YAITEQFLNRLFHEYKIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  195

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  196  DIVGRILSS  204



>ref|XP_010505515.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=362

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++SP DITT+++ +
Sbjct  270  WEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILESPLDITTSTIIR  329

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  330  RIVANHEAYQKRN  342


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  11   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  68

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  69   YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGSDAYALAKKAGRYKQIKRTEGVSST  125

Query  388  SVGQRII  368
             +  R++
Sbjct  126  DIVGRML  132



>ref|XP_009342823.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=419

 Score =   202 bits (515),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI++D TVS  RG +YP+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  268  GHVEILKNARQLGDFLLVGIHNDETVSEHRG-KYPIMHLHERSLSVLGCRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DMITTFNIS VVHGTVSE N  L    DPY+VPKSMGIF++++SP  ITTTSV Q
Sbjct  327  WEVTVDMITTFNISSVVHGTVSEYNFSLTGESDPYSVPKSMGIFKLLESPISITTTSVSQ  386

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y+KRNAKK  SEKKYYA+K YVSG+
Sbjct  387  RIIANHDAYLKRNAKKNESEKKYYAQKTYVSGD  419


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VD+VI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDQVITNAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+     + +   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEQFMGKLFSEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  194  DIVGRILSS  202



>emb|CCW28789.1| putative cytidylyltransferase [Arachis duranensis]
Length=400

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI+ D TVS  RG  YP+M+LHERSLSVLA  YVDEVIIGAP
Sbjct  250  GHVEILKKARQLGDFLLVGIHSDETVSSQRGNHYPIMHLHERSLSVLACGYVDEVIIGAP  309

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEITKDMITTFNIS VVHGTV+E +   +   DPY VPKSMGIF +++SPKDITTTSV Q
Sbjct  310  WEITKDMITTFNISAVVHGTVAEKSLSER---DPYEVPKSMGIFHLLESPKDITTTSVAQ  366

Query  376  RIIANHEIY-VKRN  338
            RI+ANHE Y VKRN
Sbjct  367  RIMANHEAYVVKRN  380


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  61   GHANALRQAKALGDELVVGLVSDEEILANKGP--PVLSMEERLTLVSGLKWVDEVITDAP  118

Query  556  WEITKDMIT----TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ +      +NI  V+HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  119  YAITEEFLNRLFYEYNIDYVIHG---DDPCLLPDGTDAYAAAKKAGRYKQIKRTEGVSST  175

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  176  DIVGRIMSS  184



>gb|EEC67567.1| hypothetical protein OsI_34911 [Oryza sativa Indica Group]
Length=424

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ +
Sbjct  332  WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIR  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  392  RIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  73   GHCNALRQARALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  130

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G F+ I+  + ++TT
Sbjct  131  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRFKQIKRTEGVSTT  187

Query  388  SVGQRII  368
             +  R++
Sbjct  188  DIVGRML  194



>ref|NP_001066024.1| Os12g0121300 [Oryza sativa Japonica Group]
 gb|ABA95682.2| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29043.1| Os12g0121300 [Oryza sativa Japonica Group]
 dbj|BAG94236.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE52664.1| hypothetical protein OsJ_35038 [Oryza sativa Japonica Group]
Length=424

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ +
Sbjct  332  WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIR  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  392  RIVANHEAYQKRNEKKEASEKKYYDSKSFVNGE  424


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A  LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  73   GHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  130

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + ++TT
Sbjct  131  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSTT  187

Query  388  SVGQRII  368
             +  R++
Sbjct  188  DIVGRML  194



>ref|XP_008351357.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
 ref|XP_008351358.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=418

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 133/153 (87%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++ARQLGDFLLVGI++D TV   RG ++P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  267  GHVEILKNARQLGDFLLVGIHNDETVCEHRG-KHPIMHLHERSLSVLGCRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DMITTFNIS VVHGTVSE NS+     DPY+VPKSMGIF++++SPK ITT+SV Q
Sbjct  326  WEVTLDMITTFNISSVVHGTVSEYNSLFTGESDPYSVPKSMGIFKLLESPKSITTSSVSQ  385

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y++RNAKK+ SEKKYYA+K YVSG+
Sbjct  386  RIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPNAP  136

Query  556  WEITKD-MITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+  M   FN   I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YEITEQFMGRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+A+
Sbjct  194  DIVGRILAS  202



>ref|XP_010517175.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=420

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++SP DITT+++ +
Sbjct  328  WEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFEILESPLDITTSTIIR  387

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  388  RIVANHEAYQKRN  400


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGSDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_010509160.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Camelina 
sativa]
Length=420

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF I++SP DITT+++ +
Sbjct  328  WEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYAVPISMGIFEILESPLDITTSTIIR  387

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  388  RIVANHEAYQKRN  400


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGSDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_009143367.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Brassica 
rapa]
Length=420

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++SP DITT+++ +
Sbjct  328  WEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTIIR  387

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY +K +VSG+
Sbjct  388  RIVANHEAYQKRNLKKEASEKKYYEQKAFVSGD  420


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  68   GHCNALRQARVLGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISDAP  125

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  126  YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  182

Query  388  SVGQRII  368
             +  R++
Sbjct  183  DIVGRML  189



>ref|XP_009341732.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009341733.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Pyrus x bretschneideri]
Length=418

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 132/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGI++D TVS  RG ++P+M+LHERSLSVL  RYVDEVIIGAP
Sbjct  267  GHVEILKKARQLGDFLLVGIHNDETVSEHRG-KHPIMHLHERSLSVLGCRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T DMITTFNIS VVHGTVSE NS      DPY++PKSMGIF++++SPK ITT+SV Q
Sbjct  326  WEVTLDMITTFNISSVVHGTVSEYNSSFTGESDPYSLPKSMGIFKLLESPKSITTSSVSQ  385

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RIIANH+ Y++RNAKK+ SEKKYYA+K YVSG+
Sbjct  386  RIIANHDAYLRRNAKKKESEKKYYAQKTYVSGD  418


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 72/129 (56%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  79   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIPNAP  136

Query  556  WEITKD-MITTFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT+  M   FN   I  ++HG   +   +L D  D YA+ K    ++ I+  + +++T
Sbjct  137  YEITEQFMGRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKASRYKQIKRTEGVSST  193

Query  388  SVGQRIIAN  362
             +  RI+A+
Sbjct  194  DIVGRILAS  202



>ref|XP_002450173.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
 gb|EES09161.1| hypothetical protein SORBIDRAFT_05g001470 [Sorghum bicolor]
Length=423

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+    +D  +PYAVPK+MGI+R ++SP DITT+++ +
Sbjct  331  WDVSKDMITTFNISLVVHGTIAENMDFAEDDSNPYAVPKAMGIYRRLESPLDITTSTIIR  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  391  RIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  423


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VD++I  AP
Sbjct  73   GHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPDAP  130

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  131  YAITEEFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  187

Query  388  SVGQRII  368
             +  R++
Sbjct  188  DIVGRML  194



>emb|CDP06353.1| unnamed protein product [Coffea canephora]
Length=362

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGI ++++SP DITT+++ +
Sbjct  270  WEVSKDMITTFNISLVVHGTVAEDNDFQKEKSNPYAVPISMGILKLLESPLDITTSTIIR  329

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  330  RIVSNHEAYQKRN  342


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  11   GHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSAVKWVDEVIPDAP  68

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  69   YAITEDFMKKLFDEYNIDYIIHG---DDPCILPDGTDAYALAKKAGRYKQIKRTEGVSST  125

Query  388  SVGQRII  368
             +  R++
Sbjct  126  DIVGRML  132



>ref|XP_008355786.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=249

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIG+P
Sbjct  97   GHVEILRKARELGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGSP  156

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++E+++  K+  +PY VP S+GIF+++ S  DITT+++ +
Sbjct  157  WEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDSSLDITTSTIIR  216

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  217  RIVSNHEAYQKRNXKKAASEKRYYEGKXYVSGD  249



>ref|XP_004302493.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Fragaria 
vesca subsp. vesca]
Length=428

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVL  RYVDEVIIGAP
Sbjct  276  GHVEILRVARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLGCRYVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEITKD+ITTFNISLVVHGTV+E+N+  K+T +PY VP SMGIF+++ SP DITT+++ +
Sbjct  336  WEITKDVITTFNISLVVHGTVAENNNFEKETGNPYEVPISMGIFKVLASPLDITTSTIIR  395

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  396  RIVSNHEAYQKRN  408


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVKAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   ++I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYDIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  S-VGQRIIANHEIYVKRN  338
              VG+ ++   E  V  N
Sbjct  192  DIVGRMLLCVRERSVNEN  209



>ref|XP_009606107.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
tomentosiformis]
Length=413

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  261  GHVEILRLARGLGDFLLVGIHTDQTVSANRGVHRPIMNLHERSLSVLACRYADEVIIGAP  320

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGIF+I+ SP DITT+++ +
Sbjct  321  WEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMGIFKILDSPLDITTSTIIR  380

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASE++YY  K YVSG+
Sbjct  381  RIVSNHEAYQKRNDKKAASERRYYEGKSYVSGD  413


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  62   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISDAP  119

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  120  YAITEDFMRKLFDEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  176

Query  388  SVGQRII  368
             +  R++
Sbjct  177  DIVGRML  183



>gb|KFK36771.1| hypothetical protein AALP_AA4G168400 [Arabis alpina]
Length=419

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  267  GHVEILRQARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+I++SP DITT+++ +
Sbjct  327  WEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQILESPLDITTSTIIR  386

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  387  RIVANHEAYQKRN  399


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISDAP  124

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  125  YAITEDFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>ref|XP_011101976.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Sesamum 
indicum]
Length=427

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  275  GHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYADEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SMGIF++++SP DITT+++ +
Sbjct  335  WEVSKDMITTFNISLVVHGTVAEDNDFQKEKRNPYAVPISMGIFKLLESPLDITTSTIIR  394

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEKKYY EK YVSG+
Sbjct  395  RIVSNHEAYQKRNDKKAQSEKKYYEEKTYVSGD  427


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  76   GHCNALRQARALGDQLVVGVVSDAEITVNKGP--PVTPLNERMIMVSAVKWVDEVIPDAP  133

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  134  YAITEDFMRKLFDEYNIDYIIHG---DDPCILPDGTDAYALAKKVGRYKQIKRTEGVSST  190

Query  388  SVGQRII  368
             +  R++
Sbjct  191  DIVGRML  197



>ref|NP_181401.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
 sp|Q9ZVI9.1|PECT1_ARATH RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine cytidylyltransferase 1 [Arabidopsis 
thaliana]
 gb|AAC67351.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM12983.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AAM91207.1| putative phospholipid cytidylyltransferase [Arabidopsis thaliana]
 gb|AEC09568.1| ethanolamine-phosphate cytidylyltransferase [Arabidopsis thaliana]
Length=421

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+++ SP DITT+++ +
Sbjct  329  WEVSRDTITTFDISLVVHGTVAESDDFRKEEDNPYSVPISMGIFQVLDSPLDITTSTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  389  RIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  126

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +      + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEDFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_007140015.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
 gb|ESW12009.1| hypothetical protein PHAVU_008G077100g [Phaseolus vulgaris]
Length=421

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRLARDLGDFLLVGIHTDQTVSTTRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT++E+N   K+ C+PYAVP SMG+F++++SP DITTT++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTIAENNDFQKEQCNPYAVPISMGVFKLLESPVDITTTTIIK  388

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  389  RIVSNHEAYQKRN  401


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLMMVNAVKWVDEVIPEAP  124

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  125  YAITEEFMKKLFDEYKIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>ref|XP_004977412.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 129/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   ++D  +PYAVP +MGI+R ++SP DITT+++ +
Sbjct  333  WDVSKDMITTFNISLVVHGTIAENMDFMEDDSNPYAVPIAMGIYRRLESPLDITTSTIIR  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  393  RIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VD++I  AP
Sbjct  74   GHCNALRQARALGDELIVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPDAP  131

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  132  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_010931423.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRIARGLGDFLLVGIHTDQTISTTRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT++E+   LK+  +PYAVP +MGI+R I+SP DITT+++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTIAENMDFLKEKSNPYAVPMAMGIYRQIESPLDITTSTIIR  388

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  389  RIVSNHEAYQKRN  401


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VDEVI  AP
Sbjct  70   GHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_006411085.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
 gb|ESQ52538.1| hypothetical protein EUTSA_v10016709mg [Eutrema salsugineum]
Length=423

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++SP DITT+++ +
Sbjct  331  WEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYAVPISMGIFQILESPLDITTSTIIK  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y  RN KKEASEKKYY +K +VSG+
Sbjct  391  RIVANHEAYQIRNKKKEASEKKYYEQKAFVSGD  423


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  71   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPDAP  128

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  129  YAITEDFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  185

Query  388  SVGQRII  368
             +  R++
Sbjct  186  DIVGRML  192



>ref|XP_008788034.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=417

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  265  GHVEILRIARGLGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  324

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT +E+   LK+  +PYAVP +MGI+R I+SP DI TT++ +
Sbjct  325  WEVSKDMITTFNISLVVHGTFAENMDFLKEKSNPYAVPMAMGIYRQIESPLDIRTTTIIK  384

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN +KEASE++YY  K +VSG+
Sbjct  385  RIVSNHEAYQKRNEQKEASERRYYEGKTHVSGD  417


 Score = 79.7 bits (195),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  L ER + V A ++VDEVI  AP
Sbjct  66   GHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLRERMIMVGAVKWVDEVIPDAP  123

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  124  YAITEEFMKKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKRAGRYKQIKRTEGVSST  180

Query  388  SVGQRII  368
             +  R++
Sbjct  181  DIVGRML  187



>emb|CDY07710.1| BnaA03g18010D [Brassica napus]
Length=439

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVSG RG Q+P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++SP DI+T+++ +
Sbjct  326  WEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTIIK  385

Query  376  RIIANHEIY  350
            RI+ANHE Y
Sbjct  386  RIVANHEAY  394


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPDAP  124

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  125  YAITEEFMKRLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>emb|CDY14442.1| BnaC03g21530D [Brassica napus]
Length=426

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVSG RG Q+P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  262  GHVEILRRARELGDFLLVGIHNDQTVSGKRGAQHPIMNLHERSLSVLACRYVDEVIIGAP  321

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+I  VVHGTV+ES+   K+  +PYAVPKSMGIF +++SP DI+T+++ +
Sbjct  322  WEVSKDTITTFDIWKVVHGTVAESDDFQKEEGNPYAVPKSMGIFEVLESPLDISTSTIIK  381

Query  376  RIIANHEIY  350
            RI+ANHE Y
Sbjct  382  RIVANHEAY  390


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  63   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVIPDAP  120

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  121  YAITEEFMKRLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  177

Query  388  SVGQRII  368
             +  R++
Sbjct  178  DIVGRML  184



>gb|EMS66153.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=312

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  160  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  219

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+I+KDMITTFNISLVV GT++E+    KD   PYAVP  MGIFR ++SP DITT+++ +
Sbjct  220  WDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLESPLDITTSTIIR  279

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  280  RIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  312


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -3

Query  601  VLASRYVDEVIIGAPWEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSM  434
            V A ++VD+VI  AP+ IT+D    + T +NI  ++HG   +   +L D  D YA+ K+ 
Sbjct  4    VGAVKWVDDVIPDAPYAITEDFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKNA  60

Query  433  GIFRIIQSPKDITTTSVGQRII  368
            G ++ I+  + ++TT +  R++
Sbjct  61   GRYKQIKRTEGVSTTDIVGRML  82



>ref|XP_009801689.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nicotiana 
sylvestris]
Length=413

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  261  GHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYTDEVIIGAP  320

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K+  +PYAVP SM IF+I+ SP DITT+++ +
Sbjct  321  WEVSKDMITTFNISLVVHGTVAEDNDFQKEKGNPYAVPISMDIFKILDSPLDITTSTIIR  380

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASE++YY  K YVSG+
Sbjct  381  RIVSNHEAYQKRNEKKAASERRYYEGKSYVSGD  413


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  62   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISDAP  119

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  120  YAITEDFMRKLFDEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  176

Query  388  SVGQRII  368
             +  R++
Sbjct  177  DIVGRML  183



>ref|XP_008679350.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Zea 
mays]
 gb|AFW64659.1| hypothetical protein ZEAMMB73_095669 [Zea mays]
Length=422

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRLARELGDFLLVGIHTDQTISATRGRHRPIMNLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+    +D   PYAVP +MGI+R ++SP DITT+++ +
Sbjct  330  WDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLESPLDITTSTIIR  389

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  390  RIVANHEAYQKRNEKKEASEKKYYEGKSFVNGE  422


 Score = 79.7 bits (195),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VD++I  AP
Sbjct  72   GHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMVMVRAVKWVDDIIPDAP  129

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  130  YAITEEFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  186

Query  388  SVGQRII  368
             +  R++
Sbjct  187  DIVGRML  193



>ref|NP_001170703.1| hypothetical protein [Zea mays]
 gb|ACR34556.1| unknown [Zea mays]
 tpg|DAA39300.1| TPA: hypothetical protein ZEAMMB73_839605 [Zea mays]
Length=424

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILRLARELGDFLLVGIHTDQTISATRGRHRPIMNLHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+    +D   PYAVP +MGI+R ++SP DITT+++ +
Sbjct  332  WDVSKDMITTFNISLVVHGTIAENMDFTEDDLHPYAVPMAMGIYRRLESPLDITTSTIIR  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  392  RIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  424


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VD++I  AP
Sbjct  74   GHCNALRQARALGDELVVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDIIPDAP  131

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  132  YAITEEFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_002879759.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56018.1| hypothetical protein ARALYDRAFT_903103 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 130/153 (85%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++D I TF+ISLVVHGTV+ES+   K+  +PY+VP SMGIF+++ SP DITT+++ +
Sbjct  329  WEVSRDTIMTFDISLVVHGTVAESDDFQKEEDNPYSVPISMGIFQVLDSPLDITTSTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRNAKKEASEKKYY +K +VSG+
Sbjct  389  RIVANHEAYQKRNAKKEASEKKYYEQKSFVSGD  421


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER   V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMTMVKAVKWVDEVISDAP  126

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +      + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEDFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>gb|AFW57038.1| hypothetical protein ZEAMMB73_658422 [Zea mays]
Length=425

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE LRSARQLGDFLLVGIYDD ++   RG + P+M+LHER+L VLA RYVDEVIIGAP
Sbjct  276  GHVEFLRSARQLGDFLLVGIYDDESIRDRRGCR-PIMHLHERTLGVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E NS      DPYAVPKSMGIF+ I+SPK ITT SV  
Sbjct  335  WEVSKDMITTFNISLVVHGTVAEGNSA--GEIDPYAVPKSMGIFQTIRSPKSITTLSVAT  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  393  RIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEV+  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVVPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>ref|XP_006664291.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=423

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNISLVVHGT++E+   +KD  +PYAVP++MGI+  ++SP DITT+++ +
Sbjct  331  WDVSKDMITTFNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYCRLESPLDITTSTIIR  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  391  RIVTNHEAYQKRNEKKEASEKKYYDSKSFVNGE  423


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A  LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  72   GHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  129

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  130  YAITEEFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  186

Query  388  SVGQRII  368
             +  R++
Sbjct  187  DIVGRML  193



>gb|EMT02889.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=371

 Score =   194 bits (494),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  219  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  278

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+I+KDMITTFNISLVV GT++E+    KD   PYAVP  MGIFR ++SP DITT+++ +
Sbjct  279  WDISKDMITTFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFRRLESPLDITTSTIIR  338

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  339  RIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  371


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 49/82 (60%), Gaps = 7/82 (9%)
 Frame = -3

Query  601  VLASRYVDEVIIGAPWEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSM  434
            V A ++VD+VI  AP+ IT+D    + T +NI  ++HG   +   +L D  D YA+ K+ 
Sbjct  63   VGAVKWVDDVIPDAPYAITEDFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKNA  119

Query  433  GIFRIIQSPKDITTTSVGQRII  368
            G ++ I+  + ++TT +  R++
Sbjct  120  GRYKQIKRTEGVSTTDIVGRML  141



>ref|XP_006362326.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Solanum 
tuberosum]
Length=414

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  262  GHVEILRLARGLGDFLLVGIHTDQTVSANRGGHRPIMNLHERSLSVLACRYADEVIIGAP  321

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E++KDMITTFNISLVVHGTV+E N   K+T +PYAVP SMGIF+++ SP DITT+++ +
Sbjct  322  GEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDSPLDITTSTIIR  381

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  382  RIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  414


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  63   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISDAP  120

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  121  YAITEEFMRKLFDEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  177

Query  388  SVGQRII  368
             +  R++
Sbjct  178  DIVGRML  184



>ref|XP_004249014.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Solanum 
lycopersicum]
Length=413

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  261  GHVEILRLARGLGDFLLVGIHTDQTVSANRGGHRPIMNLHERSLSVLACRYADEVIIGAP  320

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E++KDMITTFNISLVVHGTV+E N   K+T +PYAVP SMGIF+++ SP DITT+++ +
Sbjct  321  GEVSKDMITTFNISLVVHGTVAEDNDFQKETGNPYAVPISMGIFQVLDSPLDITTSTIIR  380

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  381  RIVSNHEAYQKRNEKKAASEKRYYEGKSYVSGD  413


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  62   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVGAVKWVDEVISDAP  119

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  120  YAITEEFMRKLFDEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  176

Query  388  SVGQRII  368
             +  R++
Sbjct  177  DIVGRML  183



>ref|XP_008244222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Prunus 
mume]
Length=428

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA R+VDEVIIGAP
Sbjct  276  GHVEILRIARELGDFLLVGIHTDQTVSAHRGAHRPIMNLHERSLSVLACRHVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDMITTFNISLVVHGTV+E+N+  K+  +PY VP SMGIF+++ SP DITT+++ +
Sbjct  336  WEISKDMITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLNSPLDITTSTIIR  395

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y  RN
Sbjct  396  RIVSNHEAYQIRN  408


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLDERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  S-VGQRIIANHEIYVKRN  338
              VG+ ++   E  V  N
Sbjct  192  DIVGRMLLCVRERSVSEN  209



>ref|XP_010913784.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010913785.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=424

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 111/133 (83%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVG++ D TVS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILRCARQLGDFLLVGVHGDQTVSERRGC-HPVMHLHERSLSVLACRYVDEVIIGAP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTV+E +    +  DPYA PKSMGIF+ I SPK+IT+TSV +
Sbjct  334  WEVTRDMITTFNISLVVHGTVAEGSC--NNEVDPYATPKSMGIFKTIASPKNITSTSVAR  391

Query  376  RIIANHEIYVKRN  338
            RII NHE Y KRN
Sbjct  392  RIIDNHEAYKKRN  404


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  88   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIANAP  145

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + T    +NI  ++HG   +   +L D  D Y   K  G ++ I+  + +++T
Sbjct  146  YAITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYGPAKKAGRYKQIKRTEGVSST  202

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  203  DIVGRILSS  211



>ref|XP_010922838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Elaeis 
guineensis]
Length=421

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRIARELGDFLLVGIHTDQTISSTRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNIS+VVHGT++E+   LK+  +PYAVP  MGI+  I+SP DITT+++ +
Sbjct  329  WQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMDMGIYWQIESPLDITTSTIIK  388

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  389  RIVSNHEAYQKRN  401


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VDEVI  AP
Sbjct  70   GHCNALRQAQALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPNAP  127

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEEFMKKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>emb|CDX91484.1| BnaC04g06660D [Brassica napus]
Length=411

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++SP DITT+++ +
Sbjct  328  WEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTIIR  387

Query  376  RIIANHEIY  350
            RI+ANHE Y
Sbjct  388  RIVANHEAY  396


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  68   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISDAP  125

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  126  YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  182

Query  388  SVGQRII  368
             +  R++
Sbjct  183  DIVGRML  189



>ref|XP_008804653.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=414

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  262  GHVEILRIARGLGDFLLVGIHTDQTISSTRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  321

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNIS+VVHGT++E+   LK+  +PYAVP +MGI+  I+SP DITT+++ +
Sbjct  322  WQVSKDMITTFNISMVVHGTIAENMDFLKEKSNPYAVPMAMGIYLQIESPLDITTSTIIR  381

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASE++YY  K YVSG+
Sbjct  382  RIVSNHEAYQKRNEKKEASERRYYEGKTYVSGD  414


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VDEVI  AP
Sbjct  63   GHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPNAP  120

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  121  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  177

Query  388  SVGQRII  368
             +  R++
Sbjct  178  DIVGRML  184



>ref|XP_010928770.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928771.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010928772.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Elaeis guineensis]
Length=419

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVG+Y D TVS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRCARQLGDFLLVGVYSDQTVSERRGC-HPIMHLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTV+E +    D  DPY  P+SMGIF+ I SP +IT TSV +
Sbjct  329  WEVTRDMITTFNISLVVHGTVAEGSC--SDEVDPYVTPRSMGIFKTIASPNNITWTSVAR  386

Query  376  RIIANHEIYVKRN  338
            RI+ NHE+Y KRN
Sbjct  387  RIVDNHEVYKKRN  399


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  83   GHANALRQAKSLGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIANAP  140

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + T    +NI  ++HG   +   +L D  D Y   K  G ++ I+  + +++T
Sbjct  141  YAITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYGPAKKAGRYKQIKRTEGVSST  197

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  198  DIVGRILSS  206



>ref|XP_009337844.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   194 bits (493),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  276  GHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP ++GIF++++SP DITT+++ +
Sbjct  336  WVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLESPLDITTSTIIR  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  396  RIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  SVGQRII  368
             +  R++
Sbjct  192  DIVGRML  198



>ref|XP_003552337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
1 [Glycine max]
Length=420

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++SP DITTT++ +
Sbjct  328  WEISKDMLTTFNISLVVHGTIAESNDFQKEECNPYAVPISMGIFKVLESPLDITTTTIIR  387

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y  RN
Sbjct  388  RIVSNHEAYQNRN  400


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  65   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPEAP  122

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  123  YAITEEFMKKLFDEYKIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  179

Query  388  SVGQRII  368
             +  R++
Sbjct  180  DIVGRML  186



>ref|XP_007207330.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
 gb|EMJ08529.1| hypothetical protein PRUPE_ppa006076mg [Prunus persica]
Length=428

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA R+VDEVIIGAP
Sbjct  276  GHVEILRIARELGDFLLVGIHTDQTVSAHRGAHRPIMNLHERSLSVLACRHVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KD+ITTFNISLVVHGTV+E+N+  K+  +PY VP SMGIF+++ SP DITT+++ +
Sbjct  336  WEISKDVITTFNISLVVHGTVAENNNFQKEQGNPYEVPISMGIFKVLDSPLDITTSTIIR  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y  RN KK ASEKKYY  K YVSG+
Sbjct  396  RIVSNHEAYQIRNEKKAASEKKYYEGKSYVSGD  428


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 74/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLDERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  S-VGQRIIANHEIYVKRN  338
              VG+ ++   E  V  N
Sbjct  192  DIVGRMLLCVRERSVSEN  209



>gb|EPS71148.1| hypothetical protein M569_03610, partial [Genlisea aurea]
Length=373

 Score =   192 bits (488),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 128/154 (83%), Gaps = 1/154 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  220  GHVEILRLARGLGDFLLVGIHTDQTVSINRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  279

Query  556  WEITKDMITTFNISLVVHGTVSESNSML-KDTCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            WE++KDMITTFNISLVVHGTV+E  S   KD  +PYA+P S+GIF+ ++SP DITT+++ 
Sbjct  280  WEVSKDMITTFNISLVVHGTVAEDYSDFHKDKQNPYAIPMSLGIFKQLESPLDITTSTII  339

Query  379  QRIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            +RI++NHE Y+KRN +K  SE++YY +KKYVSG+
Sbjct  340  KRIVSNHEAYLKRNERKAESERRYYEDKKYVSGD  373


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L ER + V A ++VDEVI  AP
Sbjct  21   GHCNALRQARALGDQLVVGVVSDAEITLNKGP--PVTPLDERMIMVSAIKWVDEVIPDAP  78

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  79   YAITEDFMRKLFEEYDIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  135

Query  388  SVGQRII  368
             +  R++
Sbjct  136  DIVGRML  142



>emb|CDX74894.1| BnaA05g06400D [Brassica napus]
Length=430

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  268  GHVEILRRARELGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTF+ISLVVHGTV+ES+   ++  +PYAVP SMGIF++++SP DITT+++ +
Sbjct  328  WEVSKDTITTFDISLVVHGTVAESDDFQREEENPYAVPISMGIFQVLESPLDITTSTIIR  387

Query  376  RIIANHEIY  350
            RI+ANHE Y
Sbjct  388  RIVANHEAY  396


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  68   GHCNALRQARVLGDQLVVGVVSDEEIIANKGP--PVTPLHERMIMVKAVKWVDEVISDAP  125

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  126  YAITEEFMKKLFDEYQIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  182

Query  388  SVGQRII  368
             +  R++
Sbjct  183  DIVGRML  189



>ref|XP_009141755.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brassica 
rapa]
Length=417

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS   G ++P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  265  GHVEILRRARELGDFLLVGIHNDQTVSARSGARHPIMNLHERSLSVLACRYVDEVIIGAP  324

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E++KD ITTF+ISLVVHGTV+ES++  K+  +PYAVP SMGIF+I++SP DITT+++ +
Sbjct  325  SEVSKDTITTFDISLVVHGTVAESDAFQKEEGNPYAVPISMGIFQILESPLDITTSTIIK  384

Query  376  RIIANHEIYVKRN  338
            RI+ NHE Y KRN
Sbjct  385  RIVNNHEAYQKRN  397


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMVMVKAVKWVDEVISDAP  124

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  125  YAITEDFMKRLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>ref|XP_008370315.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIG+P
Sbjct  276  GHVEILRKARELGDFLLVGIHTDQTVSATRGAHRPIMNLHERSLSVLACRYVDEVIIGSP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++E+++  K+  +PY VP S+GIF+++ S  DITT+++ +
Sbjct  336  WEISKDMLTTFNISLVVHGTIAENSNFEKEEGNPYQVPISLGIFKVLDSSLDITTSTIIR  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  396  RIVSNHEAYQKRNXKKAASEKRYYEGKAYVSGD  428


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K    ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAXRYKQIKRTEGVSST  191

Query  388  SVGQRII  368
             +  R++
Sbjct  192  DIVGRML  198



>ref|XP_010928769.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Elaeis guineensis]
Length=443

 Score =   194 bits (492),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVG+Y D TVS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  294  GHVEILRCARQLGDFLLVGVYSDQTVSERRGC-HPIMHLHERSLSVLACRYVDEVIIGAP  352

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMITTFNISLVVHGTV+E +    D  DPY  P+SMGIF+ I SP +IT TSV +
Sbjct  353  WEVTRDMITTFNISLVVHGTVAEGSC--SDEVDPYVTPRSMGIFKTIASPNNITWTSVAR  410

Query  376  RIIANHEIYVKRN  338
            RI+ NHE+Y KRN
Sbjct  411  RIVDNHEVYKKRN  423


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  107  GHANALRQAKSLGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIANAP  164

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + T    +NI  ++HG   +   +L D  D Y   K  G ++ I+  + +++T
Sbjct  165  YAITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYGPAKKAGRYKQIKRTEGVSST  221

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  222  DIVGRILSS  230



>dbj|BAD03428.1| putative phosphoethanolamine cytidylyltransferase [Oryza sativa 
Japonica Group]
 gb|EEC83124.1| hypothetical protein OsI_28285 [Oryza sativa Indica Group]
 gb|EEE68256.1| hypothetical protein OsJ_26465 [Oryza sativa Japonica Group]
Length=428

 Score =   193 bits (491),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 128/153 (84%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  279  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  337

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S++    DPYAVPKSMGIF+ I SPK ITT SV  
Sbjct  338  WEVSRDMITTFNISLVVHGTVTEGSSVV--GIDPYAVPKSMGIFQTITSPKPITTVSVAT  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  396  RIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  428


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  83   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  140

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  141  YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  197

Query  388  SVGQRII  368
             +  RI+
Sbjct  198  DIVGRIL  204



>gb|KJB27590.1| hypothetical protein B456_005G001400 [Gossypium raimondii]
Length=418

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVG ++D T+S  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRVARELGDFLLVGTHNDQTISAKRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+ES+   K+  +PY VP SMGIF++++SP DITTT++ +
Sbjct  326  WEVSKDMITTFNISLVVHGTVAESSDFQKEKDNPYDVPISMGIFKVLESPLDITTTTIIK  385

Query  376  RIIANHEIYVKRN  338
            RI+ANH+ Y KRN
Sbjct  386  RIVANHKAYQKRN  398


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR +GD L+VG+  D  +   +G   P+  +HER + V A ++VDEVI  AP
Sbjct  65   GHCNALRQARAVGDQLVVGVVSDAEIIANKGP--PVTPMHERMIMVKAVKWVDEVISDAP  122

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +      + +  ++HG   +   +L D  D YAV K  G F+ I+  + I++T
Sbjct  123  YAITEDFMKKLFDEYKMDYIIHG---DDPCVLPDGTDAYAVAKKAGRFKQIKRTEGISST  179

Query  388  SVGQRII  368
             +  R++
Sbjct  180  DIVGRLL  186



>ref|XP_009370855.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Pyrus 
x bretschneideri]
Length=428

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIG+P
Sbjct  276  GHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGSP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP S+GIF+++ S  DITT+++ +
Sbjct  336  WEISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPISLGIFKVLDSSLDITTSTIIR  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  396  RIVSNHEAYQKRNEKKAASEKRYYEGKAYVSGD  428


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  S-VGQRIIANHEIYVKRN  338
              VG+ ++   E  V  N
Sbjct  192  DIVGRMLLCVRERSVNEN  209



>ref|XP_009381352.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=419

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  267  GHVEILRLARELGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT++E+   LK   +PYAVP +M I++ ++SP DITT+++ +
Sbjct  327  WEVSKDMITTFNISLVVHGTIAENMDFLKKESNPYAVPMAMAIYKKLESPLDITTSTIIK  386

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++N+E Y KRN KKEASE++YY  K +VSG+
Sbjct  387  RIVSNNEAYQKRNEKKEASERRYYENKSFVSGD  419


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VDEVI  AP
Sbjct  68   GHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPNAP  125

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  126  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  182

Query  388  SVGQRII  368
             +  R++
Sbjct  183  DIVGRML  189



>ref|XP_003577861.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=425

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 126/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+I+KDMITTFNISLVVHGT++E+    +D  +PYAVP +MGI+  + SP DITT+++ +
Sbjct  333  WDISKDMITTFNISLVVHGTIAENMDYTEDDSNPYAVPIAMGIYHKLDSPLDITTSTIIR  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  393  RIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  425


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER   V A ++VD+VI  AP
Sbjct  74   GHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPDAP  131

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  132  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_006659222.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Oryza 
brachyantha]
Length=429

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 127/153 (83%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  280  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  338

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S+     DPYAVPKSMGIF+ I SPK ITT SV  
Sbjct  339  WEVSRDMITTFNISLVVHGTVTEGSSV--GGIDPYAVPKSMGIFQTITSPKPITTVSVAT  396

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  397  RIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  429


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  84   GHANALRQAKVLGDQLVVGVVSDEEIVANKGP--PVLSMDERLTLVSGLKWVDEVIPNAP  141

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  142  YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  198

Query  388  SVGQRII  368
             +  RI+
Sbjct  199  DIVGRIL  205



>ref|XP_004978492.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Setaria 
italica]
Length=425

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRLARELGDFLLVGIHTDQTISSTRGRHRPIMNLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+++KDMITTFNIS VVHGT++E+   ++D  +PYAVP +MGI+  ++SP DITT+++ +
Sbjct  333  WDVSKDMITTFNISSVVHGTIAENMDFMEDDSNPYAVPIAMGIYCRLESPLDITTSTIIR  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  393  RIVANHEAYQKRNEKKEASEKKYYESKSFVNGE  425


 Score = 82.8 bits (203),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VD+VI  AP
Sbjct  74   GHCNALRQARALGDELIVGVISDDEIKANKGP--PVTPLHERMIMVRAVKWVDDVIPDAP  131

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  132  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_004972545.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X4 [Setaria italica]
Length=466

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  317  GHVEILRSARQLGDFLLVGVHDDQSIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  375

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N       DPYAVPKSMGIF+ I SPK IT+ SV  
Sbjct  376  WEVSKDMITTFNISLVVHGTVAEGNP--AGEIDPYAVPKSMGIFKTITSPKSITSVSVAT  433

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  434  RIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  466


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  126  GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  183

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  184  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  240

Query  388  SVGQRII  368
             +  RI+
Sbjct  241  DIVGRIL  247



>ref|XP_009410481.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGA 
Sbjct  269  GHVEILRLARGLGDFLLVGIHTDQTISATRGAHRPIMNLHERSLSVLACRYVDEVIIGAT  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E+   LK+  +PYAVP  MGI++ ++SP DITT+++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTVAENMDFLKEESNPYAVPMDMGIYKQLKSPLDITTSTIIK  388

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  389  RIVSNHESYQKRN  401


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VDEVI  AP
Sbjct  70   GHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMIMVGAVKWVDEVIPDAP  127

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEKFMKKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_006842638.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
 gb|ERN04313.1| hypothetical protein AMTR_s00077p00187820 [Amborella trichopoda]
Length=423

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRVARELGDFLLVGIHTDQTVSTNRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W ++KDMITTFNISLVVHGTV+E++   K   +PYA P SMGI+R I+SP D+TTT++ +
Sbjct  331  WVVSKDMITTFNISLVVHGTVAENSDFWKVDDNPYAAPISMGIYREIESPLDVTTTTIIR  390

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  391  RIVANHESYQKRN  403


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLHERMIMVNAVKWVDEVISDAP  126

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEEFMNKLFNEYQIDYIIHG---DDPCLLPDGSDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_008358193.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=428

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA R+VDEVIIGAP
Sbjct  276  GHVEILRKARELGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRHVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I+KDM+TTFNISLVVHGTV+E+++  K+  +PY VP ++GIF++++SP DITT+++ +
Sbjct  336  WVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYEVPINLGIFKVLESPLDITTSTIIR  395

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  396  RIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  428


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIVNKGP--PVTPLNERMIMVNAVKWVDEVIPDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  SVGQRII  368
             +  R++
Sbjct  192  DIVGRML  198



>ref|XP_010278899.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Nelumbo 
nucifera]
Length=418

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RGT  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRLARGLGDFLLVGIHTDQTVSANRGTHRPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E+N   K  C+PY VP SMGIFR+++SP DITTT++ +
Sbjct  326  WEVSKDMITTFNISLVVHGTVAENNDYQKGKCNPYDVPISMGIFRLLESPLDITTTTIIR  385

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  386  RIVSNHEAYQKRN  398


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L+ER + V A ++VDE+I  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLNERMIMVSAVKWVDEIIPDAP  124

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  125  YAITEDFMNKLFNEYNIDYIIHG---DDPCILPDGTDAYALAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>ref|XP_009384337.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=421

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE+LR AR+LGDFLLVGI+ D T+S  +G   P+MNLHERSLSVLA RY DEVIIGAP
Sbjct  269  GHVEVLRLARELGDFLLVGIHTDQTISATQGPHRPIMNLHERSLSVLACRYADEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E     K+  +PYAVP +MGI++ + SP DITT+++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTVAEYMDFSKEESNPYAVPMAMGIYKQLNSPLDITTSTIIK  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEK+YY  K YVSG+
Sbjct  389  RIVSNHEAYQKRNEKKEASEKRYYETKTYVSGD  421


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D+ ++  +G   P++ LHER L V A ++VDEVI  AP
Sbjct  70   GHCNALRQAQALGDQLVVGVVSDDEITANKGP--PVIPLHERMLMVGAVKWVDEVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEEFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>gb|KDP21814.1| hypothetical protein JCGZ_00601 [Jatropha curcas]
Length=417

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  265  GHVEILRVARGLGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  324

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E+    ++ C+PYAVP SMGIF++++SP DITTT++ +
Sbjct  325  WEVSKDMITTFNISLVVHGTVAENIDYAEEKCNPYAVPISMGIFKVLESPLDITTTTIIR  384

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  385  RIVANHEAYQKRN  397


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  +HER + V A ++V EVI  AP
Sbjct  64   GHCNALRQARALGDELVVGVVSDAEIIANKGP--PVTPIHERMIMVNAIKWVHEVIPDAP  121

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  122  YAITEEFMKKLFEEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  178

Query  388  SVGQRII  368
             +  R++
Sbjct  179  DIVGRML  185



>gb|AAO43227.1| phosphoethanolamine cytidylyltransferase [Hordeum vulgare subsp. 
vulgare]
Length=421

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I+KDM+TTFNISLVVHGT++E+    +D  +PYAVP +MGI+  ++SP DITT+++ +
Sbjct  329  WHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLESPLDITTSTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  389  RIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER   V A ++VD+VI  AP
Sbjct  70   GHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  128  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>dbj|BAK04174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I+KDM+TTFNISLVVHGT++E+    +D  +PYAVP +MGI+  ++SP DITT+++ +
Sbjct  329  WHISKDMVTTFNISLVVHGTIAENMDYTEDDSNPYAVPVAMGIYHKLESPLDITTSTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  389  RIVSNHEAYQKRNEKKEASEKKYYDSKSFVNGE  421


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER   V A ++VD+VI  AP
Sbjct  70   GHCNALRQARALGDELVVGVVSDDEITANKGP--PVTPLHERMKMVRAVKWVDDVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  128  YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_003533643.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Glycine max]
Length=415

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  263  GHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  322

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S  DITTT++ +
Sbjct  323  WEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTIIR  382

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y  RN
Sbjct  383  RIVSNHEAYQNRN  395


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  60   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPEAP  117

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  118  YAITEEFMKKLFDEYKIDFIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  174

Query  388  SVGQRII  368
             +  R++
Sbjct  175  DIVGRML  181



>dbj|BAJ86064.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W+I+KDMI TFNISLVV GT++E+    KD   PYAVP  MGIF  ++SP DITT+++ +
Sbjct  329  WDISKDMIATFNISLVVQGTIAENMDFAKDESHPYAVPMDMGIFHRLESPLDITTSTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  389  RIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  421


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  L+ER + V A ++VD+VI  AP
Sbjct  70   GHCNALRQARALGDQLIVGVVSDDEITANKGP--PVTPLNERMVMVGAVKWVDDVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    + T +NI  ++HG   +   +L D  D YA+ K+ G ++ I+  + ++TT
Sbjct  128  YAITEDFMNKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKNAGRYKQIKRTEGVSTT  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_010036047.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Eucalyptus grandis]
 gb|KCW47570.1| hypothetical protein EUGRSUZ_K01317 [Eucalyptus grandis]
Length=425

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRVARGLGDFLLVGIHTDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTF+ISLVVHGT++E+N   KD  +PYAVP SMGIF++++SP DITTT++ +
Sbjct  333  WEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLESPLDITTTTIIR  392

Query  376  RIIANHEIYVKRN  338
            RI+ANHE ++KRN
Sbjct  393  RIVANHEAFLKRN  405


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L ER + V A ++VDEVI  AP
Sbjct  74   GHCNALRQARALGDQLVVGVVSDAEIVVNKGP--PVTPLKERMIMVNAVKWVDEVIPDAP  131

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   ++I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  132  YAITEEFMKKLFDEYHIDYIIHG---DDPCVLPDGTDAYALAKKAGKYKQIKRTEGVSST  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_003573570.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
 ref|XP_010234484.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=416

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG   P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  267  GHVEILRSARQLGDFLLVGVHDDQAIRERRGCG-PIMHLHERTLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S      DPYA+PKSMGIF+ + SPK IT+ SV  
Sbjct  326  WEVSRDMITTFNISLVVHGTVAERSS--AGEVDPYALPKSMGIFQTVTSPKTITSVSVAT  383

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE  YY +KK+VSG+
Sbjct  384  RIIDNHEAYKKRNLKKKASEDMYYTQKKFVSGD  416


 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  84   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  141

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++    +   ++I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  142  YEITEEFMNALFNKYDIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSST  198

Query  388  SVGQRII  368
             +  RI+
Sbjct  199  DIVGRIL  205



>ref|XP_010684667.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Beta 
vulgaris subsp. vulgaris]
Length=422

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRLARELGDFLLVGIHTDQTVSAKRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KD ITTFNISLVVHGTV+ES+   ++  +PYAVP SMGIF++I SP DITTT++ +
Sbjct  330  WEVSKDTITTFNISLVVHGTVAESDDFQQENDNPYAVPISMGIFKVIDSPLDITTTTIIR  389

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KK  SE+KYY EK YVSG+
Sbjct  390  RIVANHEAYQKRNEKKATSERKYYEEKTYVSGD  422


 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  LHER   V A ++VDEVI  AP
Sbjct  71   GHCNALRQARALGDQLVVGVVSDKEITANKGP--PVTPLHERMTMVQAVKWVDEVIPDAP  128

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G F+ I+  + +++T
Sbjct  129  YAITEDFMKKLFDEYNIDYIIHG---DDPCLLPDGSDAYALAKRAGRFKQIKRTEGVSST  185

Query  388  SVGQRII  368
             +  R++
Sbjct  186  DIVGRML  192



>gb|EEC66861.1| hypothetical protein OsI_33354 [Oryza sativa Indica Group]
Length=351

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  202  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  260

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S K ITT SV  
Sbjct  261  WEVSRDMITTFNISLVVHGTVTEGSSVVG--IDSYAVPKSMGIFQTITSTKPITTVSVAT  318

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  319  RIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  351


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  11   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  68

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  69   YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  125

Query  388  SVGQRII  368
             +  RI+
Sbjct  126  DIVGRIL  132



>ref|XP_006429675.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
 ref|XP_006481274.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Citrus 
sinensis]
 gb|ESR42915.1| hypothetical protein CICLE_v10011843mg [Citrus clementina]
Length=416

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  264  GHVEILRIARGLGDFLLVGIHNDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  323

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E+N   KD  +PYA+P SM IF++++SP DITTT++ +
Sbjct  324  WEVSKDMITTFNISLVVHGTVAENNDFQKDDGNPYAIPISMDIFKVLESPLDITTTTIIR  383

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASEK+YY  K +VSG+
Sbjct  384  RIVSNHEAYQKRNEKKNASEKRYYEGKTFVSGD  416


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  66   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISDAP  123

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + ITKD +      +NI  ++HG   +   +L D  D Y + K  G ++ I+  + +++T
Sbjct  124  YAITKDFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYELAKKAGRYKQIKRTEGVSST  180

Query  388  SVGQRII  368
             +  R++
Sbjct  181  DIVGRML  187



>ref|XP_006587893.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Glycine max]
Length=393

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  263  GHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  322

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S  DITTT++ +
Sbjct  323  WEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTIIR  382

Query  376  RIIANHEIYVK  344
            RI++NHE Y K
Sbjct  383  RIVSNHEAYQK  393


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  60   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPEAP  117

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  118  YAITEEFMKKLFDEYKIDFIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  174

Query  388  SVGQRII  368
             +  R++
Sbjct  175  DIVGRML  181



>gb|EYU26697.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26698.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
 gb|EYU26699.1| hypothetical protein MIMGU_mgv1a007403mg [Erythranthe guttata]
Length=409

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA +Y DEVIIGAP
Sbjct  257  GHVEILRLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACQYADEVIIGAP  316

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E++KDMITTFNISLVV GTV+E N   KD  +PYA+P S+GIF++++SP DITT+++ +
Sbjct  317  REVSKDMITTFNISLVVQGTVAEDNDFQKDKQNPYAIPISLGIFKLLESPLDITTSTIIR  376

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  377  RILSNHEAYQKRN  389


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L ER + V A ++VDEVI  AP
Sbjct  58   GHCNALRQARALGDQLVVGVVSDAEITVNKGP--PVTPLKERMIMVSAVKWVDEVIPDAP  115

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  116  YAITEDFMRKLFDEYNIDYIIHG---DDPCVLPDGSDAYALAKKVGRYKQIKRTEGVSST  172

Query  388  SVGQRII  368
             +  R++
Sbjct  173  DIVGRML  179



>gb|EPS64234.1| hypothetical protein M569_10547, partial [Genlisea aurea]
Length=423

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 115/136 (85%), Gaps = 3/136 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV+IL+ A+QLGDFLLVG+Y D TVS +RG ++PLMNL ERSLSVLA +YVD++IIGAP
Sbjct  269  GHVKILKKAKQLGDFLLVGLYADQTVSWLRGDRFPLMNLLERSLSVLACQYVDDIIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNS-MLKD--TCDPYAVPKSMGIFRIIQSPKDITTTS  386
            + +TKDMI+TFNISLVV G++SE N+ +L D    DPY VPK MGIFR ++SP+ ITT+S
Sbjct  329  FAVTKDMISTFNISLVVRGSISEDNNPLLWDGAASDPYDVPKGMGIFRNLESPEVITTSS  388

Query  385  VGQRIIANHEIYVKRN  338
            + +RIIANHEIY+KRN
Sbjct  389  IAERIIANHEIYLKRN  404


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 75/136 (55%), Gaps = 10/136 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI   P
Sbjct  71   GHANALRQAKALGDELVVGVASDEEIILYKGP--PVLSMQERLTLVNGLKWVDEVIPDVP  128

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  +VHG   +   +L D  D Y + K  G ++ I+  + +++T
Sbjct  129  YVITEDFMNVLFNEYKIDYIVHG---DDPCILSDGTDAYGLAKKAGRYKQIKRTEGVSST  185

Query  388  SVGQRIIANHEIYVKR  341
             +  RI+++ + YVK+
Sbjct  186  DIVGRILSSAD-YVKK  200



>dbj|BAJ95410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96704.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG   P+M+LHER+L VLA RYVDEVIIGAP
Sbjct  269  GHVEILRSARQLGDFLLVGVHDDQSIREKRGYP-PIMHLHERTLGVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E  S      DPYA+PK+MGIF+++ SPK IT+ SV  
Sbjct  328  WEVSRDMITTFNISLVVHGTVTEGGS--ASEVDPYALPKNMGIFQVVTSPKTITSVSVAT  385

Query  376  RIIANHEIYVKRN  338
            RII NHE Y KRN
Sbjct  386  RIIDNHEAYKKRN  398


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIRRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>ref|XP_010036048.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Eucalyptus grandis]
Length=425

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  273  GHVEILRVARGLGDFLLVGIHTDQTVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTF+ISLVVHGT++E+N   KD  +PYAVP SMGIF++++SP DITTT++ +
Sbjct  333  WEVSRDMITTFDISLVVHGTIAENNDFQKDEGNPYAVPISMGIFKVLESPLDITTTTIIR  392

Query  376  RIIANHEIYVKRN  338
            RI+ANHE ++KR+
Sbjct  393  RIVANHEAFLKRS  405


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  L ER + V A ++VDEVI  AP
Sbjct  74   GHCNALRQARALGDQLVVGVVSDAEIVVNKGP--PVTPLKERMIMVNAVKWVDEVIPDAP  131

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   ++I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  132  YAITEEFMKKLFDEYHIDYIIHG---DDPCVLPDGTDAYALAKKAGKYKQIKRTEGVSST  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>gb|KHN29458.1| Ethanolamine-phosphate cytidylyltransferase [Glycine soja]
Length=414

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D TVS  RG+  P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  263  GHVEILRLARDLGDFLLVGIHTDQTVSATRGSHRPIMNLHERSLSVLACRYVDEVIIGAP  322

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDM+TTFNISLVVHGT++ESN   K+ C+PYAVP SMGIF++++S  DITTT++ +
Sbjct  323  WEISKDMLTTFNISLVVHGTIAESNDFKKEECNPYAVPISMGIFKVLESTLDITTTTIIR  382

Query  376  RIIANHEIY  350
            RI++NHE Y
Sbjct  383  RIVSNHEAY  391


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 69/127 (54%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  60   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLVMVNAVKWVDEVIPEAP  117

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  118  YAITEEFMKKLFDEYKIDFIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  174

Query  388  SVGQRII  368
             +  R++
Sbjct  175  DIVGRML  181



>ref|XP_003564627.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=418

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG   P+M+LHER+LSVLA RYVDEVIIG+P
Sbjct  269  GHVEILRSARQLGDFLLVGVHDDQVIRERRGC-CPIMHLHERTLSVLACRYVDEVIIGSP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E+++DMITTFNISLVVHGTV+E +S+  D  DPYA+PKSMGIF+II SPK IT+ SV  
Sbjct  328  REVSRDMITTFNISLVVHGTVAEGSSV--DEVDPYALPKSMGIFQIITSPKAITSVSVAT  385

Query  376  RIIANHEIYVKRN  338
            RII NHE Y KRN
Sbjct  386  RIIDNHEAYKKRN  398


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPDAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIRRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>ref|XP_004137664.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
 gb|KGN58672.1| hypothetical protein Csa_3G727900 [Cucumis sativus]
Length=431

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR +GDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  279  GHVEILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  338

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP SMGIF+I+ SP DITTT++ +
Sbjct  339  WEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYAVPISMGIFKILDSPLDITTTTIIR  398

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  399  RIVSNHEAYQKRN  411


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  80   GHCNALRQARALGDQLVVGVVSDSEIIANKGP--PVTPLNERMIMVNAVKWVDEVIPNAP  137

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  138  YAITEEFMRKLFDEYKIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  194

Query  388  SVGQRII  368
             +  R++
Sbjct  195  DIVGRML  201



>ref|XP_004972544.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X3 [Setaria italica]
Length=476

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  317  GHVEILRSARQLGDFLLVGVHDDQSIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  375

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N       DPYAVPKSMGIF+ I SPK IT+ SV  
Sbjct  376  WEVSKDMITTFNISLVVHGTVAEGNP--AGEIDPYAVPKSMGIFKTITSPKSITSVSVAT  433

Query  376  RIIANHEIYVKRN  338
            RI+ NHE Y  R+
Sbjct  434  RIVDNHEAYKVRD  446


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  126  GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  183

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  184  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  240

Query  388  SVGQRII  368
             +  RI+
Sbjct  241  DIVGRIL  247



>ref|XP_002323699.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
 gb|EEF05460.2| hypothetical protein POPTR_0016s15020g [Populus trichocarpa]
Length=427

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 128/153 (84%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR LGDFLLVG+++D+ VS  RG   P+MNLHERSLSVLA +YVDEVIIGAP
Sbjct  275  GHVEILKLARALGDFLLVGMHNDHIVSSKRGAHRPIMNLHERSLSVLACQYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNIS VVHGTV+E+N  LK+  +PY VP SMGIF+++ SP DITTT++ +
Sbjct  335  WEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDSPLDITTTTIIK  394

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASE++YY +K YVSG+
Sbjct  395  RIVSNHEAYQKRNQKKAASERRYYEDKAYVSGD  427


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  +HER + V A ++VDEVI  AP
Sbjct  76   GHCNALRQARALGDQLVVGVVSDDEIIANKGP--PVTPVHERMIMVNAVKWVDEVISDAP  133

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  134  YAITEDFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  190

Query  388  SVGQRII  368
             +  R++
Sbjct  191  DIVGRML  197



>ref|XP_002990148.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
 gb|EFJ08708.1| hypothetical protein SELMODRAFT_131236 [Selaginella moellendorffii]
Length=416

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV IL  A+ LGDFLLVGI+ D TV   RG  +P+MNLHERSLSVL+ RY DE+IIGAP
Sbjct  264  GHVAILERAKALGDFLLVGIHTDQTVRTRRGAHHPVMNLHERSLSVLSCRYADEIIIGAP  323

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDM+TTFNISLVVHGTV+E+    +   DPYA PK +G F+I++SP++ITT+++  
Sbjct  324  WEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILESPRNITTSTIIA  383

Query  376  RIIANHEIYVKRN  338
            RI+ANHE + KRN
Sbjct  384  RIVANHEAFRKRN  396


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+M++ ER   V + ++VDEVI  AP
Sbjct  68   GHANALRQARALGDELVVGVVSDGEIESNKGP--PVMSMDERMAMVRSVKWVDEVIEDAP  125

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + I ++    + T + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  126  YAINEEFMNKLFTKYRIDYIIHG---DDPCLLPDGSDAYAHAKKAGRYKQIKRTEGVSST  182

Query  388  SVGQRII  368
             +  R++
Sbjct  183  DIVGRML  189



>ref|NP_001064493.1| Os10g0387000 [Oryza sativa Japonica Group]
 gb|ABB47464.1| Cytidylyltransferase family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26407.1| Os10g0387000 [Oryza sativa Japonica Group]
Length=425

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  276  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S K ITT SV  
Sbjct  335  WEVSRDMITTFNISLVVHGTVTEGSSVVG--IDSYAVPKSMGIFQTITSTKPITTVSVAT  392

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  393  RIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  425


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>gb|EAZ15919.1| hypothetical protein OsJ_31340 [Oryza sativa Japonica Group]
Length=423

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  274  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  332

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGTV+E +S++    D YAVPKSMGIF+ I S K ITT SV  
Sbjct  333  WEVSRDMITTFNISLVVHGTVTEGSSVVG--IDSYAVPKSMGIFQTITSTKPITTVSVAT  390

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RII NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  391  RIIDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  423


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  83   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  140

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  141  YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  197

Query  388  SVGQRII  368
             +  RI+
Sbjct  198  DIVGRIL  204



>ref|XP_002992541.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
 gb|EFJ06479.1| hypothetical protein SELMODRAFT_162424 [Selaginella moellendorffii]
Length=420

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV IL  A+ LGDFLLVGI+ D TV   RG  +P+MNLHERSLSVL+ RY DE+IIGAP
Sbjct  268  GHVAILERAKALGDFLLVGIHTDQTVRTRRGAHHPVMNLHERSLSVLSCRYADEIIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDM+TTFNISLVVHGTV+E+    +   DPYA PK +G F+I++SP++ITT+++  
Sbjct  328  WEVTKDMVTTFNISLVVHGTVAETTDFKEGDFDPYACPKQLGKFKILESPRNITTSTIIA  387

Query  376  RIIANHEIYVKRN  338
            RI+ANHE + KRN
Sbjct  388  RIVANHEAFRKRN  400


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+M++ ER   V + ++VDEVI  AP
Sbjct  72   GHANALRQARALGDELVVGVVSDGEIESNKGP--PVMSMDERMAMVRSVKWVDEVIEDAP  129

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + I ++    + T + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  130  YAINEEFMNKLFTKYRIDYIIHG---DDPCLLPDGSDAYAHAKKAGRYKQIKRTEGVSST  186

Query  388  SVGQRII  368
             +  R++
Sbjct  187  DIVGRML  193



>ref|XP_008442303.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Cucumis melo]
Length=430

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR +GDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  278  GHVEILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  337

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ SP DITTT++ +
Sbjct  338  WEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTIIR  397

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  398  RIVSNHEAYQKRN  410


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  79   GHCNALRQARALGDQLVVGVVSDSEITANKGP--PVTPLNERMIMVNAVKWVDEVIPNAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMRKLFDEYKIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRII  368
             +  R++
Sbjct  194  DIVGRML  200



>ref|XP_003579008.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Brachypodium 
distachyon]
Length=427

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  275  GHVEILRLARGLGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  334

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNIS+VV GT++E+    KD   PYAV   MGI   ++SP DITT+++ +
Sbjct  335  WEVSKDMITTFNISIVVQGTIAENMDFAKDESHPYAVAMEMGILHRLESPLDITTSTIIR  394

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KKEASEKKYY  K +V+GE
Sbjct  395  RIVSNHEAYQKRNEKKEASEKKYYESKNFVNGE  427


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 75/127 (59%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  LHER + V A ++VD+VI  AP
Sbjct  75   GHCNALRQARALGDQLVVGVVSDDEITANKGP--PVTPLHERMVMVGAVKWVDDVIPDAP  132

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    + T +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + ++TT
Sbjct  133  YAITEDFMKKLFTEYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIKRTEGVSTT  189

Query  388  SVGQRII  368
             +  R++
Sbjct  190  DIVGRML  196



>ref|XP_008781724.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
 ref|XP_008781725.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Phoenix 
dactylifera]
Length=420

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR ARQLGDFLLVG++ D TVS   G  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILRCARQLGDFLLVGVHSDQTVSERIGC-HPIMHLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+T+DMI+TFNISLVVHGTV+E +       DPYA+PKSMGIF+ I SPK IT+T V +
Sbjct  330  WEVTRDMISTFNISLVVHGTVAEGSC--NSEVDPYAIPKSMGIFKTIASPKVITSTLVAR  387

Query  376  RIIANHEIYVKRN  338
            RI+ NHE Y KRN
Sbjct  388  RIMDNHEAYKKRN  400


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 73/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER + V   ++VDEVI  AP
Sbjct  84   GHANALRQAKALGDELVVGVVSDEEIVANKGP--PVLSMEERLILVSGLKWVDEVIANAP  141

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + T    +NI  ++HG   +   +L D  D Y   K  G ++ I+  + +++T
Sbjct  142  YAITEEFMNTLFNKYNIDYIIHG---DDPCVLPDGTDAYGPAKKAGRYKQIKRTEGVSST  198

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  199  DIVGRILSS  207



>ref|XP_004972543.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Setaria italica]
Length=494

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 129/179 (72%), Gaps = 27/179 (15%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  317  GHVEILRSARQLGDFLLVGVHDDQSIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  375

Query  556  WEITKDMITTFNISLVVHGTVSESNS--------------------------MLKDTCDP  455
            WE++KDMITTFNISLVVHGTV+E N                           +L+   DP
Sbjct  376  WEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEIDP  435

Query  454  YAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            YAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y KRN KK+ASE +YY +KK+VSG+
Sbjct  436  YAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKKRNLKKKASEDRYYTQKKFVSGD  494


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  126  GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  183

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  184  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  240

Query  388  SVGQRII  368
             +  RI+
Sbjct  241  DIVGRIL  247



>emb|CDM85025.1| unnamed protein product [Triticum aestivum]
Length=418

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 107/133 (80%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG   P+M+LHER+L VLA RYVDEVIIGAP
Sbjct  269  GHVEILRSARQLGDFLLVGVHDDQSIREKRGYP-PIMHLHERTLGVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E+++DMITTFNISLVVHGTV+E  S      DPYA+PKSMGIF+++ SPK IT+ SV  
Sbjct  328  LEVSRDMITTFNISLVVHGTVAEGGS--ASEVDPYALPKSMGIFQVVTSPKTITSVSVAT  385

Query  376  RIIANHEIYVKRN  338
            RII NHE Y KRN
Sbjct  386  RIIDNHEAYKKRN  398


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIRRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>gb|KEH23310.1| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=312

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR  GDFLLVGI+ D TVS  RG   P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  160  GHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIGAP  219

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ SP DITTT++ +
Sbjct  220  WEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTIIR  279

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  280  RIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  312



>ref|XP_002519980.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
 gb|EEF42304.1| Ethanolamine-phosphate cytidylyltransferase, putative [Ricinus 
communis]
Length=418

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI++D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRVARGLGDFLLVGIHNDQTVSARRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNI LVVHGTV+E+    ++  +PY VP SMGIF++++SP DITTT++ +
Sbjct  326  WEVSKDMITTFNIFLVVHGTVAENTDYQEEKSNPYDVPISMGIFQVLESPLDITTTTIIR  385

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI+ANHE Y KRN KK  SEK+YY  K +VSG+
Sbjct  386  RIVANHEAYQKRNEKKAESEKRYYEGKTFVSGD  418


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDELVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVIPDAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  127  YAITEEFMKKLFEEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>emb|CBI31131.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   181 bits (459),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++SP DITTT++ +
Sbjct  270  WEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTIIR  329

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  330  RIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  362


 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L+ER + V   ++VDEVI  AP
Sbjct  11   GHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPDAP  68

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  69   YAITEDFMKKLFDEYNIDYIIHG---DDPCILPDGTDAYALAKKAGRYKQIKRTEGVSST  125

Query  388  SVGQRII  368
             +  R++
Sbjct  126  DIVGRML  132



>ref|XP_011018911.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Populus 
euphratica]
Length=428

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI+ D  VS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  276  GHVEILRLARTLGDFLLVGIHSDQIVSAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  335

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDMITTFNIS VVHGTV+E++   K+  +PYAVP SMGIF+I+ SP DITTT++ +
Sbjct  336  WEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKILDSPLDITTTTIIR  395

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  396  RIVSNHEAYQKRN  408


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  77   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISDAP  134

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  135  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  191

Query  388  SVGQRII  368
             +  R++
Sbjct  192  DIVGRML  198



>ref|XP_001759318.1| predicted protein [Physcomitrella patens]
 gb|EDQ76002.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 108/136 (79%), Gaps = 3/136 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE L++AR +GDFLLVGI+ D  VS  RG  +P+M++HERSLSVLA RYVDEVIIGAP
Sbjct  267  GHVETLKAARAMGDFLLVGIHSDQIVSAHRGPNHPIMHVHERSLSVLACRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSML---KDTCDPYAVPKSMGIFRIIQSPKDITTTS  386
            WE+TKDMITTFNISLVVHGT +E N +L   +   DPY+  K+ GIF  I+SP+DITT++
Sbjct  327  WEVTKDMITTFNISLVVHGTCAEENFVLPWRQGEIDPYSAAKAAGIFSEIKSPRDITTST  386

Query  385  VGQRIIANHEIYVKRN  338
            +  RI+ANH+ Y KRN
Sbjct  387  IISRILANHDAYKKRN  402


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+M++ ER + V + ++VDEVI  AP
Sbjct  69   GHANALRQARALGDELVVGVMSDEEIKANKGP--PVMSMDERVVMVSSVKWVDEVIQDAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EI       + T + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  127  YEINVEFMNKLFTEYRIDYIIHG---DDPCLLPDGSDAYAHAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>gb|EMT24851.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=418

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG   P+M+LHER+L VLA RYVDEVIIGAP
Sbjct  269  GHVEILRSARQLGDFLLVGVHDDQSIREKRGYP-PIMHLHERTLGVLACRYVDEVIIGAP  327

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E+++DMITTFNISLVVHGTV E  S      DPYA+PKSMGIF+++ SPK IT+ SV  
Sbjct  328  LEVSRDMITTFNISLVVHGTVVEGGS--ASEVDPYALPKSMGIFQVVTSPKTITSVSVAT  385

Query  376  RIIANHEIYVKRN  338
            RII NHE Y KRN
Sbjct  386  RIIDNHEAYKKRN  398


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVVNKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIRRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>ref|XP_008442304.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X3 [Cucumis melo]
Length=376

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            G++ IL+ AR +GDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  224  GYLSILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  283

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ SP DITTT++ +
Sbjct  284  WEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTIIR  343

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  344  RIVSNHEAYQKRN  356



>ref|XP_002265169.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Vitis 
vinifera]
 emb|CAQ58612.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=421

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  269  GHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  328

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++SP DITTT++ +
Sbjct  329  WEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTIIR  388

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  389  RIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  421


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L+ER + V   ++VDEVI  AP
Sbjct  70   GHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEDFMKKLFDEYNIDYIIHG---DDPCILPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>emb|CAQ58636.1| Ethanolamine-phosphate cytidylyltransferase [Vitis vinifera]
Length=424

 Score =   180 bits (457),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR LGDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILKLARGLGDFLLVGIHTDQTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  331

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N+  K   DPYA+P S+GI+  ++SP DITTT++ +
Sbjct  332  WEVSKDMITTFNISLVVHGTVAEYNNFPKGKEDPYAIPISLGIYEQLESPLDITTTTIIR  391

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEK+YY +K +VSG+
Sbjct  392  RIVSNHEAYQKRNEKKAESEKRYYEDKTFVSGD  424


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  ++  +G   P+  L+ER + V   ++VDEVI  AP
Sbjct  70   GHCNALRQARALGDQLVVGVVSDAEITANKGP--PVTPLNERMIMVSGVKWVDEVIPDAP  127

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEDFMKKLFDEYNIDYIIHG---DDPCILPDGTDAYALAKKAGRYKQIKRTEGVSST  184

Query  388  SVGQRII  368
             +  R++
Sbjct  185  DIVGRML  191



>ref|XP_004972546.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X5 [Setaria italica]
 ref|XP_004972547.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X6 [Setaria italica]
Length=462

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 111/159 (70%), Gaps = 27/159 (17%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  275  GHVEILRSARQLGDFLLVGVHDDQSIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNS--------------------------MLKDTCDP  455
            WE++KDMITTFNISLVVHGTV+E N                           +L+   DP
Sbjct  334  WEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEIDP  393

Query  454  YAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  338
            YAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y  R+
Sbjct  394  YAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  432


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  84   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  141

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  142  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  198

Query  388  SVGQRII  368
             +  RI+
Sbjct  199  DIVGRIL  205



>ref|XP_003623695.1| Ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=419

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR  GDFLLVGI+ D TVS  RG   P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  267  GHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIGAP  326

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ SP DITTT++ +
Sbjct  327  WEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTIIR  386

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  387  RIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  419


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  66   GHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPEAP  123

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  124  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  180

Query  388  SVGQRII  368
             +  R++
Sbjct  181  DIVGRML  187



>gb|AES79913.2| ethanolamine-phosphate cytidylyltransferase [Medicago truncatula]
Length=422

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR  GDFLLVGI+ D TVS  RG   P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ SP DITTT++ +
Sbjct  330  WEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTIIR  389

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  390  RIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422


 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPEAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  127  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>gb|AFK43034.1| unknown [Medicago truncatula]
Length=422

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR  GDFLLVGI+ D TVS  RG   P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  270  GHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMSLHERSLSVLACRYVDEVIIGAP  329

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGT +E+    K+  +PYAVP S+GIF+I+ SP DITTT++ +
Sbjct  330  WEVSKDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISLGIFQILDSPLDITTTTIIR  389

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK  SEKKYY  K +VSG+
Sbjct  390  RIVSNHEAYQKRNEKKGESEKKYYESKTHVSGD  422


 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  69   GHCNALRQARALGDQLIVGVVSDDEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPEAP  126

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  127  YTITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  183

Query  388  SVGQRII  368
             +  R++
Sbjct  184  DIVGRML  190



>ref|XP_001780359.1| predicted protein [Physcomitrella patens]
 gb|EDQ54813.1| predicted protein [Physcomitrella patens]
Length=393

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 104/133 (78%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE L++AR +GDFLLVGI+ D  VS  RG  +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  243  GHVETLKAARAMGDFLLVGIHSDQIVSANRGLNHPIMHLHERSLSVLACRYVDEVIIGAP  302

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+TKDMITTFNISLVVHG+ +E N +     DPY   K+ GIF  I+SP++ITT+++  
Sbjct  303  WEVTKDMITTFNISLVVHGSCAEENELR--NIDPYKAAKAAGIFAEIKSPRNITTSTIIS  360

Query  376  RIIANHEIYVKRN  338
            RI+ NHE Y KRN
Sbjct  361  RILTNHEAYRKRN  373


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+M++ ER + V + ++VDEVI  AP
Sbjct  45   GHANALRQARVLGDELVVGVISDEEIKANKGP--PVMSMDERVVMVSSVKWVDEVIQDAP  102

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EI  +    + T + I  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  103  YEINAEFMNKLFTEYKIDYIIHG---DDPCLLPDGSDAYAHAKKAGRYKQIKRTEGVSST  159

Query  388  SVGQRII  368
             +  R++
Sbjct  160  DIVGRML  166



>ref|XP_004972542.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Setaria italica]
Length=504

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 111/159 (70%), Gaps = 27/159 (17%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD ++   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  317  GHVEILRSARQLGDFLLVGVHDDQSIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  375

Query  556  WEITKDMITTFNISLVVHGTVSESNS--------------------------MLKDTCDP  455
            WE++KDMITTFNISLVVHGTV+E N                           +L+   DP
Sbjct  376  WEVSKDMITTFNISLVVHGTVAEGNPAVSINELMSKTNLHVVAEFIMKIDEWVLQGEIDP  435

Query  454  YAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  338
            YAVPKSMGIF+ I SPK IT+ SV  RI+ NHE Y  R+
Sbjct  436  YAVPKSMGIFKTITSPKSITSVSVATRIVDNHEAYKVRD  474


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 74/127 (58%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  126  GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  183

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    ++I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  184  YEITEEFMNTLFNKYSIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  240

Query  388  SVGQRII  368
             +  RI+
Sbjct  241  DIVGRIL  247



>gb|EEC68755.1| hypothetical protein OsI_37278 [Oryza sativa Indica Group]
Length=412

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/203 (52%), Positives = 130/203 (64%), Gaps = 50/203 (25%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI+ D T+S  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  210  GHVEILRLARELGDFLLVGIHTDQTISSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAP  269

Query  556  WEITK--------------------------------------------------DMITT  527
            W+++K                                                  DMITT
Sbjct  270  WDVSKDMELLDATASNSSLNMAQLCMHSSKIEHDIYATPAKALLTAIIDFRYRLTDMITT  329

Query  526  FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYV  347
            FNISLVVHGT++E+   +KD  +PYAVP++MGI+R ++SP DITT+++ +RI+ANHE Y 
Sbjct  330  FNISLVVHGTIAENMDFMKDDLNPYAVPRAMGIYRRLESPLDITTSTIIRRIVANHEAYQ  389

Query  346  KRNakkeasekkyyaekkYVSGE  278
            KRN KKEASEKKYY  K +V+GE
Sbjct  390  KRNEKKEASEKKYYDSKSFVNGE  412


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A  LGD L+VG+  D+ ++  +G   P+  LHER + V A ++V +VI  AP
Sbjct  11   GHCNALRQAHALGDELIVGVVSDDEITANKGP--PVTPLHERLIMVRAVKWVHDVIPDAP  68

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + ++TT
Sbjct  69   YAITEDFMNKLFNEYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSTT  125

Query  388  SVGQRII  368
             +  R++
Sbjct  126  DIVGRML  132



>ref|XP_008442302.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Cucumis melo]
Length=493

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            G++ IL+ AR +GDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  341  GYLSILKHARSMGDFLLVGIHTDLTVSANRGAHRPIMNLHERSLSVLACRYVDEVIIGAP  400

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNISLVVHGTV+E N   K  C+PYAVP +MGIF+I+ SP DITTT++ +
Sbjct  401  WEVSKDMITTFNISLVVHGTVAEVNDFQKRDCNPYAVPINMGIFKILDSPLDITTTTIIR  460

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  461  RIVSNHEAYQKRN  473


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ ++  +G   P+  L+ER + V A ++VDEVI  AP
Sbjct  79   GHCNALRQARALGDQLVVGVVSDSEITANKGP--PVTPLNERMIMVNAVKWVDEVIPNAP  136

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  137  YAITEDFMRKLFDEYKIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  193

Query  388  SVGQRII  368
             +  R++
Sbjct  194  DIVGRML  200



>ref|XP_004492610.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cicer 
arietinum]
Length=418

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR  GDFLLVGI+ D TVS  RG   P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  266  GHVEILRLARDRGDFLLVGIHTDQTVSATRGLHRPIMNLHERSLSVLACRYVDEVIIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DMITTFNISLVVHGT +E+    K+  +PYAVP SMGIF+I+ S  DITTT++ +
Sbjct  326  WEVSRDMITTFNISLVVHGTTAENTDFQKEQSNPYAVPISMGIFQILDSSLDITTTTIIR  385

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  386  RIVSNHEAYQKRN  398


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLIVGVVSDAEIIANKGP--PVTPLHERLIMVNAVKWVDEVIPEAP  124

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA  K  G ++ I+  + +++T
Sbjct  125  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYAHAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>emb|CDY18374.1| BnaA04g22130D [Brassica napus]
 emb|CDX93310.1| BnaC04g45860D [Brassica napus]
Length=409

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS   G ++P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  265  GHVEILRRARELGDFLLVGIHNDQTVSARSGARHPIMNLHERSLSVLACRYVDEVIIGAP  324

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E++KD ITTF+ISLVVHGTV+ES+   K+  +PYAVP SMGIF+I++SP DITT+++ +
Sbjct  325  SEVSKDTITTFDISLVVHGTVAESDDFQKEEGNPYAVPISMGIFQILESPLDITTSTIIK  384

Query  376  RIIAN  362
            RI  N
Sbjct  385  RIKRN  389


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  67   GHCNALRQARALGDQLVVGVVSDEEIIANKGP--PVTPLHERMVMVKAVKWVDEVISDAP  124

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D    +   + I  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  125  YAITEDFMKRLFDEYQIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  181

Query  388  SVGQRII  368
             +  R++
Sbjct  182  DIVGRML  188



>gb|EMS51700.1| Ethanolamine-phosphate cytidylyltransferase [Triticum urartu]
Length=428

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 106/143 (74%), Gaps = 13/143 (9%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVS----------GVRGTQYPLMNLHERSLSVLASR  587
            GHVEILRSARQLGDFLLVG++DD ++             RG   P+M+LHER+L VLA R
Sbjct  269  GHVEILRSARQLGDFLLVGVHDDQSIRYHAYENQLCREKRGYP-PIMHLHERTLGVLACR  327

Query  586  YVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP  407
            YVDEVIIGAP E+++DMITTFNISLVVHGTV E  S      DPYA+PKSMGIF+++ SP
Sbjct  328  YVDEVIIGAPLEVSRDMITTFNISLVVHGTVVEGGS--ASEVDPYALPKSMGIFQVVTSP  385

Query  406  KDITTTSVGQRIIANHEIYVKRN  338
            K IT+ SV  RII NHE Y KRN
Sbjct  386  KTITSVSVATRIIDNHEAYKKRN  408


 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  85   GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  142

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  143  YEITEEFMNTLFSKYNIDYIIHG---DDPCLLPDGTDAYALAKKAGRYKQIRRTEGVSST  199

Query  388  SVGQRII  368
             +  RI+
Sbjct  200  DIVGRIL  206



>ref|XP_006381291.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
 gb|ERP59088.1| hypothetical protein POPTR_0006s11470g [Populus trichocarpa]
Length=423

 Score =   172 bits (436),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR LGDFLLVGI++D  VS +   + P+MNLHERSLSVLA RYVDEVIIGAP
Sbjct  272  GHVEILRLARTLGDFLLVGIHNDQIVSLIIAHR-PIMNLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WEI+KDMITTFNIS VVHGTV+E++   K+  +PYAVP SMGIF+++ SP DITTT++ +
Sbjct  331  WEISKDMITTFNISSVVHGTVAENDDFQKEQDNPYAVPISMGIFKVLDSPLDITTTTIIR  390

Query  376  RIIANHEIYVKRN  338
            RI++NHE Y KRN
Sbjct  391  RIVSNHEAYQKRN  403


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D  +   +G   P+  LHER + V A ++VDEVI  AP
Sbjct  73   GHCNALRQARALGDQLVVGVVSDAEIIANKGP--PVTPLHERMIMVNAVKWVDEVISDAP  130

Query  556  WEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT    K +   +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  131  YAITEEFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRTEGVSST  187

Query  388  SVGQRII  368
             +  R++
Sbjct  188  DIVGRML  194



>ref|XP_009151252.1| PREDICTED: uncharacterized protein LOC103874581 [Brassica rapa]
Length=533

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV ILR AR+LGDFLLVGI++D TVS  RG   P+M++ ER LSV A RYVDEVI GAP
Sbjct  348  GHVGILRRARELGDFLLVGIHNDQTVSAKRGGHPPIMSMQERILSVGACRYVDEVIFGAP  407

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++K  IT F ISLVVHGTV+ES++  +   +PYAVP SMGIF+I++SP +ITT+++  
Sbjct  408  WEVSKITITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILESPLNITTSTIMG  467

Query  376  RIIANHEIYVKRN  338
            RI+ANHE Y KRN
Sbjct  468  RIVANHEAYQKRN  480



>ref|XP_011006223.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Populus euphratica]
Length=426

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 99/153 (65%), Positives = 123/153 (80%), Gaps = 1/153 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+  R L DFL V I++D  VS  RG   P+MNLHERSLSVLA +YVDEVIIGAP
Sbjct  275  GHVEILKLPRALRDFL-VEIHNDQIVSSKRGAHRPIMNLHERSLSVLACQYVDEVIIGAP  333

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++KDMITTFNIS VVHGTV+E+N  LK+  +PY VP SMGIF+++ SP DITTT++ +
Sbjct  334  WEVSKDMITTFNISSVVHGTVAENNDFLKEKDNPYVVPISMGIFQVLDSPLDITTTTIIK  393

Query  376  RIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            RI++NHE Y KRN KK ASE++YY +K Y+SG+
Sbjct  394  RIVSNHEAYQKRNQKKAASERRYYEDKAYISGD  426


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 75/138 (54%), Gaps = 10/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+   + +   +G   P+  +H R + V A ++VDEVI  AP
Sbjct  76   GHCHALRQARALGDQLVVGVVSVDEIIANKGP--PVTPVHVRMIMVHAVKWVDEVISDAP  133

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+D +      +NI  ++HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  134  YAITEDFMKKLFDEYNIDYIIHG---DDPCVLPDGTDAYALAKKAGRYKQIKRSEGVSST  190

Query  388  S-VGQRIIANHEIYVKRN  338
              VG+ ++   E  +  N
Sbjct  191  DIVGRMLLCTRERSISDN  208



>gb|AFK45455.1| unknown [Medicago truncatula]
Length=115

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 103/117 (88%), Gaps = 2/117 (2%)
 Frame = -3

Query  628  MNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYA  449
            M+LHERSLSVLASRYVDEVIIGAP EITKDMITTFNISLVVHGTV+E +  L    DPY 
Sbjct  1    MHLHERSLSVLASRYVDEVIIGAPLEITKDMITTFNISLVVHGTVAEKS--LPSEKDPYE  58

Query  448  VPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            VPKS+GIFR+++SPKDITTTSV QRI+ANH+ YVKRNAKK  SEK+YY E+KYVSG+
Sbjct  59   VPKSIGIFRLLESPKDITTTSVAQRIMANHDAYVKRNAKKAKSEKRYYEERKYVSGD  115



>ref|XP_004149674.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=116

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 87/97 (90%), Gaps = 1/97 (1%)
 Frame = -3

Query  628  MNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYA  449
            M+LHERSLSVL  RYVDEVIIGAPWEIT+DMITTFNISLVVHGTV+E+NS   D+ DPYA
Sbjct  1    MHLHERSLSVLGCRYVDEVIIGAPWEITRDMITTFNISLVVHGTVAENNSFAGDS-DPYA  59

Query  448  VPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  338
            VPKSMGIF++++SPK ITTTS+ +RI+ANH+ + KRN
Sbjct  60   VPKSMGIFKLLESPKTITTTSIAKRIVANHDAFKKRN  96



>emb|CDY48653.1| BnaC07g27560D [Brassica napus]
Length=672

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR AR+LGDFLLVGI++D TVS  RG   P+M++ ERSLSV A RYVDEVI GAP
Sbjct  394  GHVEILRRARELGDFLLVGIHNDQTVSAKRGGHPPIMSMQERSLSVGACRYVDEVIFGAP  453

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE++K+ IT F ISLVVHGTV+ES++  +   +PYAVP SMGIF+I++SP DITT+++  
Sbjct  454  WEVSKNTITFFGISLVVHGTVAESDNFQRKEENPYAVPISMGIFQILESPLDITTSTIMG  513

Query  376  RIIAN  362
            RI  N
Sbjct  514  RIKRN  518



>gb|ABX10446.1| ethanolamine-phosphate cytidylyltransferase 2 [Gossypium hirsutum]
Length=413

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFL+VGIY D   S  RG  YP+M+L ER+L  LA RYVDEV     
Sbjct  261  GHVEILKKARQLGDFLVVGIYPDYIGSEQRGMPYPVMHLLERTLCGLACRYVDEVYRALR  320

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
                    T     LVVHGTV+ESNS L    DPYA+PKSMGIFR+++SPK ITT+SV Q
Sbjct  321  RSKAWFTFTFLGGPLVVHGTVAESNSSLPGETDPYAIPKSMGIFRLLESPKSITTSSVAQ  380

Query  376  RIIANHEIYVKRN  338
            RI+ NHE+Y+KRN
Sbjct  381  RIVTNHEVYMKRN  393


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 74/129 (57%), Gaps = 9/129 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VD+VI  AP
Sbjct  70   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PILSMEERLALVSGLKWVDQVIANAP  127

Query  556  WEITKDMITT-FN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT++ + + FN   I  V+HG   +   +L D  D YA+ K  G ++ I+  + +++T
Sbjct  128  YAITEEFMNSLFNEHKIDYVIHG---DDPCLLPDGSDAYALAKIAGRYKQIKRTEGVSST  184

Query  388  SVGQRIIAN  362
             +  RI+++
Sbjct  185  DIVGRILSS  193



>ref|XP_010505513.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Camelina 
sativa]
Length=117

 Score =   149 bits (376),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  628  MNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYA  449
            MNLHERSLSVLA RYVDEVIIGAPWE+++D ITTF+ISLVVHGTV+ES+   K+  +PYA
Sbjct  1    MNLHERSLSVLACRYVDEVIIGAPWEVSRDTITTFDISLVVHGTVAESDDFQKEEDNPYA  60

Query  448  VPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  338
            VP SMGIF I++SP DITT+++ +RI+ANHE Y KRN
Sbjct  61   VPISMGIFEILESPLDITTSTIIRRIVANHEAYQKRN  97



>ref|XP_010113033.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
 gb|EXC35204.1| Ethanolamine-phosphate cytidylyltransferase [Morus notabilis]
Length=383

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/177 (51%), Positives = 111/177 (63%), Gaps = 48/177 (27%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTV----------------------SGV---------  650
            GHVEILR A++LGDFLLVG + D TV                      SG+         
Sbjct  158  GHVEILRVAKELGDFLLVGTHTDQTVRILTYHHASDTDVHGGPLWMAHSGLSRSPLPQRG  217

Query  649  -----------------RGTQYPLMNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFN  521
                             RG   P+MNLHERSLSVLA RYVDEVIIGAPWE+++DMITTFN
Sbjct  218  LEEEHALIPIDITLGAKRGAHRPIMNLHERSLSVLACRYVDEVIIGAPWEVSRDMITTFN  277

Query  520  ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANHEIY  350
            ISLVVHGTV+E+N   K+  +PY VP SMGIF+I++SP DITTT++ +RI++NHE Y
Sbjct  278  ISLVVHGTVAENNDFQKENGNPYDVPISMGIFKILESPLDITTTTIIRRIVSNHEAY  334



>ref|XP_005538734.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82698.1| phosphoethanolamine cytidylyltransferase [Cyanidioschyzon merolae 
strain 10D]
Length=442

 Score =   153 bits (387),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
             H+  L+  R+LGDFLLVGI+DD+ V+  RG  YP++NLHER+L VL+ RYVDEVIIGAP
Sbjct  290  AHIRFLKQCRELGDFLLVGIHDDHAVNQHRGRNYPILNLHERTLMVLSIRYVDEVIIGAP  349

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W++T+DMI T NISLV+HGT  +  ++     DPY VPK +GIFR I S  D++   + +
Sbjct  350  WKVTEDMIKTMNISLVIHGTHYDELNIRDGDDDPYEVPKRLGIFREIPSSSDLSVPKIIE  409

Query  376  RIIANHEIYVKRN  338
            RI+ N E Y++R 
Sbjct  410  RIVRNRERYLERQ  422


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A  LGD L+VG+  D  ++  +G   P+M   ER  +V A ++VD VI G P
Sbjct  74   GHANAIRQAASLGDELIVGVCSDEEITKHKGP--PVMTEEERYETVEAVKWVDHVIRGVP  131

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + +T + + T    + I  VVHG     ++  +D    Y   K  G FR I   + +++T
Sbjct  132  YNVTPEFLETLVRDYEIDYVVHGDDPCLDASGRDV---YEAVKQAGKFRTIARTEGVSST  188

Query  388  SVGQRII  368
             +  R++
Sbjct  189  DIVGRML  195



>ref|XP_005714716.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
 emb|CDF34897.1| Ethanolamine-phosphate cytidylyltransferase, putative [Chondrus 
crispus]
Length=453

 Score =   152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E LR AR+ GDFLLVGI+DD TV+  +G+ +P+MN+HER+L+VL+ R+VDEVIIGAP
Sbjct  300  GHIETLRKAREQGDFLLVGIHDDATVNARKGSNFPIMNVHERTLAVLSCRHVDEVIIGAP  359

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I++DMI T NIS VVHG+    +  + +  DPY VP+ M +   ++S  ++T   V  
Sbjct  360  WCISEDMIKTMNISAVVHGSHRGDSKYVDNFVDPYEVPRQMNLLHKVKSESELTVQVVLD  419

Query  376  RIIANHEIYVKRN  338
            RI+ N E +VKRN
Sbjct  420  RIVQNREAFVKRN  432


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 67/127 (53%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VGI  +  +   +G   P+M   ER ++V + ++VD+V+   P
Sbjct  96   GHANALRQAKALGDVLVVGINPEVEIRKHKGP--PVMTDEERRIAVSSVKWVDKVLTDVP  153

Query  556  W----EITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +    E  K +I    I ++VHG   +   +  D  D Y   K MG FR ++  + +++T
Sbjct  154  YVVTPEFLKTLIEKHKIDIIVHG---DDPCIGADGQDVYRAVKQMGRFRTVKRTEGVSST  210

Query  388  SVGQRII  368
             +  R++
Sbjct  211  DIVGRML  217



>ref|XP_004171635.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Cucumis 
sativus]
Length=117

 Score =   142 bits (358),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = -3

Query  628  MNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYA  449
            MNLHERSLSVLA RYVDEVIIGAPWE++KDMITTFNISLVVHGTV+E N   K  C+PYA
Sbjct  1    MNLHERSLSVLACRYVDEVIIGAPWEVSKDMITTFNISLVVHGTVAEINDFQKRDCNPYA  60

Query  448  VPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRN  338
            VP SMGIF+I+ SP DITTT++ +RI++NHE Y KRN
Sbjct  61   VPISMGIFKILDSPLDITTTTIIRRIVSNHEAYQKRN  97



>gb|EIE92478.1| hypothetical protein RO3G_17000 [Rhizopus delemar RA 99-880]
Length=314

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEV+IGAP
Sbjct  163  GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVVIGAP  222

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T++++   + +S+VVHGT      M  D  DPY +PK +GI++ I +PK  ITT  +
Sbjct  223  YSVTEELLKGEYQVSIVVHGTSHLEKDM--DGKDPYELPKKLGIYKQIDTPKSTITTEDI  280

Query  382  GQRIIANHEIYVKRN  338
              RII N +I+ +R 
Sbjct  281  IYRIIENRKIFEERQ  295



>ref|XP_008355152.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Malus 
domestica]
Length=117

 Score =   142 bits (358),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -3

Query  628  MNLHERSLSVLASRYVDEVIIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYA  449
            MNLHERSLSVLA R+VDEVIIGAPW I+KDM+TTFNISLVVHGTV+E+++  K+  +PY 
Sbjct  1    MNLHERSLSVLACRHVDEVIIGAPWVISKDMLTTFNISLVVHGTVAENSNFEKEEGNPYE  60

Query  448  VPKSMGIFRIIQSPKDITTTSVGQRIIANHEIYVKRNakkeasekkyyaekkYVSGE  278
            VP ++GIF++++SP DITT+++ +RI++NHE Y KRN KK ASEK+YY  K YVSG+
Sbjct  61   VPINLGIFKVLESPLDITTSTIIRRIVSNHEAYQKRNEKKAASEKRYYESKGYVSGD  117



>ref|XP_005845984.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
 gb|EFN53882.1| hypothetical protein CHLNCDRAFT_25204, partial [Chlorella variabilis]
Length=200

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (71%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ A+Q GDFLLVG++ D  V   RG   P+M LHER+LSVL+ RYVDEV+IGAP
Sbjct  48   GHVEILKKAKQAGDFLLVGVHTDEDVCERRGPHLPIMTLHERALSVLSCRYVDEVVIGAP  107

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             EI +D++TTFNISLVV GTV E+ S   +    YAVP+  GIF+ + SP  +T+  + +
Sbjct  108  MEIAEDLLTTFNISLVVTGTVHETCSRDSER-QRYAVPQERGIFQRLDSPDTMTSAKLIE  166

Query  376  RIIANHEIYVKRN  338
            RI+AN  ++  R 
Sbjct  167  RIMANRALFEARQ  179



>emb|CEG84347.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++ GDFL+VG++DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  202  GHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIGAP  261

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++ T +N+++VVHGT S    +  D  DPY +PKS GI++ I SP   +TT  +
Sbjct  262  YSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEISSPNSTLTTQDI  319

Query  382  GQRIIANHEIYVKRN  338
              RII N  IY +R 
Sbjct  320  IDRIIENRMIYEERQ  334


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +M   ER  +V A ++VDEV+  AP
Sbjct  21   GHANALRQAKEMGDILVVGVHSDAEIEKNKGPT--VMKEQERYAAVAACKWVDEVVPNAP  78

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  79   YNTTVEILQKYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  135

Query  376  RII  368
            R++
Sbjct  136  RML  138



>emb|CEG75719.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=354

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  200  GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIGAP  259

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I++PK  ITT  +
Sbjct  260  YSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETPKSTITTEDI  317

Query  382  GQRIIANHEIYVKRN  338
              RII N +I+ +R 
Sbjct  318  IHRIIENRKIFEERQ  332


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++ DEV+  AP
Sbjct  4    GHANALRQAKAMGDILVVGVHSDADIEKNKGPT--VMKEDERYAAVAACKWADEVVPNAP  61

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   NI   VHG   +  + + D  D Y   K  G++R  +    ++TT +  
Sbjct  62   YNTTVEILKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTVGVSTTELVG  118

Query  376  RII  368
            R++
Sbjct  119  RML  121



>emb|CEG66905.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=364

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 99/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++ GDFL+VG++DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  202  GHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIGAP  261

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++ T +N+++VVHGT S    +  D  DPY +PKS GI++ I SP   +TT  +
Sbjct  262  YSVTEDVLNTEYNVTVVVHGTTSSEPDI--DGKDPYELPKSRGIYKEISSPNSTLTTQDI  319

Query  382  GQRIIANHEIYVKRN  338
              RII N  IY +R 
Sbjct  320  IDRIIENRMIYEERQ  334


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +M   ER  +V A ++VDEV+  AP
Sbjct  21   GHANALRQAKEMGDILVVGVHSDAEIEKNKGPT--VMKEQERYAAVAACKWVDEVVPNAP  78

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  79   YNTTVEILQKYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  135

Query  376  RII  368
            R++
Sbjct  136  RML  138



>emb|CEI95984.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=187

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 4/130 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  60   GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIGAP  119

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I++PK  ITT  +
Sbjct  120  YSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETPKSTITTEDI  177

Query  382  GQRIIANHEI  353
              RII N ++
Sbjct  178  IHRIIENRKM  187



>emb|CEG75718.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=372

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  218  GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIGAP  277

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I++PK  ITT  +
Sbjct  278  YSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETPKSTITTEDI  335

Query  382  GQRIIANHEIYVKRN  338
              RII N +I+ +R 
Sbjct  336  IHRIIENRKIFEERQ  350


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++ DEV+  AP
Sbjct  22   GHANALRQAKAMGDILVVGVHSDADIEKNKGPT--VMKEDERYAAVAACKWADEVVPNAP  79

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   NI   VHG   +  + + D  D Y   K  G++R  +    ++TT +  
Sbjct  80   YNTTVEILKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTVGVSTTELVG  136

Query  376  RII  368
            R++
Sbjct  137  RML  139



>ref|XP_005647873.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23329.1| CTP-phosphoethanolamine cytidylyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=461

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 95/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ AR  GDFLLVG++ D+ +   RG   P+M+LHER+LSVLA  YV+EVIIGAP
Sbjct  309  GHVEILKLARAQGDFLLVGLHTDDDIMERRGAHLPIMDLHERALSVLACCYVNEVIIGAP  368

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             E+T+D++TTFNISLVV GTVSE+ +        Y VPK   I R ++SP+DITT ++  
Sbjct  369  LEVTEDLLTTFNISLVVRGTVSETGAADNADHPRYMVPKQRDIMRTLRSPRDITTATIIH  428

Query  376  RIIANHEIYVKRN  338
            RI++N   Y  RN
Sbjct  429  RIVSNRAAYEARN  441


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR LGD L+VG+  D+ +   +G   P+MN  ER   V + ++VDEVI  AP
Sbjct  98   GHANALRQARMLGDQLVVGLISDDEIRAAKGP--PVMNYAERKSLVGSVKWVDEVIDDAP  155

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + +++D    + T   I  VVHG   +   +L D  D YA  K  G F++I+  + +++T
Sbjct  156  YLLSEDFLHELFTKHKIDYVVHG---DDPCLLPDGTDAYAYAKQQGRFKMIKRTEGVSST  212

Query  388  SVGQRII  368
             +  R++
Sbjct  213  DIVGRML  219



>gb|KDO54356.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=366

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D  VS  RG+ +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSML  473
            WE+TKDMITTFNI LVVHGTVSE+N+ L
Sbjct  331  WEVTKDMITTFNICLVVHGTVSETNTPL  358


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIANAP  137

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  138  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  194

Query  388  SVGQRIIANHE  356
             +  RI+++ E
Sbjct  195  DIVGRILSSME  205



>gb|KDO54357.1| hypothetical protein CISIN_1g0144871mg [Citrus sinensis]
Length=379

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL+ ARQLGDFLLVGIY D  VS  RG+ +P+M+LHERSLSVLA RYVDEVIIGAP
Sbjct  271  GHVEILKKARQLGDFLLVGIYTDQIVSEHRGSYHPIMHLHERSLSVLACRYVDEVIIGAP  330

Query  556  WEITKDMITTFNISLVVHGTVSESNSML  473
            WE+TKDMITTFNI LVVHGTVSE+N+ L
Sbjct  331  WEVTKDMITTFNICLVVHGTVSETNTPL  358


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 74/131 (56%), Gaps = 9/131 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  80   GHANALRQAKALGDELVVGVVSDEEIIANKGP--PVLSMEERLALVSGLKWVDEVIANAP  137

Query  556  WEITKDMIT-TFN---ISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + IT+  +   FN   I  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  138  YAITEQFMNRLFNEHKIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  194

Query  388  SVGQRIIANHE  356
             +  RI+++ E
Sbjct  195  DIVGRILSSME  205



>emb|CEP18288.1| hypothetical protein [Parasitella parasitica]
Length=372

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 98/134 (73%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++LGDFL+VG++DD  V+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  217  GHIEFLKRAKELGDFLIVGVHDDQIVNAIKGANYPLMNLHERALSVLACRYVDEVIIGAP  276

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++T  +N+S+VVHG  S    +  D  DPY +PK   I+  +++P + ITT  +
Sbjct  277  YSVTEDVLTKEYNVSMVVHGNTSTEPDL--DGSDPYTLPKKRNIYVEVENPNNTITTQGI  334

Query  382  GQRIIANHEIYVKR  341
             +RII N  I+ +R
Sbjct  335  IERIIENRNIFEER  348


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +M   ER  +V A ++ DEV+  AP
Sbjct  24   GHANALRQAKEMGDILVVGVHSDAEIEKNKGPT--VMKEEERYAAVAACKWADEVVPNAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  82   YNTTVECLKEYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



>emb|CEI99016.1| Putative Ethanolamine-phosphate cytidylyltransferase [Rhizopus 
microsporus]
Length=345

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 95/130 (73%), Gaps = 4/130 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  218  GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGANYPLMNLHERALSVLACRYVDEVIIGAP  277

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T +++   + +SLVVHGT      +  D  DPY +PK +GI++ I++PK  ITT  +
Sbjct  278  YSVTDEILKGEYKVSLVVHGTTHLEKDV--DGRDPYELPKKLGIYKQIETPKSTITTEDI  335

Query  382  GQRIIANHEI  353
              RII N ++
Sbjct  336  IHRIIENRKM  345


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (52%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++ DEV+  AP
Sbjct  22   GHANALRQAKAMGDILVVGVHSDADIEKNKGPT--VMKEDERYAAVAACKWADEVVPNAP  79

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  T +++   NI   VHG   +  + + D  D Y   K  G++R  +    ++TT  VG
Sbjct  80   YNTTVEILKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTVGVSTTELVG  136

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  137  RMLLMTRDHHKRR  149



>gb|EPB91886.1| ethanolamine-phosphate cytidylyltransferase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=373

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 97/134 (72%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++LGDFL+VG++DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  217  GHIEFLKRAKELGDFLIVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIGAP  276

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   +N+++VVHG       +  D  DPY +PK   I+  I++P + ITT  +
Sbjct  277  YSVTEDVLNKEYNVNMVVHGNTPTEPDL--DGSDPYELPKKRNIYVEIENPNNTITTQGI  334

Query  382  GQRIIANHEIYVKR  341
             +RII N  I+ +R
Sbjct  335  IERIIENRNIFEER  348


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +M   ER  +V A ++ DEV+  AP
Sbjct  24   GHANALRQAKEMGDILVVGVHSDAEIEKNKGPT--VMKEQERYAAVAACKWADEVVPDAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  82   YNTTVEILKEYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



>ref|XP_002950808.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
 gb|EFJ48123.1| hypothetical protein VOLCADRAFT_109104 [Volvox carteri f. nagariensis]
Length=402

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV+IL++A+  GDFLLVG++ D  V   RG   P+MNLHERSLSVLA +YVDEVIIG+P
Sbjct  249  GHVKILKAAKAEGDFLLVGLHTDEEVQARRGPHLPIMNLHERSLSVLACKYVDEVIIGSP  308

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
              +T D+I TFNISLVV G+VSE++ +     + Y+VP++ GIFR ++SP ++T  ++  
Sbjct  309  CVMTDDLIKTFNISLVVRGSVSETSMLGPVKQERYSVPRAAGIFRELRSPSEVTARNIIH  368

Query  376  RIIANHEIYVKRN  338
            RI+     + +RN
Sbjct  369  RIVDKRAAFEERN  381


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 71/127 (56%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG+ +D  +   +G   P+MN  ER   V A ++VDE++ G P
Sbjct  45   GHANALRQAKAVGDELVVGLINDAEILRCKGP--PVMNEEERYTLVEAVKWVDEILRGVP  102

Query  556  WEITKDMI----TTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +++  + I    T   I  ++HG   +   +L D  D YA  K +G F++++  + ++TT
Sbjct  103  YDLNPEFIHELFTKHRIDYIIHG---DDPCLLPDGSDAYAHAKKLGRFKMVKRTEGVSTT  159

Query  388  SVGQRII  368
             +  R++
Sbjct  160  DIVGRML  166



>gb|EIE76135.1| hypothetical protein RO3G_00839 [Rhizopus delemar RA 99-880]
Length=365

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++ GDFL+VG++DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  202  GHIEFLKRAKEQGDFLVVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIGAP  261

Query  556  WEITKDMI-TTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   + +S+V+HGT S    +  D  DPY +PKS GI++ I SP   +TT  +
Sbjct  262  YSVTEDILDKEYYVSVVIHGTTSSELDI--DGADPYELPKSRGIYKEISSPNSTLTTQGI  319

Query  382  GQRIIANHEIYVKRN  338
              RII N  ++ +R 
Sbjct  320  IDRIIENRFMFEERQ  334


 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 72/134 (54%), Gaps = 8/134 (6%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +M   ER  +V A ++VDEV+  AP
Sbjct  21   GHANALRQAKEMGDILVVGVHSDVEIEKNKGPT--VMKEEERYAAVAACKWVDEVVPNAP  78

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  79   YNTTVEILQEYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  135

Query  376  RII---ANHEIYVK  344
            R++    NH   VK
Sbjct  136  RMLLMTRNHHRDVK  149



>dbj|GAN05681.1| phosphoethanolamine-cytidyltransferase [Mucor ambiguus]
Length=373

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 96/134 (72%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++LGDFL+VG++DD TV+ ++G  YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  217  GHIEFLKRAKELGDFLIVGVHDDQTVNAIKGINYPLMNLHERALSVLACRYVDEVIIGAP  276

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   +N+ +VVHG       +  D  DPY +PK   I+  I++P + ITT  +
Sbjct  277  YSVTEDVLNKEYNVHIVVHGNTPTEPDL--DGSDPYELPKKRNIYVEIENPNNTITTQGI  334

Query  382  GQRIIANHEIYVKR  341
             +RII N  I+ +R
Sbjct  335  IERIIENRNIFEER  348


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG++ D  +   +G    +    ER  +V A ++VDEV+  AP
Sbjct  24   GHANALRQAKEMGDILVVGVHSDADIERNKGPT--VCREQERYAAVAACKWVDEVVPNAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  82   YNTTVEILKEYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTQGVSTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



>dbj|GAN03222.1| phosphoethanolamine-cytidyltransferase [Mucor ambiguus]
Length=375

 Score =   141 bits (356),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VGI+DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  218  GHIEFLKRAKALGDFLIVGIHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  277

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPK-DITTTSV  383
            + +T++++   + ++LV HG       M  D  DPY +P+ +GI++ I +P   ITT  +
Sbjct  278  YSVTEEILNGEYKVALVAHGNSHLEKDM--DGRDPYELPRKLGIYKEIDTPNATITTEGI  335

Query  382  GQRIIANHEIYVKRN  338
              RII N +I+ +R 
Sbjct  336  INRIIENRKIFEERQ  350


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD L+VG+++D  +   +G   P+M   ER  +V A ++ DEV+  AP
Sbjct  23   GHANALRQAKEMGDILVVGVHNDADIETNKGV--PVMKEEERYAAVAACKWADEVVPNAP  80

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   NI   VHG   +  + + D  D Y   K  G+++  +  + ++TT +  
Sbjct  81   YNTTVEILKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYKECKRTEGVSTTELVG  137

Query  376  RII  368
            R++
Sbjct  138  RML  140



>emb|CEP15035.1| hypothetical protein [Parasitella parasitica]
Length=373

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+  ++LGDFL+VG++DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  218  GHIEFLKRTKKLGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  277

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPK-DITTTSV  383
            + +TK+++   + ++LV HG+      M  D  DPYA+PK +GI   I +P   ITT  +
Sbjct  278  YSVTKEILNGEYKVALVAHGSSHLEKDM--DGKDPYALPKELGICVEINTPNATITTEGI  335

Query  382  GQRIIANHEIYVKRN  338
              RII N +I+ +R 
Sbjct  336  IDRIIENRKIFEERQ  350


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 70/133 (53%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++VD+V+  AP
Sbjct  23   GHANALRQAKAMGDILVVGVHSDADIEKNKGPT--VMKEEERYAAVAACKWVDQVVRNAP  80

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  T + +   NI   VHG   +  + + D  D Y   K  G++R  +  + ++TT  VG
Sbjct  81   YNTTVECLKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTEGVSTTELVG  137

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  138  RMLLMTRDHHKRR  150



>ref|XP_001008378.1| cytidyltransferase-related domain containing protein [Tetrahymena 
thermophila]
 gb|EAR88133.1| choline-phosphate cytidylyltransferase [Tetrahymena thermophila 
SB210]
Length=454

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 97/139 (70%), Gaps = 6/139 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A++LGD+L+VG++DD TV   +G+ YP++ L ER L+VLA +YVDEVIIGAP
Sbjct  300  GHIETLKKAKELGDYLIVGLHDDETVQEKKGSNYPVLTLQERVLNVLAMKYVDEVIIGAP  359

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTC--DPYAVPKSMGIFRIIQSPKDITTTSV  383
            W+ T+ +I  FNIS+VV GT+++      +    DPY VPK +GIF+ I+S  D+TT  +
Sbjct  360  WQPTEQLIKQFNISIVVEGTMTKLKENKPEVIEQDPYLVPKKLGIFKQIESSNDMTTDKI  419

Query  382  GQRIIANH----EIYVKRN  338
             +RII N     EIY  +N
Sbjct  420  VERIIENRLRFLEIYNVKN  438


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 61/125 (49%), Gaps = 9/125 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+Q  + L+VG+     ++  +G   P+++  ER     A ++ DE+   AP
Sbjct  97   GHFNAIRQAKQYCETLVVGVIAQEEITKRKGP--PVLSYEERVGIAKACKWADEICEHAP  154

Query  556  WEITKDMITTFNISLVVHGTVSESNSML--KDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            ++ T ++I   N S V HG     + M+   D CD Y+  K        +  + I+TT +
Sbjct  155  YDPTIELIDRLNCSHVAHG-----DDMIVGPDGCDAYSPFKISNRMITFKRTEGISTTDI  209

Query  382  GQRII  368
              R++
Sbjct  210  VGRLL  214



>gb|EPB89151.1| ethanolamine-phosphate cytidylyltransferase [Mucor circinelloides 
f. circinelloides 1006PhL]
Length=363

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/137 (50%), Positives = 99/137 (72%), Gaps = 10/137 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  206  GHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  265

Query  556  WEITKDMIT-TFNISLVVHGTVSESNSMLKDTCD---PYAVPKSMGIFRIIQSPK-DITT  392
            + +T++++   + ++LV HG     NS+L+   D   PY +PK +GI++ I +P   ITT
Sbjct  266  YSVTEEILNGEYKVALVAHG-----NSVLEKDMDGRNPYDLPKKLGIYKEIDTPNATITT  320

Query  391  TSVGQRIIANHEIYVKR  341
              +  RII N +I+ +R
Sbjct  321  EGIINRIIENRKIFEER  337


 Score = 67.8 bits (164),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/138 (28%), Positives = 72/138 (52%), Gaps = 9/138 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLH-----ERSLSVLASRYVDEV  572
            GH   LR A+ +GD L+VG++ D  +   +G  +   +++     +R  +V A ++VDEV
Sbjct  4    GHANALRQAKSMGDILVVGVHSDADIEKNKGPTHLKHSIYADDVDDRYAAVAACKWVDEV  63

Query  571  IIGAPWEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITT  392
            +  AP+  T + +   NI   VHG   +  + + D  D Y   K  G++R  +  + ++T
Sbjct  64   VPNAPYNTTVECLKEHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTEGVST  120

Query  391  TS-VGQRIIANHEIYVKR  341
            T  VG+ ++   + + +R
Sbjct  121  TELVGRMLLMTRDHHKRR  138



>gb|EMT25098.1| Ethanolamine-phosphate cytidylyltransferase [Aegilops tauschii]
Length=349

 Score =   139 bits (349),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 102/147 (69%), Gaps = 19/147 (13%)
 Frame = -3

Query  661  VSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAPWEITKDM------------------  536
            +S  RG   P+MNLHERSLSVLA RYVDEVIIGAPW I+KDM                  
Sbjct  203  LSSTRGPHRPIMNLHERSLSVLACRYVDEVIIGAPWHISKDMDRLVITCCNFSCQPGYVC  262

Query  535  -ITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRIIANH  359
             ITTFNISLVVHGT++E+    +D  +PYA P +MGI+  + SP DITT+++ +RI++NH
Sbjct  263  VITTFNISLVVHGTIAENMDYTEDDSNPYAAPIAMGIYHKLDSPLDITTSTIIRRIVSNH  322

Query  358  EIYVKRNakkeasekkyyaekkYVSGE  278
            E Y KRN KKEASEKKYY  K +V+GE
Sbjct  323  EAYQKRNEKKEASEKKYYDSKSFVNGE  349



>gb|AAK13093.1|AC078839_9 Putative phospholipid cytidylyltransferase [Oryza sativa Japonica 
Group]
Length=742

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 87/129 (67%), Gaps = 23/129 (18%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILRSARQLGDFLLVG++DD  +   RG + P+M+LHER+LSVLA RYVDEVIIGAP
Sbjct  633  GHVEILRSARQLGDFLLVGVHDDQAIRDRRGYR-PIMHLHERTLSVLACRYVDEVIIGAP  691

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            WE+++DM+                        D YAVPKSMGIF+ I S K ITT SV  
Sbjct  692  WEVSRDMVGI----------------------DSYAVPKSMGIFQTITSTKPITTVSVAT  729

Query  376  RIIANHEIY  350
            RII NHE Y
Sbjct  730  RIIDNHEAY  738


 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 71/122 (58%), Gaps = 9/122 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD L+VG+  D  +   +G   P++++ ER   V   ++VDEVI  AP
Sbjct  427  GHANALRQAKLLGDQLVVGVVSDEEIVANKGP--PVLSMEERLTLVSGLKWVDEVIPNAP  484

Query  556  WEITKDMITT----FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +EIT++ + T    +NI  ++HG   +   +L D  D YA+ K +G ++ I+  + +++T
Sbjct  485  YEITEEFMNTLFNKYNIDYIIHG---DDPCLLPDGTDAYALAKKVGRYKQIKRTEGVSST  541

Query  388  SV  383
             +
Sbjct  542  DI  543



>ref|XP_004353870.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
 gb|EGG14461.1| phosphoethanolamine-cytidyltransferase [Dictyostelium fasciculatum]
Length=363

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 93/133 (70%), Gaps = 4/133 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH E LR A++LGDFL+VG++DD  V+  +G+ +P+MNLHER LSVL+ RYVDEVIIGAP
Sbjct  220  GHTEALRQAKELGDFLIVGVHDDKVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVIIGAP  279

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +TK+MI +  I+ VVHG     + ++    DPY +PK +GI++ I+  + +T T + +
Sbjct  280  FNVTKEMIESLRINTVVHG----DDPVVSVDADPYKLPKGLGIYKEIKHTEGLTATEIVR  335

Query  376  RIIANHEIYVKRN  338
            RII N   +  RN
Sbjct  336  RIIENRMQFEARN  348


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR+LGD L+VG++ D  ++  +G   P+MN  ER  +V A ++ DEV  GAP
Sbjct  30   GHANALRQARELGDILVVGVHTDAEIAKNKGP--PVMNEQERYKAVRACKWADEVAEGAP  87

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   E  S+  D  D Y   K  G FR I+  + I+TT +  
Sbjct  88   YTATVELLDQLNCDFCVHG---EDISVGADGKDVYETIKKSGKFRFIKRTEGISTTELVG  144

Query  376  RII  368
            R++
Sbjct  145  RML  147



>ref|XP_004368196.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
 gb|ELR25441.1| CTP:ethanolaminephosphate cytidylyltransferase [Acanthamoeba 
castellanii str. Neff]
Length=366

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 91/133 (68%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVE L+ AR + D+L+VG++ D  ++  RG+ YP+MNL+ER+L VL+ RYVDEVIIGAP
Sbjct  212  GHVEALKQARAMCDYLMVGVHSDQDINRSRGSNYPIMNLNERALCVLSCRYVDEVIIGAP  271

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            W I++D +T   ISLV+HG   +    L    DPYA  K +GIF+ I+  + ++TTS+  
Sbjct  272  WGISEDDLTNLRISLVLHGDERDQYYPLPSADDPYAAAKKLGIFQEIKYSQGLSTTSIVD  331

Query  376  RIIANHEIYVKRN  338
            RII +   Y KRN
Sbjct  332  RIIHHRLTYEKRN  344


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+Q+GD L+VGI+ D  +  +R    P+MN  ER   V A ++VDEV + AP
Sbjct  32   GHANALRQAKQMGDVLVVGIHPDEEI--IRNKGPPVMNQDERLAVVKACKWVDEVTLDAP  89

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            ++ T   +  FNI   VHG   E  S+  D  D Y   K  G F++I+    ++TT +  
Sbjct  90   YQTTLATLDKFNIDFAVHG---EDISVNSDGTDSYEEVKKAGRFKLIKRTTGVSTTDLVG  146

Query  376  RII  368
            R++
Sbjct  147  RML  149



>ref|XP_002672471.1| predicted protein [Naegleria gruberi]
 gb|EFC39727.1| predicted protein [Naegleria gruberi]
Length=371

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 99/134 (74%), Gaps = 5/134 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L++A++LGD+L+VG+++D  +S  +G  +P+MN+HER LSVL+ RYVD+VIIGAP
Sbjct  226  GHIEFLKAAKKLGDYLIVGLHEDKVISQFKGPHHPIMNIHERLLSVLSCRYVDDVIIGAP  285

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP-KDITTTSVG  380
            + +T+D++    I++VV GTV E    +    DPY +PK +GI+  I+SP K++TTT++ 
Sbjct  286  FIVTQDLVDVMKINIVVSGTVLEPEVKV----DPYELPKKLGIYHQIESPCKELTTTNII  341

Query  379  QRIIANHEIYVKRN  338
             RII N + Y +RN
Sbjct  342  NRIIDNAKRYEERN  355



>ref|XP_003283291.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
 gb|EGC40222.1| phosphoethanolamine-cytidyltransferase [Dictyostelium purpureum]
Length=361

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 95/135 (70%), Gaps = 5/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH E L+ A+ LGDFL+VG++DD TV+  +G+ +P+MNLHER LSVL+ RYVDEV+IGAP
Sbjct  215  GHTEALKQAKALGDFLIVGVHDDKTVNQQKGSNFPIMNLHERVLSVLSCRYVDEVVIGAP  274

Query  556  WEITKDMITTFNISLVVHGTVSESNSML--KDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +TK+MI + +I++VVHG   +   +L   +  DPY +PK MGI++ I   + +T + +
Sbjct  275  FSVTKEMIESLHINVVVHG---DDPVILGPDNGADPYKLPKEMGIYKEIAHTEGLTASEI  331

Query  382  GQRIIANHEIYVKRN  338
             QRII N   +  RN
Sbjct  332  VQRIIDNRLQFEARN  346


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR+LGD L+VG++ D  ++  +G   P+M   ER  +V A ++ DEV  GAP
Sbjct  24   GHANALRQARELGDILVVGVHTDEEITKNKGP--PVMKEQERYKAVRACKWADEVAEGAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +T++ + + N    VHG   E  S+  D  D Y   K  G FR I+  + ++TT +  
Sbjct  82   YTLTEEFLDSQNCDFCVHG---EDISVGADGKDVYEGIKKSGKFRFIKRTEGVSTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



>emb|CEF71025.1| Ethanolamine-phosphate cytidylyltransferase [Strongyloides ratti]
Length=411

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 95/133 (71%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+  L  AR+LGD+L+VG+++D+ V+  +GT +P+M+LHER+LSVLA + V EVIIGAP
Sbjct  244  GHLSFLEKARKLGDYLIVGLFEDSVVNAYKGTNHPIMSLHERTLSVLAYKPVSEVIIGAP  303

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + ITKD+I  FN+S+V  G+    ++ L D  D Y +PK MGI+ +I S  D+TT  + +
Sbjct  304  YIITKDLIKNFNVSIVADGSRVPHHNTLDDV-DIYKIPKEMGIYELIDSENDMTTDMIIK  362

Query  376  RIIANHEIYVKRN  338
            R++ N + + KRN
Sbjct  363  RVVENEKAFKKRN  375


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++G +L+VG++ DN +  +R    P+ N +ER   V   ++VDEV+ GAP
Sbjct  52   GHANQLRQAKKMGKYLVVGVHTDNEI--LRNKGPPVFNENERYKMVKGIKWVDEVVEGAP  109

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  +N    VHG      ++  +  D YA  K+ G ++  +    ++TT +  
Sbjct  110  YSTTIETLDKYNCEFCVHGN---DITLTAEGVDTYAEVKNAGRYKECERTAGVSTTDLVG  166

Query  376  RII  368
            R++
Sbjct  167  RML  169



>gb|KFH72676.1| ethanolamine-phosphate cytidylyltransferase [Mortierella verticillata 
NRRL 6337]
Length=376

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+QLGD+LLVGI+DD TV+ ++G+ YP+MNLHER LSVL+ RYVDEV+IGAP
Sbjct  217  GHIEFLKRAKQLGDYLLVGIHDDQTVNAIKGSNYPVMNLHERVLSVLSCRYVDEVVIGAP  276

Query  556  WEITKDMI-TTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+ ++   + +++VVHG     N   KD  DPY + K  GI+  I +P++ +TT S+
Sbjct  277  YSVTEQVLEKVYKVNVVVHGNTPSLND--KDGQDPYQLAKDRGIYVEIDNPQNSVTTESI  334

Query  382  GQRIIANHEIYVKRN  338
              RII + ++Y +R 
Sbjct  335  IDRIITHRKVYEERQ  349


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 72/133 (54%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD+L+VG++ D  +   +G    +M   ER  +V A ++VDEV+  AP
Sbjct  25   GHFNALRQAKAMGDYLVVGVHSDAEIEHHKGP--TVMKEDERYAAVAACKWVDEVVPNAP  82

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  + + +  +N    VHG   +  + L D  D Y V K  G +R  +  +DI+TT  VG
Sbjct  83   YLTSIEWMDKYNCDFCVHG---DDITTLADGTDCYQVVKDAGRYRECKRTQDISTTELVG  139

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  140  RMLLMTRDHHKRR  152



>ref|XP_001692963.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
 gb|AAO60076.1| CTP:ethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|AAP21826.1| CTP-phosphoethanolamine cytidylyltransferase [Chlamydomonas reinhardtii]
 gb|EDP03532.1| CDP-Ethanolamine synthase [Chlamydomonas reinhardtii]
Length=443

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV+IL++A+  GDFLLVG++ D  V   RG   P+MNLHERSLSVL+ +YVDEV+IG+P
Sbjct  290  GHVKILQAAKAQGDFLLVGLHTDEDVQARRGPHLPIMNLHERSLSVLSCKYVDEVVIGSP  349

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
              IT+D++TTFNIS+VV G++SE++ +     + Y VP+ MG+F  + SP D++  ++  
Sbjct  350  CVITEDLMTTFNISVVVRGSMSETSMLGPVEEERYEVPRRMGLFTELPSPSDVSARNIIH  409

Query  376  RIIANHEIYVKRN  338
            RI+     +  RN
Sbjct  410  RIVDKRAAFEARN  422


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 70/127 (55%), Gaps = 9/127 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG+ +D  +   +G   P+MN  ER   V A ++VDE++ G P
Sbjct  86   GHANALRQAKAVGDELVVGLINDAEIMRCKGP--PVMNEEERHTLVEAVKWVDEILTGVP  143

Query  556  W----EITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +    E   ++ T   I  ++HG   +   +L D  D YA  K +G F++++  + ++TT
Sbjct  144  YDLNPEFVNELFTKHRIDYIIHG---DDPCLLPDGSDAYAHAKKLGRFKMVKRTEGVSTT  200

Query  388  SVGQRII  368
             +  R++
Sbjct  201  DIVGRML  207



>emb|CDS08410.1| hypothetical protein LRAMOSA09772 [Absidia idahoensis var. thermophila]
Length=269

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  113  GHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  172

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + IT+ ++T  + + +V HG       +  D  DPY + K  GI+  I++P   +TT  +
Sbjct  173  YSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENPNSTLTTQGI  230

Query  382  GQRIIANHEIYVKRN  338
             +RII N   Y  R 
Sbjct  231  IERIIENRVKYEARQ  245



>gb|EPZ32625.1| Rossmann-like alpha/beta/alpha sandwich fold domain-containing 
protein [Rozella allomycis CSF55]
Length=350

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 100/135 (74%), Gaps = 5/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E+L+ A++LGD+LLVGI+DD TV+ ++G+ YP+MN+HER+LSVL+ RYVDEV+IGAP
Sbjct  203  GHIELLKKAKELGDYLLVGIHDDKTVNAIKGSNYPIMNVHERTLSVLSCRYVDEVVIGAP  262

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + + ++M+T  +NI +VVHG  +E  S+  +  DPY  PKS+  F  I++    +TT  V
Sbjct  263  YSVNEEMMTAIYNIDIVVHGK-TEVFSVNGE--DPYKYPKSVSKFIEIETKYSYLTTECV  319

Query  382  GQRIIANHEIYVKRN  338
             +RI  N ++Y +RN
Sbjct  320  IERIFNNRKLYEERN  334


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 69/129 (53%), Gaps = 8/129 (6%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+++GD+L+VG++ D  +   +G    +MN  ER  +V A ++VDEV+  AP
Sbjct  5    GHSNAIRQAKEMGDYLIVGVHSDEEIRKHKGP--TVMNQEERYEAVAACKWVDEVVPNAP  62

Query  556  WEITKDMITTFNISLVVHG------TVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDIT  395
            +  T D++  ++    VHG       V  +N+ L D  D Y   K  G ++  +    ++
Sbjct  63   YFTTVDILDQYDADFCVHGDDISKINVMTNNATLSDGTDCYEEVKKAGRYKECKRTTGVS  122

Query  394  TTSVGQRII  368
            TT +  R++
Sbjct  123  TTELVGRML  131



>ref|XP_004032276.1| hypothetical protein IMG5_125800 [Ichthyophthirius multifiliis]
 gb|EGR30689.1| hypothetical protein IMG5_125800 [Ichthyophthirius multifiliis]
Length=373

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 96/140 (69%), Gaps = 8/140 (6%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L+ A++LGD+L+VG++DD  ++  +G  YP+ +L ER L+VLA +YVDEVIIGAP
Sbjct  229  GHIQTLQKAKELGDYLIVGLHDDEIINEKKGNNYPIYSLQERVLNVLAMKYVDEVIIGAP  288

Query  556  WEITKDMITTFNISLVVHGTVSES----NSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            W I ++MI  FNIS+VV G++++      + +    DPY +PK MGI+RI+ S  ++TT 
Sbjct  289  WNINQNMIKEFNISIVVEGSMTKQKVNDQTQVTREDDPYKIPKQMGIYRIVVSACNLTTE  348

Query  388  SVGQRIIANH----EIYVKR  341
             + +RII       EIY +R
Sbjct  349  KIVERIIDQRLKYLEIYNER  368


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 61/125 (49%), Gaps = 9/125 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+Q  + L+VG+   + ++  +G   P++   ER     A ++ DE+   AP
Sbjct  4    GHFNAIRQAKQYCEVLVVGVIAQDEITKRKGP--PVLQYEERLAIAKACKWADEICENAP  61

Query  556  WEITKDMITTFNISLVVHGTVSESNSML--KDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            ++ T +++   N S V HG     + M+   D  D Y++ K        +  + I+TT +
Sbjct  62   YDPTIELLDRLNCSHVAHG-----DDMIIGPDGSDAYSMFKESNRMITFKRTEGISTTDI  116

Query  382  GQRII  368
              R++
Sbjct  117  VGRLL  121



>gb|KIZ02908.1| ethanolamine-phosphatecytidylyltransferase [Monoraphidium neglectum]
Length=450

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/133 (48%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEIL++A+  GDFLLVG++ D  V+  RG   P+MN+HER+LSVLA RYVDEV+IGAP
Sbjct  290  GHVEILKAAKAQGDFLLVGLHSDEDVAKRRGPHMPIMNVHERALSVLACRYVDEVVIGAP  349

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
             ++  ++++TFNI LVV G+ SE++         Y++PK   +FR + SP   TT ++ +
Sbjct  350  EQVDANLLSTFNIGLVVRGSRSETSQQGPVEPYRYSLPKDRDMFRELPSPSQTTTRNIIE  409

Query  376  RIIANHEIYVKRN  338
            RI+AN   +  RN
Sbjct  410  RIVANRAAFEARN  422


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/154 (27%), Positives = 71/154 (46%), Gaps = 34/154 (22%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGV---------------RGTQY-----------  635
            GH   LR A+ LGD L+VG+  D  +  V               R + +           
Sbjct  11   GHANALRQAKALGDVLVVGLIPDAEILKVTPRLGAARRSRSFVGRDSAFDQGRPSRAVKG  70

Query  634  -PLMNLHERSLSVLASRYVDEVIIGAPWEITKDMITTF----NISLVVHGTVSESNSMLK  470
             P+ N  ER   V A ++VDE+I G P++++ + I        I  ++HG   +   ++ 
Sbjct  71   PPVQNDKERYTMVEAVKWVDEIITGVPYDLSPEFIEELFKKHRIDYIIHG---DDPCLMP  127

Query  469  DTCDPYAVPKSMGIFRIIQSPKDITTTSVGQRII  368
            D  D YA  K +G F++I+  + ++TT +  R++
Sbjct  128  DGTDAYAHAKKLGRFKVIKRTEGVSTTDIVGRML  161



>dbj|GAM28819.1| hypothetical protein SAMD00019534_119950, partial [Acytostelium 
subglobosum LB1]
Length=361

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH E LR A++ GDFL+VG++DD  V+  +G+ +P+MNLHER LSVL+ RYVDEVIIGAP
Sbjct  218  GHCEALRQAKEQGDFLIVGVHDDLVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVIIGAP  277

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + ++K+ I    I++V HG   +   +  D  DPY +PK MGI++ ++  + +TT+ + +
Sbjct  278  FTVSKETIEALGINVVCHG---DDPVVASDGSDPYKIPKQMGIYKEVKHTEGLTTSDIIR  334

Query  376  RIIANHEIYVKRN  338
            RII N   +  RN
Sbjct  335  RIIENRNQFEARN  347


 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A++LGD L+VG++ D  ++  +G   P+MN  ER  +V A ++ DEV  GAP
Sbjct  30   GHANALRQAKELGDILVVGVHTDAEIARNKGP--PVMNEQERYKAVRACKWADEVAEGAP  87

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   E  S+  D  D Y   K+ G+FR I+  + ++TT +  
Sbjct  88   YTATVELLKELNCDFCVHG---EDISVGADGKDVYETIKNSGMFRFIKRTEGVSTTELVG  144

Query  376  RII  368
            R++
Sbjct  145  RML  147



>ref|XP_646687.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
 sp|Q55BZ4.1|PCY2_DICDI RecName: Full=Ethanolamine-phosphate cytidylyltransferase; AltName: 
Full=CTP:phosphoethanolamine cytidylyltransferase; AltName: 
Full=Phosphorylethanolamine transferase [Dictyostelium 
discoideum]
 gb|EAL72499.1| hypothetical protein DDB_G0270298 [Dictyostelium discoideum AX4]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 94/135 (70%), Gaps = 5/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH E L+ AR LGD+L+VG++DD  V   +G+ +P+MNLHER LSVL+ RYVDEV+IGAP
Sbjct  214  GHTEALKQARALGDYLIVGVHDDRVVHEQKGSNFPIMNLHERVLSVLSCRYVDEVVIGAP  273

Query  556  WEITKDMITTFNISLVVHGTVSESNSML--KDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +TKDMI + +I++VVHG   +   +L  +   DPY +P+ +GI++ ++  + +T T +
Sbjct  274  FSVTKDMIDSLHINVVVHG---DDQVVLGPEGGVDPYKLPRELGIYKEVKHTEGLTATEI  330

Query  382  GQRIIANHEIYVKRN  338
             +RII N   Y  RN
Sbjct  331  VKRIIDNRLQYEARN  345


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR AR+LGD L+VG++ D  ++  +G   P+MN  ER  +V A ++ DEV  GAP
Sbjct  24   GHANALRQARELGDILVVGVHTDEEIAKNKGP--PVMNEQERYKAVRACKWADEVAEGAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +T++ + + N    VHG   E  S+  D  D Y   K  G FR I+  + ++TT +  
Sbjct  82   YTLTEEYLDSLNCDFCVHG---EDISVGADGKDVYEGIKKSGKFRFIKRTEGVSTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



>ref|XP_002060439.1| GJ14912 [Drosophila virilis]
 gb|EDW71479.1| GJ14912, partial [Drosophila virilis]
Length=167

 Score =   127 bits (318),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A +LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA ++V+EV+IGAP
Sbjct  13   GHLDFLEKASKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAP  72

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T++++  F I +V HG    S   L+D   DPYAVPK+  IF ++ S  D+TT  + 
Sbjct  73   YCVTEELLDHFKIDVVCHGRTPIS---LEDGKIDPYAVPKTRAIFELLDSGNDMTTERIV  129

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  130  ERIISHRLEYERRN  143



>emb|CDS08409.1| hypothetical protein LRAMOSA09772 [Absidia idahoensis var. thermophila]
Length=377

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  221  GHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  280

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + IT+ ++T  + + +V HG       +  D  DPY + K  GI+  I++P   +TT  +
Sbjct  281  YSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENPNSTLTTQGI  338

Query  382  GQRIIANHEIYVKRN  338
             +RII N   Y  R 
Sbjct  339  IERIIENRVKYEARQ  353


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++VD+V+  AP
Sbjct  27   GHANALRQAKAMGDVLVVGVHSDAEILKNKGP--TVMKEQERYDAVAACKWVDQVVPNAP  84

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  ++I   VHG   +  + + D  D Y   K  G++R  +  + ++TT +  
Sbjct  85   YNTTVEILKEYDIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTQGVSTTELVG  141

Query  376  RII  368
            R++
Sbjct  142  RML  144



>ref|XP_011398757.1| Ethanolamine-phosphate cytidylyltransferase [Auxenochlorella 
protothecoides]
 gb|KFM25861.1| Ethanolamine-phosphate cytidylyltransferase [Auxenochlorella 
protothecoides]
Length=485

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (67%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHV+IL++AR  GDFLLVGI+ D  V+  RG   P+MNLHER+LSVLA +Y DEVIIGAP
Sbjct  333  GHVDILKAARSKGDFLLVGIHTDEDVAERRGPHQPIMNLHERALSVLACKYADEVIIGAP  392

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
              +T+D++TTF I  VV G+V ES     +    Y VP + G FR + SP  +T+ +V +
Sbjct  393  QTVTEDLLTTFGIGEVVRGSVHESGDASSER-GRYEVPIAHGTFRRLASPSPVTSATVIR  451

Query  376  RIIANHEIYVKRN  338
            RI+ N   Y  RN
Sbjct  452  RIVDNRAQYEARN  464


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 70/139 (50%), Gaps = 21/139 (15%)
 Frame = -3

Query  736  GHVEILRSA------------RQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLA  593
            GH   LR A            R LGD L++G+  D+ +   +G   P++N  ER   V +
Sbjct  101  GHANALRQAKACLWANPVDFGRSLGDQLVLGLIPDSEIRRCKGP--PILNEEERRKLVES  158

Query  592  SRYVDEVIIGAPWEIT----KDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIF  425
             ++VDEVI   P+++T     ++IT   I  V+HG   +   +L D  D Y   K +G F
Sbjct  159  VKWVDEVITDVPYDLTPAFLDELITKHKIDYVIHG---DDPCLLPDGTDAYEHAKKLGRF  215

Query  424  RIIQSPKDITTTSVGQRII  368
             +I+  + ++TT +  R++
Sbjct  216  LMIKRTEGVSTTDIVGRML  234



>emb|CDH52899.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=395

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 91/135 (67%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G+ YPLMNLHER+LSVLA RYVDEVIIGAP
Sbjct  239  GHIEFLKRAKALGDFLIVGVHDDQTVNAIKGSNYPLMNLHERALSVLACRYVDEVIIGAP  298

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + IT+ ++T  + + +V HG       +  D  DPY + K  GI+  I++P   +TT  +
Sbjct  299  YSITEAVLTKEYKVHIVAHGNTPTEPDL--DGKDPYQLAKDRGIYTEIENPNSTLTTQGI  356

Query  382  GQRIIANHEIYVKRN  338
             +RII N   Y  R 
Sbjct  357  IERIIENRVKYEARQ  371


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD L+VG++ D  +   +G    +M   ER  +V A ++VD+V+  AP
Sbjct  45   GHANALRQAKAMGDILVVGVHSDAEILKNKGPT--VMKEQERYDAVAACKWVDQVVPDAP  102

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +NI   VHG   +  + + D  D Y   K  G++R  +  + ++TT +  
Sbjct  103  YNTTVEILKEYNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTQGVSTTELVG  159

Query  376  RII  368
            R++
Sbjct  160  RML  162



>gb|EFA80421.1| phosphoethanolamine-cytidyltransferase [Polysphondylium pallidum 
PN500]
Length=371

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 86/116 (74%), Gaps = 3/116 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH E LR A++LGDFL+VG++DD  V+  +G+ +P+MNLHER LSVL+ RYVDEV+IGAP
Sbjct  228  GHTEALRQAKELGDFLIVGVHDDAVVNEQKGSNFPIMNLHERVLSVLSCRYVDEVVIGAP  287

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + +TK+MI   +I+ VVHG   +   + +D  DPY VPK +GI++ I+  + +TTT
Sbjct  288  FNVTKEMIEGLHINTVVHG---DDPVISRDGLDPYKVPKELGIYKEIKHTEGLTTT  340


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R AR+LGD L+VG++ D  ++  +G   P+MN  ER  +V A ++ DEV  GAP
Sbjct  39   GHANAMRQARELGDILVVGVHTDAEIARNKGP--PVMNEQERYKAVRACKWADEVAEGAP  96

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   E  S+  D  D Y   K+ G+FR I+  + ++TT +  
Sbjct  97   YTATVELLKQLNCDFCVHG---EDISVGADGKDVYETIKNSGMFRYIKRTEGVSTTELVG  153

Query  376  RII  368
            R++
Sbjct  154  RML  156



>ref|XP_002155934.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Hydra 
vulgaris]
Length=374

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 94/133 (71%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            G ++ L   ++LGD+++VG++ D+ V+  +G+ YP+MNLHER LSVLA RYV++VIIGAP
Sbjct  217  GLLDFLEKVKELGDYVIVGLHTDSEVNRYKGSNYPIMNLHERVLSVLACRYVNQVIIGAP  276

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +++T+++IT F + +VVHG+    N    D  DPYA PK +GIF+ + S   +TT+ + Q
Sbjct  277  YKVTEELITQFKVDVVVHGSTLIMNDA--DGSDPYAYPKQIGIFQTVDSGNPLTTSDIVQ  334

Query  376  RIIANHEIYVKRN  338
            RIIA+   Y  RN
Sbjct  335  RIIAHKLEYELRN  347


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   +R A+ +GD+L+VG++ D  V   +G   P+ N  ER   V A ++VDEV+  AP
Sbjct  25   GHANQIRQAKSMGDYLIVGVHSDEEVRKHKGP--PVFNEEERYKMVRAIKWVDEVVPDAP  82

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +    + +  +  S  VHG   +  +   D  D Y + K+ G ++  +  + ++TT++  
Sbjct  83   YITALETLDKYGCSFCVHG---DDITCTADGQDTYHIVKAAGRYKECKRTEGVSTTNLVG  139

Query  376  RII  368
            R++
Sbjct  140  RML  142



>ref|XP_002611477.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
 gb|EEN67487.1| hypothetical protein BRAFLDRAFT_113520 [Branchiostoma floridae]
Length=382

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 95/135 (70%), Gaps = 6/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L+ ARQ GD+L+VG++ D  V+G +G+ +P+MN+HER+L VLA R+V EV+IGAP
Sbjct  223  GHLDFLQRARQEGDYLIVGLHTDPVVNGYKGSNHPIMNIHERTLCVLACRHVSEVVIGAP  282

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDT--CDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +T++++  FNI LVVHG      +++ DT   DPY VPK +G ++ I S  D+TTT +
Sbjct  283  YTVTEELMEHFNIDLVVHG----RTNVIPDTEGHDPYKVPKGLGKYKQIDSGNDMTTTKI  338

Query  382  GQRIIANHEIYVKRN  338
             +RII N   +  RN
Sbjct  339  IERIIRNRLHFEARN  353


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 68/123 (55%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD+L+VG++ D  +S  +G   P+M   ER   V A ++VDEV+  AP
Sbjct  31   GHANALRQAKKMGDYLIVGVHSDEEISKHKGP--PVMTEEERYKMVRAVKWVDEVVEAAP  88

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  +N    VHG   +  +M  D  D YA  K+ G ++  +    ++TT +  
Sbjct  89   YVTTIETLDKYNCDYCVHG---DDITMTADGHDTYAEVKNGGRYKECKRTAGVSTTDLVG  145

Query  376  RII  368
            R++
Sbjct  146  RML  148



>gb|AAL25522.1| SD08668p [Drosophila melanogaster]
 gb|ACL88289.1| Pect-PA, partial [synthetic construct]
 gb|ACL92413.1| Pect-PA [synthetic construct]
Length=206

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA ++V+EV+IGAP
Sbjct  52   GHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAP  111

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +T++++  F I +V HG      ++     DPYAVPK+  IF +I S  ++TT  + +
Sbjct  112  YCVTEELLEHFKIDVVCHGRT--PIALENGKIDPYAVPKTRAIFELIDSGNEMTTERIVE  169

Query  376  RIIANHEIYVKRN  338
            RII++   Y +RN
Sbjct  170  RIISHRLEYERRN  182



>ref|XP_002782897.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER14693.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
Length=158

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 90/134 (67%), Gaps = 1/134 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   L  A+ LG +LLVGI+DD TV+ ++G  YP+MNL ER L+V A ++VDEVIIGAP
Sbjct  5    GHATTLEKAKALGTYLLVGIFDDETVNKMKGGNYPVMNLLERVLNVSACKHVDEVIIGAP  64

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSVG  380
             EIT+D+I T NIS+V  G++S S+   +       VPKS+GI R ++S    +T+ ++ 
Sbjct  65   VEITEDLIRTMNISIVAQGSISPSSIQYRFMTQVNEVPKSLGILRDVESDYPYLTSATIA  124

Query  379  QRIIANHEIYVKRN  338
            +RI  N  +Y+ RN
Sbjct  125  ERIAINRLMYISRN  138



>ref|XP_004527209.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X2 [Ceratitis capitata]
Length=409

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  255  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  314

Query  556  WEITKDMITTFNISLVVHGT--VSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +T+D++  F I +V HG   ++  N  +    DPYAVPK+ GIF +I S   +TT  +
Sbjct  315  YCVTEDLLDHFKIDVVCHGQTPIALENGKI----DPYAVPKTRGIFTLIDSQNSMTTELI  370

Query  382  GQRIIANHEIYVKRN  338
             +RII++   Y +RN
Sbjct  371  VERIISHRLEYERRN  385


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  63   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  120

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  121  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  177

Query  376  RII  368
            R++
Sbjct  178  RML  180



>ref|XP_004527208.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like isoform 
X1 [Ceratitis capitata]
Length=422

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  268  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  327

Query  556  WEITKDMITTFNISLVVHGT--VSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +T+D++  F I +V HG   ++  N  +    DPYAVPK+ GIF +I S   +TT  +
Sbjct  328  YCVTEDLLDHFKIDVVCHGQTPIALENGKI----DPYAVPKTRGIFTLIDSQNSMTTELI  383

Query  382  GQRIIANHEIYVKRN  338
             +RII++   Y +RN
Sbjct  384  VERIISHRLEYERRN  398


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  63   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  120

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  121  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  177

Query  376  RII  368
            R++
Sbjct  178  RML  180



>emb|CDH58540.1| ethanolamine-phosphate cytidylyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=378

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G  +PLMNLHER+LSVLA +YVDEVIIGAP
Sbjct  220  GHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIGAP  279

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   + + +V HG  +    +  D  D Y +PK  GI+  I++P   +TT  +
Sbjct  280  YSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENPNSTLTTQGI  337

Query  382  GQRIIANHEIYVKRN  338
              RII N  ++ +R 
Sbjct  338  IDRIIENRFVFEERQ  352


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD+L+VG++ D  ++  +G    +M   ER  +V A ++VDEV+  AP
Sbjct  27   GHANALRQAKAMGDYLVVGVHSDAEITKNKGPT--VMREEERYAAVAACKWVDEVVPDAP  84

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  T D++   NI   VHG   +  + + D  D Y   K  G++R  +  + ++TT  VG
Sbjct  85   YFTTVDILRKHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTQGVSTTELVG  141

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  142  RMLLMTRDHHKRR  154



>emb|CDH58541.1| ethanolamine-phosphate cytidylyltransferase-like [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=377

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G  +PLMNLHER+LSVLA +YVDEVIIGAP
Sbjct  219  GHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIGAP  278

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   + + +V HG  +    +  D  D Y +PK  GI+  I++P   +TT  +
Sbjct  279  YSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENPNSTLTTQGI  336

Query  382  GQRIIANHEIYVKRN  338
              RII N  ++ +R 
Sbjct  337  IDRIIENRFVFEERQ  351


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD+L+VG++ D  ++  +G    +M   ER  +V A ++VDEV+  AP
Sbjct  26   GHANALRQAKAMGDYLVVGVHSDAEITKNKGP--TVMREEERYAAVAACKWVDEVVPDAP  83

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  T D++   NI   VHG   +  + + D  D Y   K  G++R  +  + ++TT  VG
Sbjct  84   YFTTVDILRKHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTQGVSTTELVG  140

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  141  RMLLMTRDHHKRR  153



>emb|CDS11051.1| Putative Ethanolamine-phosphatecytidylyltransferase [Absidia 
idahoensis var. thermophila]
Length=379

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 92/135 (68%), Gaps = 4/135 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LGDFL+VG++DD TV+ ++G  +PLMNLHER+LSVLA +YVDEVIIGAP
Sbjct  219  GHIEFLKRAKALGDFLVVGVHDDQTVNAIKGANHPLMNLHERALSVLACKYVDEVIIGAP  278

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKD-ITTTSV  383
            + +T+D++   + + +V HG  +    +  D  D Y +PK  GI+  I++P   +TT  +
Sbjct  279  YSVTEDVLNKEYKVHVVAHGNTATEPDL--DGSDAYELPKQRGIYVEIENPNSTLTTQGI  336

Query  382  GQRIIANHEIYVKRN  338
              RII N  ++ +R 
Sbjct  337  IDRIIENRFVFEERQ  351


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+++GD+L+VG++ D  ++  +G    +M   ER  +V A ++VDEV+  AP
Sbjct  26   GHANALRQAKEMGDYLVVGVHSDAEIAKNKGP--TVMREEERYAAVAACKWVDEVVPDAP  83

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTS-VG  380
            +  T D++   NI   VHG   +  + + D  D Y   K  G++R  +  + ++TT  VG
Sbjct  84   YFTTVDILRKHNIDFCVHG---DDITTMADGTDCYQAVKDAGLYRECKRTQGVSTTELVG  140

Query  379  QRIIANHEIYVKR  341
            + ++   + + +R
Sbjct  141  RMLLMTRDHHKRR  153



>ref|XP_002423231.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
 gb|EEB10493.1| Ethanolamine-phosphate cytidylyltransferase, putative [Pediculus 
humanus corporis]
Length=434

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ +  AR LGDFL+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV EV+IGAP
Sbjct  263  GHLDFIEKARGLGDFLIVGLHTDPVVNLYKGSNYPIMNLHERVLSVLAFKYVSEVVIGAP  322

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +T++++  FN+ +V HG       +  D  DPY VPK MG F +I S  D+TT  + +
Sbjct  323  YSVTRNLMEHFNVDIVCHGNTQIMPDV--DGRDPYLVPKQMGKFVLIDSGNDMTTEKIVK  380

Query  376  RIIANHEIYVKRN  338
            RII N   Y +RN
Sbjct  381  RIIMNRLEYEQRN  393


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD+L+VG+++D  +   +G   P+    ER   V A ++VDEV+ GAP
Sbjct  54   GHANSLRQAKALGDYLVVGVHNDEEIIKHKGP--PVFTQKERYKMVQAIKWVDEVVEGAP  111

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  +     VHG   +  +   D  D Y + K    ++ ++    I+++ +  
Sbjct  112  YVTTLETLDKYKCDFCVHG---DDITTTADGVDSYHLVKKANRYKEVKRTAGISSSDLVG  168

Query  376  RII  368
            R++
Sbjct  169  RML  171



>ref|XP_005181836.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Musca domestica]
Length=406

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  252  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  311

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F + +V HG   ++   L+D   DPYA+PK+ GIF +I S   +TT  + 
Sbjct  312  YCVTEDLLDHFKVDVVCHG---QTPIALEDGKIDPYAIPKTRGIFCLIDSSNTMTTERIV  368

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  369  ERIISHRLEYERRN  382


 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  39   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  96

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   +  +M  +  D Y + K    ++ ++    ++TT +  
Sbjct  97   YVTTLEVLDEHNCDFCVHG---DDITMTAEGVDTYHLVKKANRYKEVKRTAGVSTTDLVG  153

Query  376  RII  368
            R++
Sbjct  154  RML  156



>ref|XP_011188405.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Bactrocera cucurbitae]
Length=407

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  AR+LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  253  GHLDFLEKARELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  312

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F I +V HG   ++    +D   DPYA+PK+ GIF +I S   +TT  + 
Sbjct  313  YCVTEDLLDHFKIDVVCHG---QTPIAFEDGKIDPYALPKTRGIFTLIDSTNSMTTELIV  369

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  370  ERIISHRLEYERRN  383


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  61   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  118

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  119  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  175

Query  376  RII  368
            R++
Sbjct  176  RML  178



>ref|XP_005181838.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Musca domestica]
Length=385

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  231  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  290

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F + +V HG   ++   L+D   DPYA+PK+ GIF +I S   +TT  + 
Sbjct  291  YCVTEDLLDHFKVDVVCHG---QTPIALEDGKIDPYAIPKTRGIFCLIDSSNTMTTERIV  347

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  348  ERIISHRLEYERRN  361


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  39   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  96

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   +  +M  +  D Y + K    ++ ++    ++TT +  
Sbjct  97   YVTTLEVLDEHNCDFCVHG---DDITMTAEGVDTYHLVKKANRYKEVKRTAGVSTTDLVG  153

Query  376  RII  368
            R++
Sbjct  154  RML  156



>ref|XP_001851245.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
 gb|EDS33301.1| ethanolamine-phosphate cytidylyltransferase [Culex quinquefasciatus]
Length=372

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A+  GD+L+VG++ D  V+  +G  YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  218  GHLDFLEKAKTYGDYLIVGLHTDPVVNVYKGGNYPIMNLHERVLSVLACKYVNEVVIGAP  277

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +TKD++  FN+ LV HG  + +  +     DPYAVPK MG F +I S   ITT  + +
Sbjct  278  YSVTKDLMEHFNVDLVCHGQTTIAPDV--GNLDPYAVPKQMGKFMLIDSGNPITTEDIVE  335

Query  376  RIIANHEIYVKRN  338
            RII +   Y  RN
Sbjct  336  RIIRHRLEYEARN  348


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LG  L+VGI++D  ++  +G   P+    ER   V   ++VDEV+  AP
Sbjct  26   GHANSLRQAKALGHKLVVGIHNDEDITKNKGP--PVFTQEERYKMVRGIKWVDEVVEDAP  83

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +   N    VHG   +  ++  D  D Y + K+   ++ +     ++TT +  
Sbjct  84   YVTTLETLDNNNCDFCVHG---DDITLTADGVDTYHLVKTAERYKEVSRTAGVSTTDLVG  140

Query  376  RII  368
            R++
Sbjct  141  RML  143



>ref|XP_008904899.1| hypothetical protein PPTG_11355 [Phytophthora parasitica INRA-310]
 gb|ETN09753.1| hypothetical protein PPTG_11355 [Phytophthora parasitica INRA-310]
Length=470

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 92/133 (69%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR A+Q G FL+VG+++D+ V+  RG  YP+MNLHER LSVL  +YVD+V+I AP
Sbjct  317  GHVEILRLAKQQGSFLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLIDAP  376

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDP-YAVPKSMGIFRIIQSPKDITTTSVG  380
            W++T +MI + NIS+VVHGT  + + + + + +  Y   + +GIF++IQSP  +    + 
Sbjct  377  WQVTPEMIASLNISVVVHGTHRDQHHLPEFSLEEHYEHARKVGIFQLIQSPIKLDVNDIV  436

Query  379  QRIIANHEIYVKR  341
             RI  N E + K+
Sbjct  437  ARINDNRERFEKK  449


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 70/133 (53%), Gaps = 9/133 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+   R AR LG +L+VG+ DD +++  +G   P++N  ER  SV   ++VDEV    P
Sbjct  125  GHMNAFRQARSLGTYLVVGVNDDESITACKGAP-PVLNNEERIASVEGCKFVDEVEPHCP  183

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + + +D    MI    I  VVHG     +  + D  D Y   + +G +R I   + ++T+
Sbjct  184  YIMNEDYLQRMIKKHRIDYVVHG----DDPCIVDGKDVYESAQKLGKYRTIPRTEGVSTS  239

Query  388  SVGQRIIANHEIY  350
             +  R++  H+ +
Sbjct  240  DILGRMLVMHKTH  252



>ref|XP_001969670.1| GG23821 [Drosophila erecta]
 gb|EDV58729.1| GG23821 [Drosophila erecta]
Length=384

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 94/135 (70%), Gaps = 6/135 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA ++V+EV+IGAP
Sbjct  230  GHLDFLEKAKKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAP  289

Query  556  WEITKDMITTFNISLVVHG--TVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSV  383
            + +T+D++  F I +V HG   +S  N  +    DPYAVPK+  IF +I S  ++TT  +
Sbjct  290  YCVTEDLLEHFKIDVVCHGRTPISLENGKI----DPYAVPKTRAIFELIDSGNEMTTERI  345

Query  382  GQRIIANHEIYVKRN  338
             +RII++   Y +RN
Sbjct  346  VERIISHRLEYERRN  360


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  38   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  95

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  96   YVTTLEVLDQNNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVG  152

Query  376  RII  368
            R++
Sbjct  153  RML  155



>ref|XP_011188404.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Bactrocera cucurbitae]
Length=420

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  AR+LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  266  GHLDFLEKARELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F I +V HG   ++    +D   DPYA+PK+ GIF +I S   +TT  + 
Sbjct  326  YCVTEDLLDHFKIDVVCHG---QTPIAFEDGKIDPYALPKTRGIFTLIDSTNSMTTELIV  382

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  383  ERIISHRLEYERRN  396


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  61   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  118

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  119  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  175

Query  376  RII  368
            R++
Sbjct  176  RML  178



>ref|XP_001623420.1| predicted protein [Nematostella vectensis]
 gb|EDO31320.1| predicted protein [Nematostella vectensis]
Length=373

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            G ++ L  A+ LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA RYVD+VIIGAP
Sbjct  219  GFLDFLEKAKALGDYLIVGLHTDQIVNRYKGSNYPIMNLHERVLSVLACRYVDQVIIGAP  278

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +++++I  F + LVVHG     N +  +  DPY +P+ +GIF+ I S   ITT  +  
Sbjct  279  YSVSQELIDQFKVDLVVHGNTPVMNDVNGE--DPYRIPRKLGIFKTINSESTITTADIVA  336

Query  376  RIIANHEIYVKRN  338
            RII N   + +RN
Sbjct  337  RIIRNKLKFEERN  349


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD+L VG++ D  ++  +G   P+ N  ER   V A ++VDEVI  AP
Sbjct  27   GHANALRQAKAMGDWLCVGVHSDAEIAHNKGP--PVFNEEERYKMVRAIKWVDEVIENAP  84

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +        VHG   +  ++  D  D Y + K  G ++  +    ++TT++  
Sbjct  85   YTTTLETMDDHGCEFCVHG---DDITLTADGTDTYHIVKDAGRYKECKRTAGVSTTNLVG  141

Query  376  RII  368
            R++
Sbjct  142  RML  144



>ref|XP_011202026.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X2 [Bactrocera dorsalis]
Length=407

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  253  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  312

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F I +V HG   ++    +D   DPYAVPK+ GIF +I S   +TT  + 
Sbjct  313  YCVTEDLLDHFKIDVVCHG---QTPIAFEDGKIDPYAVPKTRGIFTLIDSQNSMTTELIV  369

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  370  ERIISHRIEYERRN  383


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  61   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  118

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  119  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  175

Query  376  RII  368
            R++
Sbjct  176  RML  178



>ref|XP_002002855.1| GI17607 [Drosophila mojavensis]
 gb|EDW12297.1| GI17607 [Drosophila mojavensis]
Length=394

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  AR+LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA ++V+EV+IGAP
Sbjct  240  GHLDFLEKARKLGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKFVNEVVIGAP  299

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T++++  F I +V HG    S   L+D   DPYAVPK+  IF +I S  D+TT  + 
Sbjct  300  YCVTEELLDHFKIDVVCHGRTPIS---LEDGKVDPYAVPKTRAIFELIDSGNDMTTERIV  356

Query  379  QRIIANHEIYVKRN  338
            +RII +   Y +RN
Sbjct  357  ERIILHRLEYERRN  370


 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  48   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  105

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++   +    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  106  YVTTLEVLDQNDCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVKRTAGVSTTDLVG  162

Query  376  RII  368
            R++
Sbjct  163  RML  165



>ref|XP_011202025.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase isoform 
X1 [Bactrocera dorsalis]
Length=420

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 94/134 (70%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A++LGD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV+EV+IGAP
Sbjct  266  GHLDFLEKAKELGDYLIVGLHTDPVVNSYKGSNYPIMNLHERVLSVLACKYVNEVVIGAP  325

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKD-TCDPYAVPKSMGIFRIIQSPKDITTTSVG  380
            + +T+D++  F I +V HG   ++    +D   DPYAVPK+ GIF +I S   +TT  + 
Sbjct  326  YCVTEDLLDHFKIDVVCHG---QTPIAFEDGKIDPYAVPKTRGIFTLIDSQNSMTTELIV  382

Query  379  QRIIANHEIYVKRN  338
            +RII++   Y +RN
Sbjct  383  ERIISHRIEYERRN  396


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD ++VGI+ D  ++  +G   P+    ER   V   ++VDEV++GAP
Sbjct  61   GHANSLRQAKALGDKVIVGIHTDEEITKHKGP--PVFTEEERVKMVKGIKWVDEVVLGAP  118

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T +++  +N    VHG   +  +M  +  D Y + KS   ++ ++    ++TT +  
Sbjct  119  YVTTLEVLDEYNCDFCVHG---DDITMTAEGVDTYHLVKSANRYKEVRRTAGVSTTDLVG  175

Query  376  RII  368
            R++
Sbjct  176  RML  178



>ref|XP_002767684.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER00402.1| Choline-phosphate cytidylyltransferase A, putative [Perkinsus 
marinus ATCC 50983]
Length=215

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 89/134 (66%), Gaps = 1/134 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   L  A+ LG +LLVGI+DD TV+ ++G  YP+MNLHER L+V A ++VDEVIIGAP
Sbjct  62   GHATTLEKAKALGTYLLVGIFDDETVNKMKGGNYPVMNLHERVLNVSACKHVDEVIIGAP  121

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSP-KDITTTSVG  380
             EI++D+I T NIS+V  G++S  ++  +     + VPK +GI R ++S    +T  ++ 
Sbjct  122  VEISEDLIRTMNISIVAQGSISSFSTQYEILVRLFVVPKRLGILREVESDYPHLTGATIA  181

Query  379  QRIIANHEIYVKRN  338
             RII N   Y+ RN
Sbjct  182  TRIIKNCLTYINRN  195



>ref|XP_787725.3| PREDICTED: ethanolamine-phosphate cytidylyltransferase-like [Strongylocentrotus 
purpuratus]
Length=213

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 88/133 (66%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A +LG++++VG++ D  V+   G+ YP+MNLHER+LSVLA RYVDEV+IGAP
Sbjct  46   GHIDFLEQASKLGNYIIVGLHGDQEVNRYHGSNYPIMNLHERTLSVLACRYVDEVVIGAP  105

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +++T +++  FN+ +VV G          D  DPY  PK  GI +++ S  +++ + + +
Sbjct  106  YKVTAELLDHFNVDVVVQGKTKIFQGA--DGADPYEEPKKRGILQLVDSGNNMSASKIVE  163

Query  376  RIIANHEIYVKRN  338
            RII N   + KRN
Sbjct  164  RIITNRIRFQKRN  176



>gb|EFX78214.1| hypothetical protein DAPPUDRAFT_305267 [Daphnia pulex]
Length=367

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 86/133 (65%), Gaps = 0/133 (0%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  AR  GD+L+VG++ D  V+  +G  YP+MNLHER LSVLA RYV EV+IGAP
Sbjct  215  GHLDFLEKARAQGDYLIVGLHTDPVVNQYKGANYPIMNLHERVLSVLACRYVSEVVIGAP  274

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + ++KDM+  F + LVVHG    +  +  +  DPY  PK    F ++ S   +TT  + Q
Sbjct  275  YSVSKDMMDHFKVDLVVHGATPVATDVDGEDGDPYEEPKRRNKFMLLDSGNTMTTELLVQ  334

Query  376  RIIANHEIYVKRN  338
            RII+N   +V+RN
Sbjct  335  RIISNRLSFVERN  347


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GD+L+VG+++D  ++  +G   P+    ER   V   ++VDEVI GAP
Sbjct  23   GHANSLRQAKAMGDYLVVGVHNDEEITKHKGP--PVFTEEERYKMVRGIKWVDEVIEGAP  80

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  ++    VHG   +  +   D  D Y + KS G ++  Q  + ++TT +  
Sbjct  81   YVTTLETLDKYDCQFCVHG---DDITTTADGVDTYHIVKSAGRYKECQRTQGVSTTDLVG  137

Query  376  RII  368
            R++
Sbjct  138  RML  140



>gb|ESA12672.1| hypothetical protein GLOINDRAFT_347240 [Rhizophagus irregularis 
DAOM 181602]
Length=344

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LG++LLVGI+DD TV+ ++G  +PLMNLHER LSVLA RYVDEVI+GAP
Sbjct  195  GHIEFLKRAKSLGNYLLVGIHDDQTVNAIKGVNFPLMNLHERVLSVLACRYVDEVILGAP  254

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPK-DITTTSV  383
            + + +++++  + + +V HG       +  +  DPY +PK++GI+  I++P  +ITT  +
Sbjct  255  YSVDENVLSKVYKVDIVAHGNTPSLPDV--NGKDPYELPKALGIYVEIENPSAEITTDGI  312

Query  382  GQRIIANHEIYVKR  341
              RII + ++Y +R
Sbjct  313  INRIIEHRKMYEER  326


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GDFL+VG++ D  +   +G    +M   ER  +V A ++ D V+  AP
Sbjct  4    GHANALRQAKAMGDFLVVGVHSDEEIEKHKGPT--VMKEEERYTAVEACKWADLVVKDAP  61

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  + +++  +N    VHG   +  + L D  D Y   K  G +R  +  + I+TT +  
Sbjct  62   YFTSLEVMEKYNCDFCVHG---DDITTLSDGTDCYQAVKDAGKYRECKRTQGISTTELVG  118

Query  376  RII  368
            R++
Sbjct  119  RML  121



>gb|ETI47683.1| hypothetical protein F443_08147 [Phytophthora parasitica P1569]
 gb|ETK87618.1| hypothetical protein L915_07974 [Phytophthora parasitica]
 gb|ETL41016.1| hypothetical protein L916_07898 [Phytophthora parasitica]
 gb|ETL94196.1| hypothetical protein L917_07794 [Phytophthora parasitica]
 gb|ETM47424.1| hypothetical protein L914_07862 [Phytophthora parasitica]
 gb|ETO76398.1| hypothetical protein F444_08201 [Phytophthora parasitica P1976]
 gb|ETP17486.1| hypothetical protein F441_08121 [Phytophthora parasitica CJ01A1]
 gb|ETP45518.1| hypothetical protein F442_08086 [Phytophthora parasitica P10297]
Length=470

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR A+Q G +L+VG+++D+ V+  RG  YP+MNLHER LSVL  +YVD+V+I AP
Sbjct  317  GHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLIDAP  376

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDP-YAVPKSMGIFRIIQSPKDITTTSVG  380
            W++T +MI + NIS+VVHGT  + + + + + +  Y   +  GIF++IQSP  +    + 
Sbjct  377  WQVTPEMIASLNISVVVHGTHRDQHHLPEFSLEEHYEHARKAGIFQLIQSPIKLDVNDIV  436

Query  379  QRIIANHEIYVKR  341
             RI  N E + K+
Sbjct  437  ARINDNRERFEKK  449


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 70/133 (53%), Gaps = 9/133 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+   R AR LG +L+VG+ DD +++  +G   P++N  ER  SV   ++VDEV    P
Sbjct  125  GHMNAFRQARSLGTYLVVGVNDDESITACKGAP-PVLNNEERIASVEGCKFVDEVEPHCP  183

Query  556  WEITKD----MITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            + + +D    MI    I  VVHG     +  + D  D Y   + +G +R I   + ++T+
Sbjct  184  YIMNEDYLQRMIKKHRIDYVVHG----DDPCIVDGKDVYESAQKLGKYRTIPRTEGVSTS  239

Query  388  SVGQRIIANHEIY  350
             +  R++  H+ +
Sbjct  240  DILGRMLVMHKTH  252



>ref|XP_009513920.1| hypothetical protein PHYSODRAFT_348782 [Phytophthora sojae]
 gb|EGZ26645.1| hypothetical protein PHYSODRAFT_348782 [Phytophthora sojae]
Length=469

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR A+Q G +L+VG+++D+ V+  RG  YP+MNLHER LSVL  ++VD+V+I AP
Sbjct  316  GHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKFVDDVLIDAP  375

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDP-YAVPKSMGIFRIIQSPKDITTTSVG  380
            W++T +MI + NIS+VVHGT  + + + + + +  Y   +  GIF++IQSP  +    + 
Sbjct  376  WQVTPEMIASLNISVVVHGTHRDQHHLPEFSLEEHYEHARKAGIFKLIQSPNKLDVNDIV  435

Query  379  QRIIANHEIYVKR  341
             RI  N E + K+
Sbjct  436  GRINDNRERFEKK  448


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 69/133 (52%), Gaps = 9/133 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+   R AR LG +L+VG+ DD +++  +G   P++N  ER  SV   ++VDEV    P
Sbjct  125  GHMNAFRQARSLGTYLVVGVNDDESITACKGAP-PVLNNEERIASVEGCKFVDEVEPHCP  183

Query  556  W----EITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +    E  + MI    I  VVHG     +  + D  D Y   + +G +R I   + ++T+
Sbjct  184  YIMNEEYLQRMIKKHRIDYVVHG----DDPCIVDGKDVYESAQKLGKYRTIPRTEGVSTS  239

Query  388  SVGQRIIANHEIY  350
             +  R++  H+ +
Sbjct  240  DILGRMLVMHKTH  252



>ref|XP_966534.1| PREDICTED: ethanolamine-phosphate cytidylyltransferase [Tribolium 
castaneum]
 gb|EFA00200.1| hypothetical protein TcasGA2_TC003025 [Tribolium castaneum]
Length=378

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 87/133 (65%), Gaps = 2/133 (2%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH++ L  A+Q GD+L+VG++ D  V+  +G+ YP+MNLHER LSVLA +YV EV+IGAP
Sbjct  220  GHLDFLEKAKQQGDYLIVGLHTDPVVNRYKGSNYPIMNLHERVLSVLACKYVSEVVIGAP  279

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            + +TKD++  FNI +VVHG     N +  D  DP+A PK +  F  + S  D+TT  +  
Sbjct  280  YTVTKDLMEHFNIDMVVHGCTPVMNDV--DGRDPFAYPKQVKKFITVDSGSDMTTEKIVD  337

Query  376  RIIANHEIYVKRN  338
            RII N   +  RN
Sbjct  338  RIIRNRLEFEARN  350


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ LGD+L+VG++ D  ++  +G   P+ N  ER   V   ++VDEV+ GAP
Sbjct  28   GHANSLRQAKALGDYLIVGVHTDEEITKHKGP--PVFNQEERYKMVRGIKWVDEVVEGAP  85

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  T + +  ++     HG   +  +M  D  D Y + K+ G +R +Q    ++TT +  
Sbjct  86   YVTTLETLDKYDCDFCCHG---DDITMTADGVDTYHLVKAAGRYREVQRTAGVSTTDLVG  142

Query  376  RII  368
            R++
Sbjct  143  RML  145



>ref|XP_002896776.1| ethanolamine-phosphate cytidylyltransferase, putative [Phytophthora 
infestans T30-4]
 gb|EEY66711.1| ethanolamine-phosphate cytidylyltransferase, putative [Phytophthora 
infestans T30-4]
Length=470

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GHVEILR A+Q G +L+VG+++D+ V+  RG  YP+MNLHER LSVL  +YVD+V+I AP
Sbjct  317  GHVEILRLAKQQGSYLIVGVHNDSVVNAHRGLNYPIMNLHERVLSVLGCKYVDDVLIDAP  376

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDP-YAVPKSMGIFRIIQSPKDITTTSVG  380
            W++T +MI + NIS+VVHGT  + + + + + +  Y   +  GIF++IQSP  +    + 
Sbjct  377  WQVTPEMIASLNISVVVHGTHRDQHHLPEFSLEEHYEHARKAGIFQLIQSPIKLDVNDIV  436

Query  379  QRIIANHEIYVKR  341
             RI  N E + K+
Sbjct  437  ARINDNRERFEKK  449


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 9/133 (7%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+   R AR LG +L+VG+ DD +++  +G   P++N  ER  SV   ++VD V    P
Sbjct  125  GHMNAFRQARSLGTYLVVGVNDDESITACKGAP-PVLNNEERIASVKGCKFVDVVEPHCP  183

Query  556  W----EITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTT  389
            +    E  + MI    I  VVHG     +  + D  D Y   + +G +R I   + ++T+
Sbjct  184  YIMNEEYLQRMIKKHRIDYVVHG----DDPCIVDGKDVYESAQKLGKYRTIPRTEGVSTS  239

Query  388  SVGQRIIANHEIY  350
             +  R++  H+ +
Sbjct  240  DILGRMLVMHKTH  252



>gb|EXX58968.1| ethanolamine-phosphate cytidylyltransferase [Rhizophagus irregularis 
DAOM 197198w]
Length=364

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 95/134 (71%), Gaps = 4/134 (3%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH+E L+ A+ LG++LLVGI+DD TV+ ++G  +PLMNLHER LSVLA RYVDEVI+GAP
Sbjct  215  GHIEFLKRAKSLGNYLLVGIHDDQTVNAIKGVNFPLMNLHERVLSVLACRYVDEVILGAP  274

Query  556  WEITKDMITT-FNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPK-DITTTSV  383
            + + +++++  + + +V HG       +  +  DPY +PK++GI+  I++P  +ITT  +
Sbjct  275  YSVDENVLSKVYKVDIVAHGNTPSLPDV--NGKDPYELPKALGIYVEIENPSAEITTDGI  332

Query  382  GQRIIANHEIYVKR  341
              RII + ++Y +R
Sbjct  333  INRIIEHRKMYEER  346


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = -3

Query  736  GHVEILRSARQLGDFLLVGIYDDNTVSGVRGTQYPLMNLHERSLSVLASRYVDEVIIGAP  557
            GH   LR A+ +GDFL+VG++ D  +   +G    +M   ER  +V A ++ D V+  AP
Sbjct  24   GHANALRQAKAMGDFLVVGVHSDEEIEKHKGPT--VMKEEERYTAVEACKWADLVVKDAP  81

Query  556  WEITKDMITTFNISLVVHGTVSESNSMLKDTCDPYAVPKSMGIFRIIQSPKDITTTSVGQ  377
            +  + +++  +N    VHG   +  + L D  D Y   K  G +R  +  + I+TT +  
Sbjct  82   YFTSLEVMEKYNCDFCVHG---DDITTLSDGTDCYQAVKDAGKYRECKRTQGISTTELVG  138

Query  376  RII  368
            R++
Sbjct  139  RML  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515