BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032D11

Length=834
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06599.1|  unnamed protein product                                403   4e-131   Coffea canephora [robusta coffee]
ref|XP_007026989.1|  Cell division protease ftsH isoform 1              403   5e-131   
ref|XP_009772661.1|  PREDICTED: ATP-dependent zinc metalloproteas...    400   7e-130   Nicotiana sylvestris
gb|KJB16964.1|  hypothetical protein B456_002G257200                    398   4e-129   Gossypium raimondii
ref|XP_009598017.1|  PREDICTED: ATP-dependent zinc metalloproteas...    397   7e-129   Nicotiana tomentosiformis
gb|KHG12964.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    397   9e-129   Gossypium arboreum [tree cotton]
gb|KDO51173.1|  hypothetical protein CISIN_1g005738mg                   393   9e-129   Citrus sinensis [apfelsine]
gb|AFX67028.1|  putative AAA-metalloprotease FtsH                       380   1e-128   Solanum tuberosum [potatoes]
ref|XP_006480880.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   1e-127   
ref|XP_010262544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    394   1e-127   Nelumbo nucifera [Indian lotus]
ref|XP_006429118.1|  hypothetical protein CICLE_v10011087mg             394   1e-127   Citrus clementina [clementine]
ref|XP_010256889.1|  PREDICTED: ATP-dependent zinc metalloproteas...    393   3e-127   Nelumbo nucifera [Indian lotus]
ref|XP_002323508.2|  hypothetical protein POPTR_0016s10620g             392   5e-127   
gb|KDP35648.1|  hypothetical protein JCGZ_09086                         392   7e-127   Jatropha curcas
ref|XP_011007151.1|  PREDICTED: ATP-dependent zinc metalloproteas...    389   9e-127   Populus euphratica
ref|XP_008464106.1|  PREDICTED: ATP-dependent zinc metalloproteas...    392   1e-126   Cucumis melo [Oriental melon]
gb|KJB55847.1|  hypothetical protein B456_009G097900                    389   4e-126   Gossypium raimondii
ref|XP_011007150.1|  PREDICTED: ATP-dependent zinc metalloproteas...    390   5e-126   Populus euphratica
gb|KJB55846.1|  hypothetical protein B456_009G097900                    389   7e-126   Gossypium raimondii
ref|XP_011094876.1|  PREDICTED: ATP-dependent zinc metalloproteas...    389   9e-126   Sesamum indicum [beniseed]
ref|XP_011094875.1|  PREDICTED: ATP-dependent zinc metalloproteas...    389   1e-125   Sesamum indicum [beniseed]
gb|EYU41737.1|  hypothetical protein MIMGU_mgv1a001461mg                389   2e-125   Erythranthe guttata [common monkey flower]
ref|XP_007208082.1|  hypothetical protein PRUPE_ppa001525mg             387   5e-125   
ref|XP_009338598.1|  PREDICTED: ATP-dependent zinc metalloproteas...    387   5e-125   Pyrus x bretschneideri [bai li]
ref|XP_009345397.1|  PREDICTED: ATP-dependent zinc metalloproteas...    387   6e-125   Pyrus x bretschneideri [bai li]
gb|KHG20351.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    387   8e-125   Gossypium arboreum [tree cotton]
ref|XP_002530989.1|  Mitochondrial respiratory chain complexes as...    387   8e-125   
ref|XP_008369915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    386   1e-124   
ref|XP_004143122.1|  PREDICTED: ATP-dependent zinc metalloproteas...    385   3e-124   Cucumis sativus [cucumbers]
ref|XP_010106514.1|  ATP-dependent zinc metalloprotease FTSH 10         384   7e-124   Morus notabilis
ref|XP_008240759.1|  PREDICTED: ATP-dependent zinc metalloproteas...    384   1e-123   Prunus mume [ume]
ref|XP_003537985.1|  PREDICTED: ATP-dependent zinc metalloproteas...    382   3e-123   Glycine max [soybeans]
gb|KHN21936.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    382   3e-123   Glycine soja [wild soybean]
gb|KDO72822.1|  hypothetical protein CISIN_1g047690mg                   382   5e-123   Citrus sinensis [apfelsine]
ref|XP_008777200.1|  PREDICTED: ATP-dependent zinc metalloproteas...    378   7e-123   
ref|XP_008448079.1|  PREDICTED: ATP-dependent zinc metalloproteas...    381   1e-122   Cucumis melo [Oriental melon]
ref|XP_010931245.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   1e-122   
ref|XP_008448063.1|  PREDICTED: ATP-dependent zinc metalloproteas...    381   2e-122   Cucumis melo [Oriental melon]
ref|XP_010043512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   2e-122   
ref|XP_006349501.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   2e-122   Solanum tuberosum [potatoes]
ref|XP_006349499.1|  PREDICTED: ATP-dependent zinc metalloproteas...    378   2e-122   Solanum tuberosum [potatoes]
ref|XP_006349500.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   2e-122   Solanum tuberosum [potatoes]
ref|XP_006488359.1|  PREDICTED: ATP-dependent zinc metalloproteas...    380   2e-122   Citrus sinensis [apfelsine]
ref|XP_006424865.1|  hypothetical protein CICLE_v10027837mg             380   2e-122   Citrus clementina [clementine]
ref|XP_002283273.1|  PREDICTED: ATP-dependent zinc metalloproteas...    380   3e-122   Vitis vinifera
ref|XP_006341014.1|  PREDICTED: ATP-dependent zinc metalloproteas...    379   5e-122   Solanum tuberosum [potatoes]
ref|XP_004142062.1|  PREDICTED: ATP-dependent zinc metalloproteas...    379   6e-122   Cucumis sativus [cucumbers]
ref|XP_009600786.1|  PREDICTED: ATP-dependent zinc metalloproteas...    376   8e-122   Nicotiana tomentosiformis
ref|XP_007016370.1|  FTSH protease 10                                   379   1e-121   
ref|XP_004164623.1|  PREDICTED: ATP-dependent zinc metalloproteas...    379   1e-121   
gb|AAU44017.1|  putative AAA-metalloprotease FtsH (fragment)            368   1e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777193.1|  PREDICTED: ATP-dependent zinc metalloproteas...    378   2e-121   Phoenix dactylifera
ref|XP_006349497.1|  PREDICTED: ATP-dependent zinc metalloproteas...    378   2e-121   Solanum tuberosum [potatoes]
ref|XP_006349498.1|  PREDICTED: ATP-dependent zinc metalloproteas...    378   2e-121   Solanum tuberosum [potatoes]
ref|XP_006592192.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   3e-121   
ref|XP_010312354.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   4e-121   Solanum lycopersicum
ref|XP_004249560.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   4e-121   Solanum lycopersicum
ref|XP_010931243.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   4e-121   Elaeis guineensis
ref|XP_010931244.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   5e-121   Elaeis guineensis
gb|KCW85528.1|  hypothetical protein EUGRSUZ_B02325                     376   8e-121   Eucalyptus grandis [rose gum]
ref|XP_009375915.1|  PREDICTED: ATP-dependent zinc metalloproteas...    376   8e-121   Pyrus x bretschneideri [bai li]
ref|XP_009804923.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   9e-121   Nicotiana sylvestris
ref|XP_010043511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    377   9e-121   Eucalyptus grandis [rose gum]
ref|XP_009384843.1|  PREDICTED: ATP-dependent zinc metalloproteas...    376   1e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004246405.1|  PREDICTED: ATP-dependent zinc metalloproteas...    376   1e-120   Solanum lycopersicum
ref|XP_004294648.1|  PREDICTED: ATP-dependent zinc metalloproteas...    375   1e-120   Fragaria vesca subsp. vesca
ref|XP_009384842.1|  PREDICTED: ATP-dependent zinc metalloproteas...    376   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN36802.1|  unknown                                                 363   2e-120   Zea mays [maize]
ref|XP_009416148.1|  PREDICTED: ATP-dependent zinc metalloproteas...    375   2e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006592191.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   4e-120   Glycine max [soybeans]
ref|XP_004961860.1|  PREDICTED: ATP-dependent zinc metalloproteas...    375   4e-120   Setaria italica
ref|XP_008384940.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   4e-120   
ref|XP_008359096.1|  PREDICTED: ATP-dependent zinc metalloproteas...    373   5e-120   
ref|XP_009140963.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   5e-120   Brassica rapa
gb|KHN32138.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    373   6e-120   Glycine soja [wild soybean]
ref|XP_003539663.1|  PREDICTED: ATP-dependent zinc metalloproteas...    373   9e-120   Glycine max [soybeans]
ref|XP_009364366.1|  PREDICTED: ATP-dependent zinc metalloproteas...    373   1e-119   Pyrus x bretschneideri [bai li]
ref|XP_011089809.1|  PREDICTED: ATP-dependent zinc metalloproteas...    374   1e-119   Sesamum indicum [beniseed]
ref|XP_010937593.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    373   1e-119   
emb|CDY31753.1|  BnaA04g16890D                                          372   2e-119   Brassica napus [oilseed rape]
ref|XP_006293791.1|  hypothetical protein CARUB_v10022773mg             369   3e-119   
emb|CDX77230.1|  BnaC04g40250D                                          372   3e-119   
gb|KFK43073.1|  hypothetical protein AALP_AA1G075200                    372   4e-119   Arabis alpina [alpine rockcress]
ref|XP_006417796.1|  hypothetical protein EUTSA_v10006814mg             372   4e-119   Eutrema salsugineum [saltwater cress]
ref|XP_008222305.1|  PREDICTED: ATP-dependent zinc metalloproteas...    372   5e-119   Prunus mume [ume]
ref|XP_007207144.1|  hypothetical protein PRUPE_ppa001491mg             372   5e-119   Prunus persica
ref|XP_010521866.1|  PREDICTED: ATP-dependent zinc metalloproteas...    367   6e-119   Tarenaya hassleriana [spider flower]
ref|XP_004302718.2|  PREDICTED: ATP-dependent zinc metalloproteas...    371   7e-119   Fragaria vesca subsp. vesca
ref|XP_008356937.1|  PREDICTED: ATP-dependent zinc metalloproteas...    371   8e-119   Malus domestica [apple tree]
dbj|BAE98430.1|  AAA-type like ATPase                                   355   8e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003539662.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   1e-118   Glycine max [soybeans]
gb|KHN32140.1|  ATP-dependent zinc metalloprotease FTSH 10, mitoc...    370   1e-118   Glycine soja [wild soybean]
ref|XP_010043509.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   1e-118   Eucalyptus grandis [rose gum]
ref|XP_010685724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   2e-118   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009387530.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010475512.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   2e-118   Camelina sativa [gold-of-pleasure]
ref|XP_010475511.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   2e-118   Camelina sativa [gold-of-pleasure]
gb|KFK32242.1|  hypothetical protein AALP_AA6G216200                    370   2e-118   Arabis alpina [alpine rockcress]
ref|XP_010487541.1|  PREDICTED: ATP-dependent zinc metalloproteas...    370   2e-118   Camelina sativa [gold-of-pleasure]
gb|KDP42240.1|  hypothetical protein JCGZ_02970                         369   3e-118   Jatropha curcas
ref|XP_010487557.1|  PREDICTED: ATP-dependent zinc metalloproteas...    369   6e-118   
gb|EEE63976.1|  hypothetical protein OsJ_18802                          368   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521865.1|  PREDICTED: ATP-dependent zinc metalloproteas...    369   6e-118   Tarenaya hassleriana [spider flower]
ref|XP_002439915.1|  hypothetical protein SORBIDRAFT_09g022490          369   6e-118   Sorghum bicolor [broomcorn]
ref|XP_010920548.1|  PREDICTED: ATP-dependent zinc metalloproteas...    369   9e-118   Elaeis guineensis
gb|EEC79350.1|  hypothetical protein OsI_20217                          369   1e-117   Oryza sativa Indica Group [Indian rice]
ref|NP_001055745.1|  Os05g0458400                                       368   1e-117   
ref|XP_003568313.1|  PREDICTED: ATP-dependent zinc metalloproteas...    368   2e-117   Brachypodium distachyon [annual false brome]
ref|XP_010469994.1|  PREDICTED: ATP-dependent zinc metalloproteas...    367   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_002881027.1|  hypothetical protein ARALYDRAFT_344684             367   3e-117   
ref|XP_010414442.1|  PREDICTED: ATP-dependent zinc metalloproteas...    366   6e-117   Camelina sativa [gold-of-pleasure]
ref|XP_009781386.1|  PREDICTED: ATP-dependent zinc metalloproteas...    366   6e-117   Nicotiana sylvestris
ref|XP_002313426.1|  FtsH protease family protein                       365   8e-117   
gb|AFW82207.1|  hypothetical protein ZEAMMB73_958383                    366   9e-117   
emb|CDP09082.1|  unnamed protein product                                366   1e-116   Coffea canephora [robusta coffee]
ref|XP_006306790.1|  hypothetical protein CARUB_v10008328mg             365   1e-116   Capsella rubella
ref|XP_010510537.1|  PREDICTED: ATP-dependent zinc metalloproteas...    365   2e-116   Camelina sativa [gold-of-pleasure]
ref|NP_850129.1|  FTSH protease 3                                       365   2e-116   Arabidopsis thaliana [mouse-ear cress]
gb|AAC33234.1|  putative AAA-type ATPase                                365   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009125053.1|  PREDICTED: ATP-dependent zinc metalloproteas...    364   3e-116   Brassica rapa
ref|XP_010542637.1|  PREDICTED: ATP-dependent zinc metalloproteas...    365   3e-116   Tarenaya hassleriana [spider flower]
ref|XP_009611240.1|  PREDICTED: ATP-dependent zinc metalloproteas...    364   3e-116   Nicotiana tomentosiformis
emb|CDY39531.1|  BnaC04g15300D                                          364   3e-116   Brassica napus [oilseed rape]
emb|CDY47876.1|  BnaA07g14210D                                          364   4e-116   Brassica napus [oilseed rape]
ref|XP_006655377.1|  PREDICTED: ATP-dependent zinc metalloproteas...    363   4e-116   
ref|XP_009118433.1|  PREDICTED: ATP-dependent zinc metalloproteas...    363   5e-116   Brassica rapa
gb|AAL36270.1|  putative AAA-type ATPase                                363   5e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007133225.1|  hypothetical protein PHAVU_011G162000g             364   5e-116   Phaseolus vulgaris [French bean]
ref|NP_172231.2|  FTSH protease 10                                      363   6e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006409951.1|  hypothetical protein EUTSA_v10016261mg             363   1e-115   Eutrema salsugineum [saltwater cress]
ref|XP_011032280.1|  PREDICTED: ATP-dependent zinc metalloproteas...    362   3e-115   Populus euphratica
gb|AAK77908.1|AF397903_1  AAA-metalloprotease FtsH                      361   4e-115   Pisum sativum [garden pea]
emb|CDY09913.1|  BnaC08g45380D                                          360   7e-115   Brassica napus [oilseed rape]
ref|XP_002889652.1|  FTSH10                                             361   7e-115   Arabidopsis lyrata subsp. lyrata
ref|XP_008784613.1|  PREDICTED: ATP-dependent zinc metalloproteas...    360   2e-114   Phoenix dactylifera
gb|EAY76461.1|  hypothetical protein OsI_04395                          357   9e-114   Oryza sativa Indica Group [Indian rice]
ref|NP_001044774.1|  Os01g0842600                                       357   1e-113   
ref|XP_006845226.1|  hypothetical protein AMTR_s00005p00256120          358   1e-113   Amborella trichopoda
gb|KJB16965.1|  hypothetical protein B456_002G257200                    356   2e-113   Gossypium raimondii
dbj|BAJ98147.1|  predicted protein                                      355   7e-113   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644995.1|  PREDICTED: ATP-dependent zinc metalloproteas...    355   1e-112   Oryza brachyantha
ref|XP_004970544.1|  PREDICTED: ATP-dependent zinc metalloproteas...    354   2e-112   Setaria italica
ref|XP_003606687.1|  Cell division protease ftsH-like protein           353   3e-112   Medicago truncatula
ref|XP_008799731.1|  PREDICTED: ATP-dependent zinc metalloproteas...    354   4e-112   Phoenix dactylifera
gb|EMS50561.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    352   5e-112   Triticum urartu
gb|EMT04659.1|  Cell division protease ftsH-like protein, mitocho...    350   5e-112   
ref|XP_003567261.1|  PREDICTED: ATP-dependent zinc metalloproteas...    348   9e-112   
ref|XP_007132051.1|  hypothetical protein PHAVU_011G062800g             350   5e-111   Phaseolus vulgaris [French bean]
gb|AAF79577.1|AC022464_35  F22G5.10                                     351   6e-111   Arabidopsis thaliana [mouse-ear cress]
gb|EYU38460.1|  hypothetical protein MIMGU_mgv1a001496mg                350   7e-111   Erythranthe guttata [common monkey flower]
gb|KCW85527.1|  hypothetical protein EUGRSUZ_B02324                     349   1e-110   Eucalyptus grandis [rose gum]
ref|XP_010043510.1|  PREDICTED: ATP-dependent zinc metalloproteas...    349   2e-110   Eucalyptus grandis [rose gum]
ref|XP_002458748.1|  hypothetical protein SORBIDRAFT_03g039540          348   3e-110   Sorghum bicolor [broomcorn]
gb|EPS71434.1|  hypothetical protein M569_03325                         346   2e-109   Genlisea aurea
ref|XP_001785268.1|  predicted protein                                  340   3e-108   
ref|XP_004507174.1|  PREDICTED: ATP-dependent zinc metalloproteas...    343   4e-108   Cicer arietinum [garbanzo]
gb|KJB36698.1|  hypothetical protein B456_006G171800                    337   6e-108   Gossypium raimondii
ref|NP_001145329.1|  uncharacterized protein LOC100278654               332   1e-107   
ref|XP_008358519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    341   2e-107   
emb|CDM84966.1|  unnamed protein product                                337   2e-106   Triticum aestivum [Canadian hard winter wheat]
gb|EMS48627.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    336   2e-105   Triticum urartu
gb|EMT07840.1|  Cell division protease ftsH-like protein, mitocho...    338   7e-105   
ref|XP_006845235.1|  hypothetical protein AMTR_s00005p00257870          317   6e-103   
ref|XP_001782950.1|  predicted protein                                  326   5e-101   
gb|KEH23850.1|  ATP-dependent zinc metalloprotease FTSH protein         320   3e-100   Medicago truncatula
ref|XP_001759881.1|  predicted protein                                  319   3e-100   
gb|AES75793.2|  ATP-dependent zinc metalloprotease FTSH protein         312   1e-97    Medicago truncatula
ref|XP_003619575.1|  Cell division protease ftsH-like protein           311   1e-96    
ref|XP_003624038.1|  Cell division protease ftsH-like protein           308   3e-96    
ref|XP_002981661.1|  hypothetical protein SELMODRAFT_115113             301   1e-92    
ref|XP_002967857.1|  hypothetical protein SELMODRAFT_169256             301   3e-92    
ref|XP_002980658.1|  hypothetical protein SELMODRAFT_233533             275   8e-86    
ref|XP_002984562.1|  hypothetical protein SELMODRAFT_234574             275   9e-86    
ref|XP_005651157.1|  ATP-dependent metallopeptidase Hfl                 275   5e-83    Coccomyxa subellipsoidea C-169
ref|XP_002505472.1|  predicted protein                                  269   4e-81    Micromonas commoda
dbj|BAF01982.1|  hypothetical protein                                   253   1e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001422694.1|  predicted protein                                  261   3e-80    Ostreococcus lucimarinus CCE9901
gb|KEH16019.1|  ATP-dependent zinc metalloprotease FTSH protein         260   5e-79    Medicago truncatula
ref|XP_003082962.1|  FtsH protease, putative (ISS)                      265   2e-78    Ostreococcus tauri
ref|XP_007509883.1|  predicted protein                                  263   4e-77    Bathycoccus prasinos
ref|XP_005850885.1|  hypothetical protein CHLNCDRAFT_140544             260   5e-77    Chlorella variabilis
ref|XP_006845231.1|  hypothetical protein AMTR_s00005p00257390          254   6e-77    
ref|XP_011400128.1|  ATP-dependent zinc metalloprotease FTSH 10, ...    263   1e-76    Auxenochlorella protothecoides
ref|XP_003059742.1|  predicted protein                                  253   2e-75    Micromonas pusilla CCMP1545
ref|XP_003631103.1|  Cell division protease ftsH-like protein           246   4e-75    
gb|ABR26136.1|  osftsh8 - oryza sativa ftsh protease, homologue o...    227   5e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_001689949.1|  membrane AAA-metalloprotease                       240   1e-69    Chlamydomonas reinhardtii
emb|CBI30537.3|  unnamed protein product                                226   4e-69    Vitis vinifera
gb|KHG19679.1|  ATP-dependent zinc metalloprotease FTSH 8, mitoch...    226   4e-67    Gossypium arboreum [tree cotton]
ref|WP_041883641.1|  peptidase M41                                      231   1e-66    Pedobacter lusitanus
ref|XP_002410299.1|  ATPase, putative                                   223   2e-66    Ixodes scapularis [blacklegged tick]
ref|XP_002741203.1|  PREDICTED: AFG3-like protein 2                     227   3e-66    Saccoglossus kowalevskii
ref|WP_026897433.1|  peptidase M41                                      229   4e-66    Pedobacter oryzae
ref|XP_638674.1|  peptidase M41, FtsH domain-containing protein         230   8e-66    Dictyostelium discoideum AX4
ref|XP_003292084.1|  hypothetical protein DICPUDRAFT_39991              225   8e-66    Dictyostelium purpureum
dbj|GAM28243.1|  hypothetical protein SAMD00019534_114190               230   1e-65    Acytostelium subglobosum LB1
ref|WP_037443193.1|  peptidase M41                                      228   1e-65    Pedobacter antarcticus
ref|WP_037533932.1|  peptidase M41                                      228   2e-65    Sphingobacterium thalpophilum
ref|WP_013664355.1|  peptidase M41                                      228   2e-65    Sphingobacterium sp. 21
ref|WP_008241678.1|  peptidase M41                                      227   4e-65    Pedobacter sp. BAL39
ref|WP_039053642.1|  peptidase M41                                      226   7e-65    
gb|EIE80123.1|  hypothetical protein RO3G_04828                         225   8e-65    Rhizopus delemar RA 99-880
ref|WP_012780210.1|  peptidase M41                                      226   1e-64    Pedobacter heparinus
ref|WP_014682322.1|  peptidase M41                                      226   1e-64    Solitalea canadensis
gb|EQB80316.1|  hypothetical protein L950_08340                         224   1e-64    
ref|XP_003979383.1|  PREDICTED: AFG3-like protein 2-like                217   2e-64    
gb|EFA84387.1|  peptidase M41                                           226   3e-64    Heterostelium album PN500
ref|WP_040539886.1|  peptidase M41                                      224   3e-64    Pedobacter arcticus
ref|WP_009033571.1|  peptidase M41                                      224   3e-64    Indibacter alkaliphilus
ref|WP_021069372.1|  peptidase M41                                      224   3e-64    Sphingobacterium paucimobilis
gb|ESA05195.1|  hypothetical protein GLOINDRAFT_66340                   223   4e-64    
gb|EGI59447.1|  AFG3-like protein 2                                     224   4e-64    Acromyrmex echinatior
ref|WP_037497088.1|  peptidase M41                                      224   6e-64    Sphingobacterium deserti
ref|WP_010600005.1|  peptidase M41                                      224   6e-64    Pedobacter
gb|ETZ19316.1|  peptidase M41                                           224   6e-64    Pedobacter sp. V48
ref|XP_004362632.1|  peptidase M41                                      228   6e-64    Cavenderia fasciculata
ref|XP_009698917.1|  PREDICTED: AFG3-like protein 2                     213   7e-64    Cariama cristata
gb|EXX70583.1|  m-AAA protease subunit YTA12                            225   8e-64    Rhizophagus irregularis DAOM 197198w
ref|XP_001744500.1|  hypothetical protein                               222   8e-64    Monosiga brevicollis MX1
ref|WP_037460377.1|  peptidase M41                                      223   9e-64    
ref|WP_039990218.1|  peptidase M41                                      223   9e-64    
emb|CEJ01398.1|  Putative Cell division protease ftsH                   224   1e-63    Rhizopus microsporus
gb|EFK59817.1|  ATP-dependent metallopeptidase HflB                     223   1e-63    Sphingobacterium spiritivorum ATCC 33861
ref|XP_011064066.1|  PREDICTED: AFG3-like protein 2 isoform X1          224   1e-63    Acromyrmex echinatior
gb|EEI91234.1|  ATP-dependent metallopeptidase HflB                     223   2e-63    Sphingobacterium spiritivorum ATCC 33300
ref|XP_011064067.1|  PREDICTED: AFG3-like protein 2 isoform X2          224   2e-63    Acromyrmex echinatior
gb|EFN79635.1|  AFG3-like protein 2                                     216   2e-63    Harpegnathos saltator
ref|WP_028295325.1|  peptidase M41                                      222   3e-63    Olivibacter sitiensis
ref|WP_026968576.1|  peptidase M41                                      222   3e-63    Algoriphagus terrigena
ref|WP_009053651.1|  peptidase M41                                      221   3e-63    Nitritalea halalkaliphila
emb|CEI94349.1|  Putative AFG3 family protein                           223   4e-63    Rhizopus microsporus
ref|WP_026902710.1|  peptidase M41                                      221   4e-63    Pedobacter glucosidilyticus
ref|WP_038701774.1|  peptidase M41                                      221   4e-63    Sphingobacterium sp. ML3W
emb|CDT09988.1|  ATP-dependent zinc metalloprotease FtsH                221   4e-63    Sphingobacterium sp. PM2-P1-29
ref|WP_019597947.1|  peptidase M41                                      221   4e-63    Rhodonellum
ref|WP_033563684.1|  peptidase M41                                      221   4e-63    Sphingobacteriaceae bacterium DW12
ref|WP_036676326.1|  peptidase M41                                      221   5e-63    Pedobacter sp. R20-19
emb|CEG68111.1|  Putative Cell division protease ftsH                   222   5e-63    Rhizopus microsporus
gb|AFM03376.1|  membrane protease FtsH catalytic subunit                221   6e-63    Bernardetia litoralis DSM 6794
emb|CEG68110.1|  Putative YALI0A10615p                                  222   7e-63    Rhizopus microsporus
ref|WP_039450881.1|  peptidase M41                                      221   7e-63    Pedobacter glucosidilyticus
ref|XP_003737319.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    220   8e-63    
ref|XP_783782.2|  PREDICTED: AFG3-like protein 2                        222   9e-63    Strongylocentrotus purpuratus [purple urchin]
ref|WP_026951332.1|  peptidase M41                                      220   1e-62    Algoriphagus mannitolivorans
ref|XP_005816528.1|  PREDICTED: AFG3-like protein 1-like                219   1e-62    
ref|WP_041264331.1|  peptidase M41                                      219   2e-62    
ref|WP_009186129.1|  peptidase M41                                      219   2e-62    Cecembia lonarensis
ref|WP_020892866.1|  Cell division protein FtsH                         219   3e-62    Cyclobacterium qasimii
ref|XP_011254538.1|  PREDICTED: AFG3-like protein 2 isoform X2          220   3e-62    
ref|WP_026999681.1|  peptidase M41                                      219   4e-62    Eisenibacter elegans
ref|XP_011254537.1|  PREDICTED: AFG3-like protein 2 isoform X1          220   4e-62    Camponotus floridanus
ref|WP_014021491.1|  peptidase M41                                      218   5e-62    Cyclobacterium marinum
gb|EMS32972.1|  Cell division protein FtsH                              219   5e-62    Mariniradius saccharolyticus AK6
ref|WP_017733337.1|  hypothetical protein                               218   5e-62    Nafulsella turpanensis
ref|WP_040480273.1|  peptidase M41                                      218   5e-62    
ref|WP_009578256.1|  Cell division protein FtsH                         218   6e-62    Fulvivirga imtechensis
ref|WP_039137089.1|  ATPase AAA                                         218   6e-62    
ref|WP_014221908.1|  peptidase M41                                      218   6e-62    Niastella koreensis
ref|WP_044224255.1|  peptidase M41                                      218   8e-62    Flammeovirga pacifica
ref|WP_039133743.1|  ATPase AAA                                         218   8e-62    
emb|CEI95939.1|  Putative Mitochondrial inner membrane AAA protea...    218   8e-62    Rhizopus microsporus
emb|CDS03562.1|  hypothetical protein LRAMOSA00964                      218   9e-62    Lichtheimia ramosa
gb|EFX85159.1|  hypothetical protein DAPPUDRAFT_194014                  217   1e-61    Daphnia pulex
ref|XP_006612551.1|  PREDICTED: AFG3-like protein 2-like                219   1e-61    Apis dorsata [rock honeybee]
gb|KFO11702.1|  AFG3-like 2                                             212   1e-61    Balearica regulorum gibbericeps
ref|XP_010302509.1|  PREDICTED: AFG3-like protein 2                     212   1e-61    Balearica regulorum gibbericeps
dbj|GAN02747.1|  ATP-dependent metallopeptidase Hfl                     218   1e-61    Mucor ambiguus
emb|CEI89004.1|  Putative Matrix AAA protease MAP-1                     217   2e-61    Rhizopus microsporus
gb|ETO15947.1|  hypothetical protein RFI_21410                          219   2e-61    Reticulomyxa filosa
ref|XP_624548.2|  PREDICTED: AFG3-like protein 2-like                   218   2e-61    Apis mellifera [bee]
emb|CEG69908.1|  Putative Mitochondrial inner membrane AAA protea...    218   2e-61    Rhizopus microsporus
ref|XP_005946781.1|  PREDICTED: AFG3-like protein 1-like                218   2e-61    Haplochromis burtoni
ref|XP_011160232.1|  PREDICTED: AFG3-like protein 2 isoform X2          218   2e-61    Solenopsis invicta [imported red fire ant]
ref|XP_003693602.1|  PREDICTED: AFG3-like protein 2-like                218   2e-61    Apis florea [dwarf honeybee]
ref|XP_005748823.1|  PREDICTED: AFG3-like protein 1-like                218   2e-61    Pundamilia nyererei
ref|XP_011160223.1|  PREDICTED: AFG3-like protein 2 isoform X1          218   2e-61    Solenopsis invicta [imported red fire ant]
ref|XP_004566226.1|  PREDICTED: AFG3-like protein 1-like                218   2e-61    Maylandia zebra
ref|WP_044213238.1|  peptidase M41                                      216   3e-61    Flammeovirga sp. OC4
gb|KHJ47643.1|  ATP-dependent metallopeptidase HflB                     217   3e-61    Trichuris suis
gb|ERL87558.1|  hypothetical protein D910_04949                         212   3e-61    
ref|XP_010637318.1|  PREDICTED: AFG3-like protein 2 isoform X2          214   3e-61    
ref|XP_004989050.1|  AFG3-like protein 2                                218   3e-61    
ref|XP_006807100.1|  PREDICTED: AFG3-like protein 2-like                214   3e-61    
ref|XP_006805466.1|  PREDICTED: AFG3-like protein 1-like                216   3e-61    
ref|XP_010223803.1|  PREDICTED: AFG3-like protein 2                     217   4e-61    
gb|EGW00718.1|  AFG3-like protein 2                                     213   4e-61    
ref|XP_001956786.1|  GF24400                                            217   5e-61    
ref|XP_001632616.1|  predicted protein                                  215   5e-61    
ref|XP_003439591.1|  PREDICTED: AFG3-like protein 1-like                217   5e-61    
gb|KGL73505.1|  AFG3-like 2                                             217   5e-61    
ref|XP_011407709.1|  PREDICTED: AFG3-like protein 2                     213   5e-61    
ref|XP_011502504.1|  PREDICTED: AFG3-like protein 2                     217   6e-61    
ref|XP_007568550.1|  PREDICTED: AFG3-like protein 1                     216   6e-61    
ref|XP_006641297.1|  PREDICTED: AFG3-like protein 1-like                216   6e-61    
ref|XP_004656566.1|  PREDICTED: AFG3-like protein 2                     217   7e-61    
ref|WP_026945354.1|  peptidase M41                                      216   7e-61    
gb|EIE90722.1|  hypothetical protein RO3G_15433                         217   7e-61    
ref|XP_010290553.1|  PREDICTED: AFG3-like protein 2                     211   7e-61    
ref|XP_010747102.1|  PREDICTED: AFG3-like protein 1 isoform X1          216   7e-61    
ref|XP_010747103.1|  PREDICTED: AFG3-like protein 1 isoform X2          216   7e-61    
ref|NP_001072759.1|  AFG3-like AAA ATPase 2                             216   7e-61    
gb|KFQ80092.1|  AFG3-like 2                                             211   7e-61    
gb|KDR07700.1|  AFG3-like protein 2                                     216   7e-61    
ref|XP_005946480.1|  PREDICTED: AFG3-like protein 2-like isoform X3     216   8e-61    
ref|XP_011146865.1|  PREDICTED: AFG3-like protein 2                     216   8e-61    
ref|XP_004853318.1|  PREDICTED: AFG3-like protein 2 isoform X2          214   9e-61    
ref|XP_005282733.1|  PREDICTED: AFG3-like protein 2 isoform X1          216   9e-61    
ref|XP_005946478.1|  PREDICTED: AFG3-like protein 2-like isoform X1     216   9e-61    
ref|XP_005946479.1|  PREDICTED: AFG3-like protein 2-like isoform X2     216   9e-61    
ref|XP_008162617.1|  PREDICTED: AFG3-like protein 2 isoform X2          216   9e-61    
ref|WP_024284970.1|  peptidase M41                                      215   1e-60    
ref|WP_013453965.1|  peptidase M41                                      215   1e-60    
gb|EPB90189.1|  AFG3 family protein                                     215   1e-60    
ref|XP_008408894.1|  PREDICTED: AFG3-like protein 1 isoform X1          216   1e-60    
ref|XP_002030868.1|  GM24348                                            216   1e-60    
ref|XP_011484595.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    216   1e-60    
ref|WP_028787176.1|  ATPase AAA                                         214   1e-60    
ref|NP_730250.1|  CG6512, isoform B                                     214   1e-60    
ref|XP_002681483.1|  aaa ATPase family protein                          216   1e-60    
ref|WP_037327565.1|  ATPase AAA                                         214   1e-60    
ref|WP_015027481.1|  peptidase M41                                      214   2e-60    
gb|AAC27764.1|  RcaA                                                    206   2e-60    
emb|CDS12867.1|  hypothetical protein LRAMOSA05051                      215   2e-60    
ref|XP_002085240.1|  GD12422                                            215   2e-60    
ref|XP_006675531.1|  hypothetical protein BATDEDRAFT_22321              215   2e-60    
gb|KFH71888.1|  AFG3 family protein                                     215   2e-60    
ref|XP_003707659.1|  PREDICTED: AFG3-like protein 2-like                215   2e-60    
ref|XP_005706412.1|  AAA-type ATPase                                    215   2e-60    
ref|XP_008049841.1|  PREDICTED: AFG3-like protein 2                     213   2e-60    
ref|XP_005476933.1|  PREDICTED: AFG3-like protein 2 isoform X4          215   2e-60    
ref|WP_009195895.1|  ATP-dependent zinc metalloprotease FtsH            214   3e-60    
ref|WP_016195314.1|  Cell division protein FtsH                         214   3e-60    
ref|XP_005476931.1|  PREDICTED: AFG3-like protein 2 isoform X2          215   3e-60    
ref|XP_005476932.1|  PREDICTED: AFG3-like protein 2 isoform X3          215   3e-60    
ref|WP_026954726.1|  peptidase M41                                      214   3e-60    
ref|XP_005999264.1|  PREDICTED: AFG3-like protein 1-like                214   3e-60    
ref|WP_013408509.1|  peptidase M41                                      213   3e-60    
ref|WP_035465307.1|  ATPase AAA                                         213   3e-60    
ref|WP_002694247.1|  peptidase M41                                      214   3e-60    
ref|NP_730248.2|  CG6512, isoform A                                     215   3e-60    
ref|XP_003458166.1|  PREDICTED: AFG3-like protein 2 isoform X1          215   3e-60    
gb|EHJ64116.1|  hypothetical protein KGM_08960                          209   3e-60    
gb|AIE43895.1|  WRKY transcription factor 38                            215   3e-60    
ref|XP_005752595.1|  PREDICTED: AFG3-like protein 2-like                214   3e-60    
ref|XP_010637317.1|  PREDICTED: AFG3-like protein 2 isoform X1          214   3e-60    
ref|XP_004572477.1|  PREDICTED: AFG3-like protein 2-like                214   3e-60    
ref|XP_005476934.1|  PREDICTED: AFG3-like protein 2 isoform X5          214   3e-60    
ref|WP_012927540.1|  peptidase M41                                      213   4e-60    
ref|XP_008299957.1|  PREDICTED: AFG3-like protein 2                     214   4e-60    
ref|NP_001104667.1|  AFG3-like protein 2                                214   4e-60    
gb|KFP46134.1|  AFG3-like 2                                             211   4e-60    
ref|XP_007062432.1|  PREDICTED: AFG3-like protein 2                     214   4e-60    
ref|XP_008191461.1|  PREDICTED: AFG3-like protein 2                     214   4e-60    
ref|WP_015266230.1|  ATP-dependent metalloprotease FtsH                 213   4e-60    
ref|XP_006117557.1|  PREDICTED: AFG3-like protein 2 isoform X2          214   4e-60    
ref|XP_006117556.1|  PREDICTED: AFG3-like protein 2 isoform X1          214   4e-60    
gb|KFQ87123.1|  AFG3-like 2                                             211   4e-60    
ref|XP_010081449.1|  PREDICTED: AFG3-like protein 2                     211   5e-60    
ref|XP_011245300.1|  PREDICTED: AFG3-like protein 2 isoform X1          214   5e-60    
ref|XP_009960252.1|  PREDICTED: AFG3-like protein 2                     214   5e-60    
gb|KFO26923.1|  AFG3-like protein 2                                     214   5e-60    
gb|EFZ22674.1|  hypothetical protein SINV_06415                         214   5e-60    
ref|XP_011300136.1|  PREDICTED: AFG3-like protein 2                     214   6e-60    
ref|XP_003487066.1|  PREDICTED: AFG3-like protein 2-like                214   6e-60    
gb|EFB23538.1|  hypothetical protein PANDA_019250                       214   6e-60    
gb|KFQ05568.1|  AFG3-like 2                                             214   6e-60    
ref|XP_003396802.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    214   6e-60    
ref|XP_008977688.1|  PREDICTED: AFG3-like protein 2 isoform X2          214   6e-60    
ref|WP_039751710.1|  peptidase M41                                      213   6e-60    
ref|XP_011337563.1|  PREDICTED: AFG3-like protein 2                     214   6e-60    
ref|WP_037360570.1|  ATPase AAA                                         213   6e-60    
gb|EDM14729.1|  AFG3(ATPase family gene 3)-like 2 (yeast)               213   6e-60    
ref|WP_013928835.1|  peptidase M41                                      213   7e-60    
ref|XP_009061516.1|  hypothetical protein LOTGIDRAFT_127065             212   7e-60    
ref|WP_035076980.1|  peptidase M41                                      213   7e-60    
ref|XP_011235404.1|  PREDICTED: AFG3-like protein 2                     214   7e-60    
ref|XP_007244085.1|  PREDICTED: AFG3-like protein 1-like                213   7e-60    
ref|XP_006763325.1|  PREDICTED: AFG3-like protein 2 isoform X2          213   8e-60    
ref|XP_003924961.2|  PREDICTED: AFG3-like protein 2 isoform X2          213   8e-60    
ref|XP_005866972.1|  PREDICTED: AFG3-like protein 2 isoform X3          213   9e-60    
ref|XP_010374004.1|  PREDICTED: AFG3-like protein 2                     213   9e-60    
ref|XP_005866971.1|  PREDICTED: AFG3-like protein 2 isoform X2          213   9e-60    
gb|EDL09647.1|  mCG127904                                               213   9e-60    
gb|ELK30619.1|  AFG3-like protein 2                                     213   9e-60    
ref|XP_007643641.1|  PREDICTED: AFG3-like protein 2 isoform X1          212   9e-60    
emb|CAB48398.1|  paraplegin-like protein                                213   9e-60    
ref|XP_007109863.1|  PREDICTED: AFG3-like protein 2                     213   1e-59    
gb|EPQ08204.1|  AFG3-like protein 2                                     213   1e-59    
ref|XP_005100797.1|  PREDICTED: AFG3-like protein 2-like                213   1e-59    
ref|XP_005866970.1|  PREDICTED: AFG3-like protein 2 isoform X1          213   1e-59    
dbj|GAN09644.1|  ATP-dependent metallopeptidase Hfl                     213   1e-59    
ref|XP_002757077.1|  PREDICTED: AFG3-like protein 2 isoform X1          213   1e-59    
gb|KFO81406.1|  AFG3-like 2                                             213   1e-59    
ref|XP_006763324.1|  PREDICTED: AFG3-like protein 2 isoform X1          213   1e-59    
ref|XP_005074768.1|  PREDICTED: AFG3-like protein 2                     211   1e-59    
ref|XP_006008879.1|  PREDICTED: AFG3-like protein 2 isoform X2          213   1e-59    
ref|NP_001128336.1|  AFG3-like protein 2                                213   1e-59    
ref|XP_009566314.1|  PREDICTED: AFG3-like protein 2                     213   1e-59    
emb|CDS28120.1|  afg3 protein 2                                         213   1e-59    
ref|XP_006008878.1|  PREDICTED: AFG3-like protein 2 isoform X1          213   1e-59    
ref|WP_022829689.1|  peptidase M41                                      212   1e-59    
gb|EWM24473.1|  Peptidase, FtsH                                         207   1e-59    
ref|XP_003590119.1|  Cell division protease ftsH-like protein           208   1e-59    
ref|XP_003383809.1|  PREDICTED: AFG3-like protein 2                     212   1e-59    
ref|XP_010333888.1|  PREDICTED: AFG3-like protein 2 isoform X1          213   2e-59    
ref|XP_008286028.1|  PREDICTED: AFG3-like protein 1                     213   2e-59    
ref|WP_018473204.1|  peptidase M41                                      211   2e-59    
gb|EAX01551.1|  AFG3 ATPase family gene 3-like 2 (yeast), isoform...    212   2e-59    
gb|EHB14938.1|  AFG3-like protein 2                                     213   2e-59    
ref|XP_008157913.1|  PREDICTED: AFG3-like protein 2                     213   2e-59    
ref|NP_081406.1|  AFG3-like protein 2                                   213   2e-59    
ref|XP_008580361.1|  PREDICTED: AFG3-like protein 2                     213   2e-59    
gb|EHH29159.1|  AFG3-like protein 2                                     212   2e-59    
dbj|BAE29204.1|  unnamed protein product                                213   2e-59    
ref|XP_004684027.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
ref|XP_006269795.1|  PREDICTED: AFG3-like protein 2 isoform X2          212   2e-59    
ref|XP_006089365.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    213   2e-59    
ref|WP_033411345.1|  ATPase AAA                                         211   2e-59    
ref|XP_011286260.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
ref|XP_006868771.1|  PREDICTED: AFG3-like protein 2-like                213   2e-59    
ref|XP_007427904.1|  PREDICTED: AFG3-like protein 2                     213   2e-59    
ref|XP_007085973.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
ref|XP_007236622.1|  PREDICTED: AFG3-like protein 2-like                213   2e-59    
gb|KFQ35154.1|  AFG3-like 2                                             212   2e-59    
ref|XP_008700356.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
gb|KFO56363.1|  AFG3-like 2                                             212   2e-59    
gb|EPZ30859.1|  ATPase, AAA-type domain-containing protein              210   2e-59    
ref|XP_007633119.1|  PREDICTED: AFG3-like protein 2 isoform X2          212   2e-59    
emb|CDS05549.1|  hypothetical protein LRAMOSA08077                      211   2e-59    
ref|XP_010182228.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
ref|XP_010394721.1|  PREDICTED: AFG3-like protein 2                     212   2e-59    
ref|XP_008212944.1|  PREDICTED: AFG3-like protein 2 isoform X2          212   2e-59    
ref|WP_037326393.1|  peptidase M41                                      210   3e-59    
gb|KFV62490.1|  AFG3-like 2                                             212   3e-59    
ref|XP_004581871.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
gb|AAH24282.1|  Similar to AFG3 ATPase family gene 3-like 2 (yeast)     212   3e-59    
ref|XP_003800531.1|  PREDICTED: AFG3-like protein 2                     213   3e-59    
ref|XP_004903784.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_010017023.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
gb|KGL96547.1|  AFG3-like 2                                             212   3e-59    
gb|KFQ53424.1|  AFG3-like 2                                             212   3e-59    
ref|XP_006269794.1|  PREDICTED: AFG3-like protein 2 isoform X1          212   3e-59    
ref|XP_009887391.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_003276764.2|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_004069425.1|  PREDICTED: AFG3-like protein 1                     212   3e-59    
ref|XP_002095038.1|  GE22168                                            212   3e-59    
ref|XP_005486772.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_004470052.1|  PREDICTED: AFG3-like protein 2-like                212   3e-59    
emb|CDJ84591.1|  Peptidase M41 and ATPase domain containing protein     212   3e-59    
ref|XP_010857367.1|  PREDICTED: AFG3-like protein 2 isoform X2          211   3e-59    
ref|XP_008628318.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
gb|KFO93388.1|  AFG3-like 2                                             212   3e-59    
ref|XP_011379633.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_005587286.1|  PREDICTED: AFG3-like protein 2 isoform X1          212   3e-59    
gb|ELK15046.1|  AFG3-like protein 2                                     212   3e-59    
ref|XP_001602382.2|  PREDICTED: AFG3-like protein 2 isoform X1          212   3e-59    
ref|XP_001094146.1|  PREDICTED: AFG3 ATPase family gene 3-like 2 ...    212   3e-59    
gb|EPB89883.1|  AFG3 family protein                                     211   3e-59    
ref|XP_005423417.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_010140308.1|  PREDICTED: AFG3-like protein 2                     212   3e-59    
ref|XP_004408531.1|  PREDICTED: AFG3-like protein 2                     212   4e-59    
ref|XP_001972966.1|  GG15828                                            212   4e-59    
ref|XP_009579883.1|  PREDICTED: AFG3-like protein 2                     211   4e-59    
ref|XP_010857368.1|  PREDICTED: AFG3-like protein 2 isoform X3          211   4e-59    
ref|XP_005334950.1|  PREDICTED: AFG3-like protein 2                     212   4e-59    
ref|XP_002828063.1|  PREDICTED: AFG3-like protein 2                     212   4e-59    
ref|XP_005969601.1|  PREDICTED: AFG3-like protein 2                     212   4e-59    
gb|KFV94066.1|  AFG3-like 2                                             210   4e-59    
ref|NP_006787.2|  AFG3-like protein 2                                   212   4e-59    
ref|WP_037369803.1|  ATPase AAA                                         210   4e-59    
ref|XP_005587287.1|  PREDICTED: AFG3-like protein 2 isoform X2          212   4e-59    
ref|XP_512199.2|  PREDICTED: AFG3-like protein 2                        212   4e-59    
ref|XP_010857366.1|  PREDICTED: AFG3-like protein 2 isoform X1          211   4e-59    
dbj|BAE30959.1|  unnamed protein product                                212   4e-59    
ref|XP_004421113.1|  PREDICTED: AFG3-like protein 2                     212   4e-59    
ref|XP_007463350.1|  PREDICTED: LOW QUALITY PROTEIN: AFG3-like pr...    212   4e-59    
ref|XP_002068945.1|  GK18042                                            212   4e-59    
ref|XP_009908243.1|  PREDICTED: AFG3-like protein 2                     211   4e-59    
gb|AAH71038.1|  LOC432063 protein                                       211   4e-59    
ref|XP_001653295.1|  AAEL008565-PA                                      211   4e-59    
gb|KFQ32176.1|  AFG3-like 2                                             211   4e-59    
ref|XP_008941181.1|  PREDICTED: AFG3-like protein 2                     211   4e-59    
ref|XP_008309809.1|  PREDICTED: AFG3-like protein 1                     211   4e-59    
ref|XP_009100191.1|  PREDICTED: AFG3-like protein 2                     211   4e-59    
gb|ELR58811.1|  AFG3-like protein 2                                     211   5e-59    
ref|XP_006970131.1|  PREDICTED: AFG3-like protein 2                     211   5e-59    
ref|XP_006036400.1|  PREDICTED: AFG3-like protein 2 isoform X2          211   5e-59    
gb|ENN79870.1|  hypothetical protein YQE_03689                          211   5e-59    
ref|WP_008507768.1|  peptidase M41                                      210   5e-59    
emb|CAF90270.1|  unnamed protein product                                211   5e-59    
ref|XP_002192269.2|  PREDICTED: AFG3-like protein 2                     211   5e-59    
ref|WP_037352617.1|  ATPase AAA                                         210   5e-59    
gb|KFV86938.1|  AFG3-like 2                                             211   5e-59    
gb|ERE86162.1|  AFG3-like protein 2                                     211   5e-59    
ref|XP_005514095.1|  PREDICTED: AFG3-like protein 2                     211   5e-59    
ref|XP_003967322.1|  PREDICTED: AFG3-like protein 2-like                210   6e-59    
ref|XP_006164216.1|  PREDICTED: AFG3-like protein 2                     211   6e-59    
ref|XP_009644519.1|  PREDICTED: AFG3-like protein 2                     211   6e-59    
ref|XP_004939779.1|  PREDICTED: AFG3-like protein 2 isoform X5          211   6e-59    
ref|XP_004939780.1|  PREDICTED: AFG3-like protein 2 isoform X6          211   6e-59    



>emb|CDP06599.1| unnamed protein product [Coffea canephora]
Length=823

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 192/229 (84%), Positives = 209/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  594  RQTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  654  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMSK  713

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVREW++KAYE T+QLIEEHK+HVAQIAELLLEK VLH  DLVRVLGE
Sbjct  714  PYSSKTAAIIDNEVREWVSKAYERTIQLIEEHKDHVAQIAELLLEKEVLHHGDLVRVLGE  773

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK+GF+ED +   KD+ E KS +DD S PL P+VVP
Sbjct  774  RPFKSSEPTNYDRFKEGFIEDDKEVVKDSPEGKSVQDDSSPPLDPDVVP  822



>ref|XP_007026989.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
 gb|EOY07491.1| Cell division protease ftsH isoform 1 [Theobroma cacao]
Length=817

 Score =   403 bits (1035),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/229 (85%), Positives = 209/229 (91%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++A EM+K
Sbjct  649  MTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDALEMTK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  709  PYSSKTGAIIDSEVREWVGKAYERTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK SEPTNYDRFK GF E+ + E+KDT E+K+  DD S+PL+PEVVP
Sbjct  769  RPFKPSEPTNYDRFKRGFQEENK-ESKDTTESKTVGDDGSAPLEPEVVP  816



>ref|XP_009772661.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=820

 Score =   400 bits (1027),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 211/230 (92%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  652  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMSK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW++KAYE TVQLIEEHKEHVA+IAELLLEK VLHQEDLVRVLGE
Sbjct  712  PYSSKTAAIIDSEVREWVSKAYERTVQLIEEHKEHVAKIAELLLEKEVLHQEDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPFKS EPTNYDRFK GF E++  E K+  ENK+ +D  SSP++PEVVPV
Sbjct  772  RPFKSLEPTNYDRFKQGF-EEENKETKNNPENKTVEDKGSSPVEPEVVPV  820



>gb|KJB16964.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=817

 Score =   398 bits (1022),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 190/229 (83%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEM+K
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  708  PYSSKTGAIIDSEVREWVGKAYNRTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E+ ++    + E+K+  D+ S+PL+PEVVP
Sbjct  768  RPFKSSEPTNYDRFKKGFQEEDKSSKDTSTESKTVDDNGSTPLEPEVVP  816



>ref|XP_009598017.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=821

 Score =   397 bits (1021),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 194/231 (84%), Positives = 212/231 (92%), Gaps = 2/231 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  592  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  652  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMSK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW++KAYE TVQLIEEHKEHVA+IAELLLEK VLHQEDLVRVLGE
Sbjct  712  PYSSKTAAIIDSEVREWVSKAYERTVQLIEEHKEHVAKIAELLLEKEVLHQEDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD-DSSPLQPEVVPV  95
            RPFKS EPTNYDRFK GF E++  E K+  ENK+ +D+  SSP++PEVVPV
Sbjct  772  RPFKSLEPTNYDRFKQGF-EEENKETKNNPENKTVEDNGSSSPVEPEVVPV  821



>gb|KHG12964.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=817

 Score =   397 bits (1020),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 189/229 (83%), Positives = 208/229 (91%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEM+K
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  708  PYSSKTGAIIDSEVREWVGKAYDRTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+EPTNYDRFK GF E+ +     + E+K+  D+ S+PL+PEVVP
Sbjct  768  RPFKSTEPTNYDRFKKGFQEEDKASKDTSTESKTVDDNGSTPLEPEVVP  816



>gb|KDO51173.1| hypothetical protein CISIN_1g005738mg [Citrus sinensis]
Length=680

 Score =   393 bits (1009),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 210/230 (91%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  451  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  510

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  511  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  570

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVAQIAE LLEK VLHQ+DLVRVLGE
Sbjct  571  PYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGE  630

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD-SSPLQPEVVP  98
            RPFK SEPTNYDRFK GF+ED + E+K+T E  + +DD+ SSPL+PEVVP
Sbjct  631  RPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAEDDNSSSPLEPEVVP  679



>gb|AFX67028.1| putative AAA-metalloprotease FtsH, partial [Solanum tuberosum]
Length=318

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  90   RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  149

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  150  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMSK  209

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW++KAYE TVQLIE+HKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  210  PYSSKTAAIIDTEVREWVSKAYERTVQLIEKHKEHVAQIAELLLEKEVLHQEDLVRVLGE  269

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            RPFKS EPTNYD FK GF E++  E KD  ENK+ +D+ S
Sbjct  270  RPFKSLEPTNYDIFKQGF-EEENKERKDNPENKTVEDNGS  308



>ref|XP_006480880.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480881.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=818

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 210/230 (91%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  649  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVAQIAE LLEK VLHQ+DLVRVLGE
Sbjct  709  PYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD-SSPLQPEVVP  98
            RPFK SEPTNYDRFK GF+ED + E+K+T E  + +DD+ SSPL+PEVVP
Sbjct  769  RPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAEDDNSSSPLEPEVVP  817



>ref|XP_010262544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=821

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 206/229 (90%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  654  MTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  713

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+K  AIIDNEVREW+AKAYE TVQLIEEHKE VAQIAELLLEK VLHQEDLVRVLGE
Sbjct  714  PYSSKMGAIIDNEVREWVAKAYERTVQLIEEHKEQVAQIAELLLEKEVLHQEDLVRVLGE  773

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS EPTNYDRFK GF ED+++  + T E  S + D SSPL+P+VVP
Sbjct  774  RPFKSIEPTNYDRFKQGFQEDEKS--RQTTEVGSVEGDRSSPLEPDVVP  820



>ref|XP_006429118.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
 gb|ESR42358.1| hypothetical protein CICLE_v10011087mg [Citrus clementina]
Length=818

 Score =   394 bits (1012),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 210/230 (91%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  649  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIIDNEVREW+ KAY+ TV+LIEEH+EHVAQIAE LLEK VLHQ+DLVRVLGE
Sbjct  709  PYSSKTGAIIDNEVREWVGKAYDHTVKLIEEHREHVAQIAEELLEKEVLHQDDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD-SSPLQPEVVP  98
            RPFK SEPTNYDRFK GF+ED + E+K+T E  + +DD+ SSPL+PEVVP
Sbjct  769  RPFKHSEPTNYDRFKKGFLED-DKESKETKEGGTAEDDNSSSPLEPEVVP  817



>ref|XP_010256889.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nelumbo nucifera]
Length=820

 Score =   393 bits (1010),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 192/231 (83%), Positives = 207/231 (90%), Gaps = 5/231 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  652  MTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            P+S+KT AIIDNEVREW+AKAYE TV LIEEHKE VAQIAE+LLEK VLHQEDLVR+LGE
Sbjct  712  PFSSKTGAIIDNEVREWVAKAYERTVNLIEEHKEQVAQIAEVLLEKEVLHQEDLVRILGE  771

Query  244  RPFKSSEPTNYDRFKDGF--VEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+EPTNYDRFK+GF  V++K  EA D     +  DD SSPL+PEVVP
Sbjct  772  RPFKSAEPTNYDRFKEGFREVDEKSREATDVG---TMGDDGSSPLEPEVVP  819



>ref|XP_002323508.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
 gb|EEF05269.2| hypothetical protein POPTR_0016s10620g [Populus trichocarpa]
Length=814

 Score =   392 bits (1008),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 208/229 (91%), Gaps = 4/229 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEMSK
Sbjct  649  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMSK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  709  PYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVAQIAELLLEKEVLHQDDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYDRFK GF +D     K+TA+ ++  DD SSP++P+VVP
Sbjct  769  RPFKTSEPTNYDRFKQGFEQDD----KETAKGETFDDDGSSPIEPQVVP  813



>gb|KDP35648.1| hypothetical protein JCGZ_09086 [Jatropha curcas]
Length=828

 Score =   392 bits (1008),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 211/229 (92%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  600  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  659

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEM+K
Sbjct  660  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDMFEMTK  719

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+AKAY+ T+QLIEEHK+HVA+IAELLLEK VLHQ+DLVRVLGE
Sbjct  720  PYSSKTGAIIDSEVREWVAKAYDRTIQLIEEHKDHVAEIAELLLEKEVLHQDDLVRVLGE  779

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYD+FK+GF +D++ E+K+T +N +  DD S+PL P+VVP
Sbjct  780  RPFKSSEPTNYDKFKEGF-QDEDKESKETTKNGTVVDDGSAPLDPQVVP  827



>ref|XP_011007151.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Populus euphratica]
Length=709

 Score =   389 bits (998),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 207/229 (90%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  483  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  542

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEMSK
Sbjct  543  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMSK  602

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  603  PYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVAQIAELLLEKEVLHQDDLVRVLGE  662

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYDRFK GF +D +  A   A+ ++  DD SSP++P+VVP
Sbjct  663  RPFKTSEPTNYDRFKQGFEQDDKEAA---AKGETFDDDGSSPMEPQVVP  708



>ref|XP_008464106.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Cucumis melo]
Length=818

 Score =   392 bits (1006),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/229 (83%), Positives = 208/229 (91%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV+G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E++FEMSK
Sbjct  650  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPREDSFEMSK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAYE TV+LIEEHKE VAQIAELLLEK VLHQEDLVRVLGE
Sbjct  710  PYSSKTAAIIDSEVREWVGKAYERTVKLIEEHKEQVAQIAELLLEKEVLHQEDLVRVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK SE TNYDRFK GFVE  E ++ +T   ++  DD SSPL+P+VVP
Sbjct  770  RPFKPSEVTNYDRFKQGFVEADE-KSVETPPVEAADDDGSSPLEPQVVP  817



>gb|KJB55847.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=785

 Score =   389 bits (1000),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 205/230 (89%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAV+G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  556  RKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  615

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  616  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPLREDGFEMSK  675

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAYE TVQLIEEHKE VAQIAELLLEK VLHQEDLVRVLGE
Sbjct  676  PYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVAQIAELLLEKEVLHQEDLVRVLGE  735

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS-PLQPEVVP  98
            RPFKSSE TNYDRFK GF ED+ET++  T E     DD S+ PL P+VVP
Sbjct  736  RPFKSSELTNYDRFKQGF-EDEETKSMQTPEGGIADDDGSAPPLVPQVVP  784



>ref|XP_011007150.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Populus euphratica]
Length=815

 Score =   390 bits (1001),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 207/229 (90%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEMSK
Sbjct  649  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMSK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++T AIID+EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  709  PYSSETGAIIDSEVREWVGKAYDSTVKLIEEHKEQVAQIAELLLEKEVLHQDDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYDRFK GF +D +  A   A+ ++  DD SSP++P+VVP
Sbjct  769  RPFKTSEPTNYDRFKQGFEQDDKEAA---AKGETFDDDGSSPMEPQVVP  814



>gb|KJB55846.1| hypothetical protein B456_009G097900 [Gossypium raimondii]
Length=816

 Score =   389 bits (1000),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 194/230 (84%), Positives = 205/230 (89%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAV+G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  587  RKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  647  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPLREDGFEMSK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAYE TVQLIEEHKE VAQIAELLLEK VLHQEDLVRVLGE
Sbjct  707  PYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVAQIAELLLEKEVLHQEDLVRVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS-PLQPEVVP  98
            RPFKSSE TNYDRFK GF ED+ET++  T E     DD S+ PL P+VVP
Sbjct  767  RPFKSSELTNYDRFKQGF-EDEETKSMQTPEGGIADDDGSAPPLVPQVVP  815



>ref|XP_011094876.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Sesamum indicum]
Length=815

 Score =   389 bits (999),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 190/229 (83%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDM C
Sbjct  587  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMIC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTK+TY QVAVYGFS+KVGLLSFP  E  FEMSK
Sbjct  647  MTLGGRAAEQVLLGKISTGAQNDLEKVTKLTYDQVAVYGFSEKVGLLSFPQREQGFEMSK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVREW  KAY  TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  707  PYSSKTAAIIDNEVREWTGKAYTRTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GFVE+KE E     +  +++DD SS L+P VVP
Sbjct  767  RPFKSSEPTNYDRFKQGFVENKE-ETTSIPKGNNSEDDRSSSLEPHVVP  814



>ref|XP_011094875.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Sesamum indicum]
Length=817

 Score =   389 bits (999),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/229 (83%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDM C
Sbjct  589  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMIC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTK+TY QVAVYGFS+KVGLLSFP  E  FEMSK
Sbjct  649  MTLGGRAAEQVLLGKISTGAQNDLEKVTKLTYDQVAVYGFSEKVGLLSFPQREQGFEMSK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVREW  KAY  TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  709  PYSSKTAAIIDNEVREWTGKAYTRTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GFVE+KE E     +  +++DD SS L+P VVP
Sbjct  769  RPFKSSEPTNYDRFKQGFVENKE-ETTSIPKGNNSEDDRSSSLEPHVVP  816



>gb|EYU41737.1| hypothetical protein MIMGU_mgv1a001461mg [Erythranthe guttata]
Length=815

 Score =   389 bits (998),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 189/234 (81%), Positives = 204/234 (87%), Gaps = 5/234 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  583  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  642

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEMSK
Sbjct  643  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKEDGFEMSK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW+ KAY  T+QLIEEHK+H++QIAELLLEK VLHQ+DLVRVLGE
Sbjct  703  PYSSKTAAIIDTEVREWVGKAYARTIQLIEEHKDHISQIAELLLEKEVLHQDDLVRVLGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTK----DDDSSPLQPEVVPV  95
            RPF SSEPTNYDRFK GF+ED   ++     N +TK    DD   PL PEVVPV
Sbjct  763  RPFTSSEPTNYDRFKKGFIEDDNGKSGSNG-NTTTKGKKIDDGPLPLAPEVVPV  815



>ref|XP_007208082.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
 gb|EMJ09281.1| hypothetical protein PRUPE_ppa001525mg [Prunus persica]
Length=808

 Score =   387 bits (994),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  580  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEM+K
Sbjct  640  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMAK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+AKAY  T++LIEEHKE V QIAELLLEK VLHQ+DLVRVLGE
Sbjct  700  PYSSKTGAIIDSEVREWVAKAYVRTIELIEEHKEQVGQIAELLLEKEVLHQDDLVRVLGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+EPTNYDRFK+GF E+ + E K+T E  +  D  S P+QP+VVP
Sbjct  760  RPFKSNEPTNYDRFKEGFQEE-DKEPKETTEGGNVDDGRSPPIQPDVVP  807



>ref|XP_009338598.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009338599.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   387 bits (994),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 206/228 (90%), Gaps = 5/228 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEM+K
Sbjct  650  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFEMTK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHV QIAELLLEK VLHQEDL+RVLGE
Sbjct  710  PYSSKTGAIIDSEVREWVGKAYFRTVQLIEEHKEHVGQIAELLLEKEVLHQEDLIRVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD  S P+QP+VV
Sbjct  770  RPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKDGRSPPIQPDVV  812



>ref|XP_009345397.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=815

 Score =   387 bits (994),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 206/228 (90%), Gaps = 5/228 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEM+K
Sbjct  650  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFEMTK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY  TVQLIEEHKEHV QIAELLLEK VLHQEDL+RVLGE
Sbjct  710  PYSSKTGAIIDSEVREWVGKAYFRTVQLIEEHKEHVGQIAELLLEKEVLHQEDLIRVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD  S P+QP+VV
Sbjct  770  RPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKDGRSPPIQPDVV  812



>gb|KHG20351.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial -like 
protein [Gossypium arboreum]
Length=816

 Score =   387 bits (993),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 193/230 (84%), Positives = 205/230 (89%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAV+G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  587  RKTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  647  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMSK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAYE TVQLIEEHKE VAQIAELLLEK VLHQEDLVRVLGE
Sbjct  707  PYSNKTGAIIDGEVREWVAKAYEKTVQLIEEHKEQVAQIAELLLEKEVLHQEDLVRVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS-PLQPEVVP  98
            RPFKSSE TNYDRFK GF E++ET++  T E     DD S+ PL P+VVP
Sbjct  767  RPFKSSELTNYDRFKLGF-EEEETKSMQTPEGGIADDDGSAPPLVPQVVP  815



>ref|XP_002530989.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
 gb|EEF31401.1| Mitochondrial respiratory chain complexes assembly protein AFG3, 
putative [Ricinus communis]
Length=833

 Score =   387 bits (994),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 207/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  605  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  664

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  665  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMSK  724

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY+ T+QL+EEHKEH+A+IAELLLEK VLHQEDL+RVLGE
Sbjct  725  PYSSKTGAIIDSEVREWVGKAYQRTLQLVEEHKEHIAEIAELLLEKEVLHQEDLIRVLGE  784

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK+GF ED + E+K+T +  +  DD S+ L+P+V P
Sbjct  785  RPFKSSEPTNYDRFKEGFQED-DKESKETTKGGTLDDDGSTTLEPQVAP  832



>ref|XP_008369915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=815

 Score =   386 bits (992),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/228 (83%), Positives = 205/228 (90%), Gaps = 5/228 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEM+K
Sbjct  650  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFEMTK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY  TVQLIEEHKEHV QIAELLLEK VLHQEDL+RVLGE
Sbjct  710  PYSSKTGAIIDXEVREWVGKAYFRTVQLIEEHKEHVGQIAELLLEKEVLHQEDLIRVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFKS+EPTNYDRFK+GF E+ + EAK+T    + KD  S P+QP+VV
Sbjct  770  RPFKSNEPTNYDRFKEGFQEE-DKEAKET----NAKDGRSPPIQPDVV  812



>ref|XP_004143122.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004163225.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 10, mitochondrial-like [Cucumis sativus]
 gb|KGN47136.1| hypothetical protein Csa_6G190270 [Cucumis sativus]
Length=818

 Score =   385 bits (990),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 207/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV+G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVSGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E++FEMSK
Sbjct  650  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPREDSFEMSK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQEDL+R+LGE
Sbjct  710  PYSSKTAAIIDSEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQEDLLRILGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK SE TNYDRFK GFVE  E   ++    ++ +D+ SSPL+P+VVP
Sbjct  770  RPFKPSEVTNYDRFKQGFVEADEKSVENPPV-EAAEDNGSSPLEPQVVP  817



>ref|XP_010106514.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
 gb|EXC10690.1| ATP-dependent zinc metalloprotease FTSH 10 [Morus notabilis]
Length=817

 Score =   384 bits (987),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEH+EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVVGWFLEHSEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM K
Sbjct  648  MTLGGRAAEQVILGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDTFEMIK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVREW+ KAYE TVQLIEEHKEHVAQIAELLLEK VLHQ+DL++VLGE
Sbjct  708  PYSSKTAAIIDNEVREWVGKAYERTVQLIEEHKEHVAQIAELLLEKEVLHQDDLLKVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E+ E   +    + S ++D SSPL P+VVP
Sbjct  768  RPFKSVEVTNYDRFKQGFQEEDEKPVEVPLNDASEEEDGSSPLDPQVVP  816



>ref|XP_008240759.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Prunus mume]
Length=816

 Score =   384 bits (985),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/229 (81%), Positives = 205/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++AFEM+K
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDAFEMAK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+AKAY  T++LIEEHK  V QIAELLLEK VLHQ+DLVRVLGE
Sbjct  708  PYSSKTGAIIDSEVREWVAKAYVRTIELIEEHKVQVGQIAELLLEKEVLHQDDLVRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+EPTNYDRFK+GF E+ + E K+T E  +  D  S P+QP+VVP
Sbjct  768  RPFKSNEPTNYDRFKEGFQEEGK-EPKETTEGGNVDDGRSPPIQPDVVP  815



>ref|XP_003537985.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   382 bits (982),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTA+LGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTASLGFAQYVPSENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRASEQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E+SK
Sbjct  642  MALGGRASEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEISK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVR+W+ KAYE TVQLI+EHKE VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  702  PYSSKTAAIIDNEVRDWVNKAYEHTVQLIKEHKEQVAQIAELLLEKEVLHQDDLLRVLGE  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK +EPTNYDRFK GF+E++E  A+ T +    K   SSPL+P+VVP
Sbjct  762  RPFKVTEPTNYDRFKQGFIEEEEKVAESTIDTPE-KGGGSSPLEPQVVP  809



>gb|KHN21936.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   382 bits (982),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 206/229 (90%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTA+LGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTASLGFAQYVPSENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRASEQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E+SK
Sbjct  642  MALGGRASEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEISK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIIDNEVR+W+ KAYE TVQLI+EHKE VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  702  PYSSKTAAIIDNEVRDWVNKAYEHTVQLIKEHKEQVAQIAELLLEKEVLHQDDLLRVLGE  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK +EPTNYDRFK GF+E++E  A+ T +    K   SSPL+P+VVP
Sbjct  762  RPFKVTEPTNYDRFKQGFIEEEEKVAESTIDTPE-KGGGSSPLEPQVVP  809



>gb|KDO72822.1| hypothetical protein CISIN_1g047690mg [Citrus sinensis]
Length=811

 Score =   382 bits (981),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 202/229 (88%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEMSK
Sbjct  645  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDTFEMSK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  705  PYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVAQIAELLLEKEVLHQDDLLRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK GF E++++ A        T DD SSPL+P+V P
Sbjct  765  RPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVDDGSSPLEPQVAP  810



>ref|XP_008777200.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Phoenix dactylifera]
Length=679

 Score =   378 bits (970),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 203/230 (88%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  449  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  508

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+++LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  509  MTLGGRASEEILLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  568

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+AKAY+ TV+LI EHK+HV QIAELLLEK VLHQ+DLV+VLGE
Sbjct  569  PYSSKTGAIIDTEVREWVAKAYQRTVELIREHKDHVIQIAELLLEKEVLHQDDLVQVLGE  628

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD-SSPLQPEVVP  98
            RPFK SEPTNYDRFK GF + +E + + T+E  +  DDD SS L  EVVP
Sbjct  629  RPFKLSEPTNYDRFKQGFQDQEEQKGQQTSEAATMADDDGSSSLDGEVVP  678



>ref|XP_008448079.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Cucumis melo]
Length=824

 Score =   381 bits (979),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  595  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  654

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  655  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDEMFEMSK  714

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  715  PYSSKTGAIIDSEVREWVTKAYQRTVQLIEEHKEHVAQIAELLLEKEVLHQDDLVRVLGE  774

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYDRFK+GF +D+   AK+  E  +  +  S PL+P++VP
Sbjct  775  RPFKTLEPTNYDRFKEGF-KDEVDGAKEKTERGNAGNSSSPPLEPDIVP  822



>ref|XP_010931245.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Elaeis guineensis]
Length=678

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  449  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  508

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  509  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  568

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV QIAELLLEK VLHQ+DLVRVLGE
Sbjct  569  PYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVMQIAELLLEKEVLHQDDLVRVLGE  628

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E +E +++ T+E  +  DD  S L  EVVP
Sbjct  629  RPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMADDGPSSLDGEVVP  677



>ref|XP_008448063.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
 ref|XP_008448071.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cucumis melo]
Length=825

 Score =   381 bits (978),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  596  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  655

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  656  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDEMFEMSK  715

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY+ TVQLIEEHKEHVAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  716  PYSSKTGAIIDSEVREWVTKAYQRTVQLIEEHKEHVAQIAELLLEKEVLHQDDLVRVLGE  775

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYDRFK+GF +D+   AK+  E  +  +  S PL+P++VP
Sbjct  776  RPFKTLEPTNYDRFKEGF-KDEVDGAKEKTERGNAGNSSSPPLEPDIVP  823



>ref|XP_010043512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 ref|XP_010043513.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
Length=683

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 205/230 (89%), Gaps = 3/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  455  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  514

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+YGFSDKVGLLSFP  E+  EM+K
Sbjct  515  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAIYGFSDKVGLLSFPQREDGSEMTK  574

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVAQIAELLLEK VLHQEDL+RVLGE
Sbjct  575  PYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVAQIAELLLEKEVLHQEDLLRVLGE  634

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPF+SSE TNYDR+K GF  ++E ++ +T E  + +DD+S  PL P+VVP
Sbjct  635  RPFQSSEMTNYDRYKLGF--EEEEKSTETPETGAVEDDESPRPLDPQVVP  682



>ref|XP_006349501.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X3 [Solanum tuberosum]
Length=688

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+A+PLLKVTI+PRGTAALGFAQYV +EN LMTKEQLFDMTC
Sbjct  442  RRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAALGFAQYVSSENHLMTKEQLFDMTC  501

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+A E SK
Sbjct  502  MTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDALETSK  561

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVAQIAELLLEK VLHQED+ +VLGE
Sbjct  562  PYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVAQIAELLLEKEVLHQEDMAQVLGE  621

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPF+SSEPTNY RFK GF E++  E KD+ + K+T+DD SSP++P++VPV
Sbjct  622  RPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQDDRSSPVEPKIVPV  670



>ref|XP_006349499.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=716

 Score =   378 bits (970),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+A+PLLKVTI+PRGTAALGFAQYV +EN LMTKEQLFDMTC
Sbjct  442  RRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAALGFAQYVSSENHLMTKEQLFDMTC  501

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+A E SK
Sbjct  502  MTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDALETSK  561

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVAQIAELLLEK VLHQED+ +VLGE
Sbjct  562  PYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVAQIAELLLEKEVLHQEDMAQVLGE  621

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPF+SSEPTNY RFK GF E++  E KD+ + K+T+DD SSP++P++VPV
Sbjct  622  RPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQDDRSSPVEPKIVPV  670



>ref|XP_006349500.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=700

 Score =   377 bits (968),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/230 (78%), Positives = 209/230 (91%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+A+PLLKVTI+PRGTAALGFAQYV +EN LMTKEQLFDMTC
Sbjct  442  RRTIAYHESGHAVAGWFLEYADPLLKVTIIPRGTAALGFAQYVSSENHLMTKEQLFDMTC  501

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQ+++GKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+A E SK
Sbjct  502  MTLGGRAAEQILIGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDALETSK  561

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+IDNEVR+W+AKAY+ T+QLIEEH+EHVAQIAELLLEK VLHQED+ +VLGE
Sbjct  562  PYSSKTAALIDNEVRKWVAKAYDRTLQLIEEHREHVAQIAELLLEKEVLHQEDMAQVLGE  621

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPF+SSEPTNY RFK GF E++  E KD+ + K+T+DD SSP++P++VPV
Sbjct  622  RPFESSEPTNYYRFKQGF-EEENGETKDSTDGKTTQDDRSSPVEPKIVPV  670



>ref|XP_006488359.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=810

 Score =   380 bits (976),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 202/229 (88%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  584  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEMSK
Sbjct  644  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDTFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  704  PYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVAQIAELLLEKEVLHQDDLLRVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK GF E++++ A        T DD SSPL+P+V P
Sbjct  764  RPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVDDGSSPLEPQVAP  809



>ref|XP_006424865.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
 ref|XP_006488358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Citrus sinensis]
 gb|ESR38105.1| hypothetical protein CICLE_v10027837mg [Citrus clementina]
Length=811

 Score =   380 bits (976),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/229 (82%), Positives = 202/229 (88%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEMSK
Sbjct  645  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDTFEMSK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY  TVQLIEEHKEHVAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  705  PYSSKTGAIIDAEVREWVGKAYVRTVQLIEEHKEHVAQIAELLLEKEVLHQDDLLRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK GF E++++ A        T DD SSPL+P+V P
Sbjct  765  RPFKSSELTNYDRFKQGFEEEEKSSA---PPETGTVDDGSSPLEPQVAP  810



>ref|XP_002283273.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Vitis vinifera]
 emb|CBI16104.3| unnamed protein product [Vitis vinifera]
Length=820

 Score =   380 bits (976),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  591  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  650

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  651  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  710

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAYE T+QLIEEHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  711  PYSSKTGAIIDTEVREWVGKAYERTLQLIEEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  770

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS EP+NYDRFK GF E+ +  A     +++  ++ + PL+PEVVP
Sbjct  771  RPFKSLEPSNYDRFKQGFEEENDKSAITQDSSRTEPENGAPPLEPEVVP  819



>ref|XP_006341014.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum tuberosum]
Length=817

 Score =   379 bits (974),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/220 (84%), Positives = 200/220 (91%), Gaps = 1/220 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  649  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMSK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW++KAYE TVQLIE+HKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  709  PYSSKTAAIIDTEVREWVSKAYERTVQLIEKHKEHVAQIAELLLEKEVLHQEDLVRVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            RPFKS EPTNYD FK GF E++  E KD  ENK+ +D+ S
Sbjct  769  RPFKSLEPTNYDIFKQGF-EEENKERKDNPENKTVEDNGS  807



>ref|XP_004142062.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
 gb|KGN54261.1| hypothetical protein Csa_4G296150 [Cucumis sativus]
Length=824

 Score =   379 bits (974),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  595  RRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  654

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  655  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDEMFEMSK  714

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  715  PYSSKTGAIIDSEVREWVTKAYERTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  774

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYDRFK+GF  D+   AK+  E  +  +  S PL+P++VP
Sbjct  775  RPFKTLEPTNYDRFKEGF-RDEVDGAKEKTERGNPGNSSSPPLEPDIVP  822



>ref|XP_009600786.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
 ref|XP_009600787.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=716

 Score =   376 bits (965),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 206/230 (90%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHA+AG FLEHAEPLLKVTI+PRGTAALGFAQYVPNENLLMT+EQLFDMTC
Sbjct  442  RRTIAYHESGHAIAGWFLEHAEPLLKVTIIPRGTAALGFAQYVPNENLLMTREQLFDMTC  501

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKIS+GAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FE SK
Sbjct  502  MTLGGRAAEQVLIGKISSGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFETSK  561

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREWIAKAY+ T+QLIEEH+EHVAQIAELLLEK VLH EDLV+VLGE
Sbjct  562  PYSSKTAAIIDDEVREWIAKAYDRTLQLIEEHREHVAQIAELLLEKEVLHHEDLVQVLGE  621

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPF+SSE TNY+RFK GF E++  E KD  ++ + +D+ SS  + EVVP+
Sbjct  622  RPFESSELTNYNRFKQGF-EEENGEIKDIPKDMTAQDNQSSSEESEVVPI  670



>ref|XP_007016370.1| FTSH protease 10 [Theobroma cacao]
 gb|EOY33989.1| FTSH protease 10 [Theobroma cacao]
Length=813

 Score =   379 bits (972),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  585  RKTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEMSK
Sbjct  645  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMSK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W+ KAYE TVQLIEEHKE VA+IAELLLEK VLHQ+DLVRVLGE
Sbjct  705  PYSNKTGAIIDGEVRKWVGKAYEKTVQLIEEHKEQVAEIAELLLEKEVLHQDDLVRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK GF E++  ++    E  S ++D S+PL P+VVP
Sbjct  765  RPFKSSELTNYDRFKQGF-EEEANKSMQAPEVGSVENDGSAPLDPQVVP  812



>ref|XP_004164623.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Cucumis sativus]
Length=824

 Score =   379 bits (973),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/229 (81%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  595  RRTVAYHESGHAVAGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  654

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  655  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDEMFEMSK  714

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAYE TVQLIEEHKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  715  PYSSKTGAIIDSEVREWVTKAYERTVQLIEEHKEHVAQIAELLLEKEVLHQEDLVRVLGE  774

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYDRFK+GF  D+   AK+  E  +  +  S PL+P++VP
Sbjct  775  RPFKTLEPTNYDRFKEGF-RDEVDGAKEKTERGNPGNSSSPPLEPDIVP  822



>gb|AAU44017.1| putative AAA-metalloprotease FtsH (fragment) [Oryza sativa Japonica 
Group]
Length=475

 Score =   368 bits (945),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  247  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  306

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  307  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  366

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA+IAE+LLEK VLHQ+DLVRVLGE
Sbjct  367  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAKIAEMLLEKEVLHQDDLVRVLGE  426

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYD FK GF +D+E      A      DDD +P   EVVP
Sbjct  427  RPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPDDDGTPSLGEVVP  474



>ref|XP_008777193.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Phoenix dactylifera]
Length=822

 Score =   378 bits (971),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 203/230 (88%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+++LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  652  MTLGGRASEEILLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+AKAY+ TV+LI EHK+HV QIAELLLEK VLHQ+DLV+VLGE
Sbjct  712  PYSSKTGAIIDTEVREWVAKAYQRTVELIREHKDHVIQIAELLLEKEVLHQDDLVQVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD-SSPLQPEVVP  98
            RPFK SEPTNYDRFK GF + +E + + T+E  +  DDD SS L  EVVP
Sbjct  772  RPFKLSEPTNYDRFKQGFQDQEEQKGQQTSEAATMADDDGSSSLDGEVVP  821



>ref|XP_006349497.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=816

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 206/231 (89%), Gaps = 6/231 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  591  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  650

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FE +K
Sbjct  651  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFE-AK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID EVREW+AKAY+ TVQL+E+HKEHVAQIAE+LLEK VLHQEDL++VLGE
Sbjct  710  PYGSKTAAIIDTEVREWVAKAYDHTVQLVEKHKEHVAQIAEMLLEKEVLHQEDLIQVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD-DSSPLQPEVVPV  95
            RPF S EPTNYDRFK GF    E E KD AE K+ +DD  SSP++PE+VPV
Sbjct  770  RPFVSVEPTNYDRFKQGF----EEENKDGAEAKTAQDDGSSSPVEPEIVPV  816



>ref|XP_006349498.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=815

 Score =   378 bits (970),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 185/231 (80%), Positives = 206/231 (89%), Gaps = 6/231 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  590  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FE +K
Sbjct  650  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFE-AK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID EVREW+AKAY+ TVQL+E+HKEHVAQIAE+LLEK VLHQEDL++VLGE
Sbjct  709  PYGSKTAAIIDTEVREWVAKAYDHTVQLVEKHKEHVAQIAEMLLEKEVLHQEDLIQVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD-DSSPLQPEVVPV  95
            RPF S EPTNYDRFK GF    E E KD AE K+ +DD  SSP++PE+VPV
Sbjct  769  RPFVSVEPTNYDRFKQGF----EEENKDGAEAKTAQDDGSSSPVEPEIVPV  815



>ref|XP_006592192.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Glycine max]
Length=674

 Score =   374 bits (959),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTA LGFAQYVPNENL MTKEQLFD+TC
Sbjct  446  RRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGLGFAQYVPNENLFMTKEQLFDITC  505

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  506  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  565

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V +IAELLLEK VLHQ+DL+RVLGE
Sbjct  566  PYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVTEIAELLLEKEVLHQDDLLRVLGE  625

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYDRFK GF+E++E  A+ T +    +   SSPL+P+VVP
Sbjct  626  RPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EGGGSSPLEPQVVP  673



>ref|XP_010312354.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Solanum lycopersicum]
Length=813

 Score =   377 bits (968),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 207/231 (90%), Gaps = 6/231 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++F+ +K
Sbjct  648  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFD-AK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID EVREW+AKAY+ TVQL+EEH+EHVAQIAE+LLEK VLHQEDL++VLGE
Sbjct  707  PYGSKTAAIIDTEVREWVAKAYDRTVQLVEEHREHVAQIAEMLLEKEVLHQEDLIQVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD-DSSPLQPEVVPV  95
            RPF S E TNYDRFK GF    E E KD+AE+K+ +DD  SSP++PE+VPV
Sbjct  767  RPFTSVEATNYDRFKQGF----EEENKDSAESKTAQDDGSSSPVEPEIVPV  813



>ref|XP_004249560.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Solanum lycopersicum]
Length=812

 Score =   377 bits (968),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/231 (79%), Positives = 207/231 (90%), Gaps = 6/231 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  587  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++F+ +K
Sbjct  647  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFD-AK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID EVREW+AKAY+ TVQL+EEH+EHVAQIAE+LLEK VLHQEDL++VLGE
Sbjct  706  PYGSKTAAIIDTEVREWVAKAYDRTVQLVEEHREHVAQIAEMLLEKEVLHQEDLIQVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD-DSSPLQPEVVPV  95
            RPF S E TNYDRFK GF    E E KD+AE+K+ +DD  SSP++PE+VPV
Sbjct  766  RPFTSVEATNYDRFKQGF----EEENKDSAESKTAQDDGSSSPVEPEIVPV  812



>ref|XP_010931243.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=821

 Score =   377 bits (968),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  652  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV QIAELLLEK VLHQ+DLVRVLGE
Sbjct  712  PYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVMQIAELLLEKEVLHQDDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E +E +++ T+E  +  DD  S L  EVVP
Sbjct  772  RPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMADDGPSSLDGEVVP  820



>ref|XP_010931244.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Elaeis guineensis]
Length=816

 Score =   377 bits (968),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 184/229 (80%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  587  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  647  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+AKAY+ TV+LI+EHK+HV QIAELLLEK VLHQ+DLVRVLGE
Sbjct  707  PYSSKTGAIIDTEVREWVAKAYQRTVELIKEHKDHVMQIAELLLEKEVLHQDDLVRVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E +E +++ T+E  +  DD  S L  EVVP
Sbjct  767  RPFKSSEPTNYDRFKQGFQEQEEQKSQQTSEAATMADDGPSSLDGEVVP  815



>gb|KCW85528.1| hypothetical protein EUGRSUZ_B02325 [Eucalyptus grandis]
Length=816

 Score =   376 bits (966),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 204/230 (89%), Gaps = 3/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+YGFSDKVGLLSFP  E+  EM+K
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAIYGFSDKVGLLSFPQREDGSEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVAQIAELLLEK VLHQEDL+RVLGE
Sbjct  708  PYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVAQIAELLLEKEVLHQEDLLRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPF+SSE TNYDR+K GF E  E ++ +T E  + +DD+S  PL P+VVP
Sbjct  768  RPFQSSEMTNYDRYKLGFEE--EEKSTETPETGAVEDDESPRPLDPQVVP  815



>ref|XP_009375915.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   376 bits (966),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E +FEMSK
Sbjct  644  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREESFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +AQIAELLLEK VLHQ+DL++VLGE
Sbjct  704  PYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIAQIAELLLEKEVLHQDDLIKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFKDGF E+K+ E         ++DD SSPL+P+V+P
Sbjct  764  RPYKPAEATNYDRFKDGF-EEKDAEKTVETPLVGSEDDGSSPLEPQVLP  811



>ref|XP_009804923.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
 ref|XP_009804924.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Nicotiana sylvestris]
Length=716

 Score =   374 bits (959),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 206/230 (90%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTI+PRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  442  RRTIAYHESGHAVAGWFLEHAEPLLKVTIIPRGTAALGFAQYVPNENLLMTKEQLFDMTC  501

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FE SK
Sbjct  502  MTLGGRAAEQVLIGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPLRDDTFETSK  561

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+AKAY+ T+QLIEEH+EHVAQIAELLLEK VLHQEDLV+VLGE
Sbjct  562  PYSSKTAAIIDDEVREWVAKAYDRTLQLIEEHREHVAQIAELLLEKEVLHQEDLVQVLGE  621

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            R F++SE TNY+RFK GF E++  E KD  ++K+ +D+ SS    EVVP+
Sbjct  622  RSFENSELTNYNRFKQGF-EEENREIKDIPKDKTAQDNQSSSEGSEVVPI  670



>ref|XP_010043511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
Length=847

 Score =   377 bits (968),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 183/230 (80%), Positives = 205/230 (89%), Gaps = 3/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  619  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  678

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+YGFSDKVGLLSFP  E+  EM+K
Sbjct  679  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAIYGFSDKVGLLSFPQREDGSEMTK  738

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID EVREW+ KAYECT++LI EHKEHVAQIAELLLEK VLHQEDL+RVLGE
Sbjct  739  PYSSKTAALIDGEVREWVNKAYECTLELITEHKEHVAQIAELLLEKEVLHQEDLLRVLGE  798

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPF+SSE TNYDR+K GF  ++E ++ +T E  + +DD+S  PL P+VVP
Sbjct  799  RPFQSSEMTNYDRYKLGF--EEEEKSTETPETGAVEDDESPRPLDPQVVP  846



>ref|XP_009384843.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=821

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 201/230 (87%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  591  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  650

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  651  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  710

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREWI+KAYE TV+LI+EHK+HVAQIAELLL+K VLHQ+DL +VLGE
Sbjct  711  PYSNKTGAIIDTEVREWISKAYERTVELIKEHKDHVAQIAELLLKKEVLHQDDLAQVLGE  770

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD-DDSSPLQPEVVP  98
            RPFK +EPTNYDRFK GF E  E ++++T E     D D SS L  EVVP
Sbjct  771  RPFKLTEPTNYDRFKQGFQEATEKKSQETLEGSIVADGDGSSSLDGEVVP  820



>ref|XP_004246405.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Solanum lycopersicum]
Length=813

 Score =   376 bits (965),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/220 (83%), Positives = 199/220 (90%), Gaps = 1/220 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  645  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMSK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW++KAY+ TVQLIE+HKEHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  705  PYSSKTAAIIDTEVREWVSKAYDRTVQLIEKHKEHVAQIAELLLEKEVLHQEDLVRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            RPFKS EPTNYD FK GF E++  E K   ENK+ +D+ S
Sbjct  765  RPFKSHEPTNYDIFKQGF-EEENKETKVNPENKTVEDNGS  803



>ref|XP_004294648.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=810

 Score =   375 bits (964),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/229 (79%), Positives = 202/229 (88%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEMSK
Sbjct  644  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID EVREW+ KAY  TV L+EEHK+ VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  704  PYSSKTAALIDGEVREWVGKAYAHTVALLEEHKDQVAQIAELLLEKEVLHQDDLLRVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+KSSE +NYDRFK GF ++K  EA  +      ++D SSPL+P+V+P
Sbjct  764  RPYKSSEVSNYDRFKQGFEDEKTVEAPVSV---GREEDGSSPLEPQVLP  809



>ref|XP_009384842.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=833

 Score =   376 bits (965),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 201/230 (87%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  603  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  662

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  663  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  722

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREWI+KAYE TV+LI+EHK+HVAQIAELLL+K VLHQ+DL +VLGE
Sbjct  723  PYSNKTGAIIDTEVREWISKAYERTVELIKEHKDHVAQIAELLLKKEVLHQDDLAQVLGE  782

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD-DDSSPLQPEVVP  98
            RPFK +EPTNYDRFK GF E  E ++++T E     D D SS L  EVVP
Sbjct  783  RPFKLTEPTNYDRFKQGFQEATEKKSQETLEGSIVADGDGSSSLDGEVVP  832



>gb|ACN36802.1| unknown [Zea mays]
Length=417

 Score =   363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 197/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  190  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  249

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  250  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKDGGFEMSK  309

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  310  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  369

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ E TNYD FK GF ED    ++  AEN    DD S P+  +VVP
Sbjct  370  RPFKALESTNYDLFKKGF-EDGGDNSQAPAENAELPDDSSPPVG-DVVP  416



>ref|XP_009416148.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=809

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 182/222 (82%), Positives = 199/222 (90%), Gaps = 5/222 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQL DMTC
Sbjct  592  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLLDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  652  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIIDNEVREWI+KAYE TV+LI+EHK+HVAQ+A+LLLEK VLHQEDLVRVLGE
Sbjct  712  PYSSKTGAIIDNEVREWISKAYEKTVELIKEHKDHVAQVAKLLLEKEVLHQEDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSP  119
            RPFKSSEPTNYDRFK GF E++E ++     +  T DDD  P
Sbjct  772  RPFKSSEPTNYDRFKQGFQEEEENKS-----SLETLDDDVVP  808



>ref|XP_006592191.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X2 [Glycine max]
Length=782

 Score =   374 bits (959),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTA LGFAQYVPNENL MTKEQLFD+TC
Sbjct  554  RRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGLGFAQYVPNENLFMTKEQLFDITC  613

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  614  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  673

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V +IAELLLEK VLHQ+DL+RVLGE
Sbjct  674  PYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVTEIAELLLEKEVLHQDDLLRVLGE  733

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYDRFK GF+E++E  A+ T +    +   SSPL+P+VVP
Sbjct  734  RPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EGGGSSPLEPQVVP  781



>ref|XP_004961860.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Setaria italica]
Length=816

 Score =   375 bits (962),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  648  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  708  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYD FK GF +D + +++  A+N    DDD+SP   EVVP
Sbjct  768  RPFKATEPTNYDLFKQGF-QDDDDKSQAPAKNAELPDDDASPSLGEVVP  815



>ref|XP_008384940.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
 ref|XP_008366266.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   374 bits (961),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E +FEMSK
Sbjct  644  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREESFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A+IAELLLEK VLHQ+DL++VLGE
Sbjct  704  PYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIAEIAELLLEKEVLHQDDLIKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFKDGF E+K+ E         ++DD SSPL+P+V+P
Sbjct  764  RPYKPAEATNYDRFKDGF-EEKDGEKTVETPLVGSEDDGSSPLEPQVLP  811



>ref|XP_008359096.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=777

 Score =   373 bits (958),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  549  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  608

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E +FEMSK
Sbjct  609  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREESFEMSK  668

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +A+IAELLLEK VLHQ+DL++VLGE
Sbjct  669  PYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIAEIAELLLEKEVLHQDDLIKVLGE  728

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFKDGF E+K+ E         ++DD SSPL+P+V+P
Sbjct  729  RPYKPAEATNYDRFKDGF-EEKDGEKTVETPLVGSEDDGSSPLEPQVLP  776



>ref|XP_009140963.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brassica rapa]
Length=803

 Score =   374 bits (960),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  575  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  634

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  635  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  694

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAY  TV+LIEEHKE VA+IAELLLEK VLHQEDL++VLGE
Sbjct  695  PYSNKTGAIIDEEVREWVAKAYVKTVELIEEHKEQVAEIAELLLEKEVLHQEDLLKVLGE  754

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF ED E E   T       +  S PL+P+VVP
Sbjct  755  RPFKSAEVTNYDRFKSGF-EDSEKEEAATTVTPVVDEGGSPPLEPQVVP  802



>gb|KHN32138.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=771

 Score =   373 bits (957),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTAALGFAQYVPNENL+MTKEQLFD+TC
Sbjct  543  RRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAALGFAQYVPNENLIMTKEQLFDITC  602

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  603  MALGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  662

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V +IAELLLEK VLHQ+DL+RVLGE
Sbjct  663  PYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVTEIAELLLEKEVLHQDDLLRVLGE  722

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYDRFK GF+E++E  A+ T +    +   SSPL+P+VVP
Sbjct  723  RPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EGGGSSPLEPQVVP  770



>ref|XP_003539663.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Glycine max]
Length=806

 Score =   373 bits (958),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTA LGFAQYVPNENL MTKEQLFD+TC
Sbjct  578  RRTAAYHEAGHAVSGWFLEHGEPLLKVTIVPRGTAGLGFAQYVPNENLFMTKEQLFDITC  637

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  638  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  697

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW+ KAY+ T+QLIEEHKE V +IAELLLEK VLHQ+DL+RVLGE
Sbjct  698  PYSSKTAAIIDKEVREWVNKAYKHTIQLIEEHKEQVTEIAELLLEKEVLHQDDLLRVLGE  757

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYDRFK GF+E++E  A+ T +    +   SSPL+P+VVP
Sbjct  758  RPFKATEPTNYDRFKQGFIEEEEKGAESTIDTPE-EGGGSSPLEPQVVP  805



>ref|XP_009364366.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Pyrus x bretschneideri]
Length=812

 Score =   373 bits (958),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNEN+LMTKEQLFDMTC
Sbjct  584  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENILMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEMSK
Sbjct  644  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +AQIAELLLEK VLHQ+DL++VLGE
Sbjct  704  PYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIAQIAELLLEKEVLHQDDLLKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFKDGF E+K  E         ++DD SSPL+P+V+P
Sbjct  764  RPYKPAEATNYDRFKDGF-EEKNDEKTVETPLVGSEDDGSSPLEPQVLP  811



>ref|XP_011089809.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Sesamum indicum]
Length=826

 Score =   374 bits (959),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 204/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT A+H SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  598  RRTVAFHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  657

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEMSK
Sbjct  658  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMSK  717

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW++KAYE TV+LI+EHKE VA++AELLLEK  L+QEDLV++LGE
Sbjct  718  PYSSKTAAIIDTEVREWVSKAYERTVELIQEHKEQVAKMAELLLEKETLYQEDLVQLLGE  777

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK SE TNYD+FK GF  + E   + TAE+ +T+DD SSPL P+VVP
Sbjct  778  RPFKPSEMTNYDKFKQGFQGENEKSGQ-TAEDGTTEDDGSSPLVPDVVP  825



>ref|XP_010937593.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 8, mitochondrial-like [Elaeis guineensis]
Length=820

 Score =   373 bits (958),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/229 (80%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
             TLGGRASE+V+LGKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  652  RTLGGRASEEVLLGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFEMTK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAY+ TV+LI+EHK+ V QIAELLLEK VLHQ+DLVRVLGE
Sbjct  712  PYSSKTAAIIDSEVREWVTKAYQRTVELIKEHKDQVIQIAELLLEKEVLHQDDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E+ E E ++ ++    +DD SS L  EVVP
Sbjct  772  RPFKSSEPTNYDRFKQGFQEEAEDEGREPSK-AIEEDDRSSSLSGEVVP  819



>emb|CDY31753.1| BnaA04g16890D [Brassica napus]
Length=788

 Score =   372 bits (954),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 200/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  560  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  619

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  620  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  679

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAY  TV+LIEEHKE VA+IAELLLEK VLHQEDL++VLGE
Sbjct  680  PYSNKTGAIIDEEVREWVAKAYVKTVELIEEHKEQVAEIAELLLEKEVLHQEDLLKVLGE  739

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E ++ EA  T       +  S PL+P+VVP
Sbjct  740  RPFKSAEVTNYDRFKSGFEESEKEEAATTV-TPVVDEGGSPPLEPQVVP  787



>ref|XP_006293791.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
 gb|EOA26689.1| hypothetical protein CARUB_v10022773mg [Capsella rubella]
Length=679

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 177/230 (77%), Positives = 202/230 (88%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  450  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  509

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  510  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  569

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW++KAYE TV+L+EEHKE VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  570  PYSNKTGAIIDQEVREWVSKAYERTVELVEEHKEKVAEIAELLLEKEVLHQDDLLKILGE  629

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKS+E TNYDRFK GF ED E ++  T   +   D+ +  PL+P+VVP
Sbjct  630  RPFKSAEVTNYDRFKSGF-EDNEKDSTTTPRVEPVVDEGAPPPLEPQVVP  678



>emb|CDX77230.1| BnaC04g40250D [Brassica napus]
Length=789

 Score =   372 bits (954),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 198/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  561  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  620

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  621  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  680

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+ KAYE TV+LIEEHKE VA+IAELLL+K VLHQEDL++VLGE
Sbjct  681  PYSNKTGAIIDEEVREWVGKAYEKTVELIEEHKEQVAEIAELLLDKEVLHQEDLLKVLGE  740

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF ED E E   T       +    PL+P+VVP
Sbjct  741  RPFKSAEVTNYDRFKSGF-EDSEKEEAATTVTPVVDEGGPPPLEPQVVP  788



>gb|KFK43073.1| hypothetical protein AALP_AA1G075200 [Arabis alpina]
Length=814

 Score =   372 bits (955),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 200/229 (87%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  587  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  647  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEF--SK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+AKAY+ TV+L+EEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  705  PYSNRTGAMIDEEVREWVAKAYKRTVELVEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E  +   ++T   K  +DD + PL+P+VVP
Sbjct  765  RPFKSAEKTNYDRFKSGFEETDKKSQEETVTTKPVEDDGAPPLEPQVVP  813



>ref|XP_006417796.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
 gb|ESQ36149.1| hypothetical protein EUTSA_v10006814mg [Eutrema salsugineum]
Length=815

 Score =   372 bits (955),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 199/229 (87%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E  F  SK
Sbjct  648  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREEEF--SK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  706  PYSNRTGAMIDEEVREWVAKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLTKVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   ++    K T+DD S PL+P+VVP
Sbjct  766  RPFKSGETTNYDRFKSGFEETEKKSQEEPVTVKPTEDDGSPPLEPQVVP  814



>ref|XP_008222305.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Prunus mume]
Length=814

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 202/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  646  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMAK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY  TV++IEEHK  VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  706  PYSSKTGAIIDSEVREWVGKAYTRTVEIIEEHKVQVAQIAELLLEKEVLHQDDLLRVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK+GF E+K+ E         +++D SSPL+P+V+P
Sbjct  766  RPFKSSEVTNYDRFKEGF-EEKDDEKTVEIPLVGSEEDGSSPLEPQVLP  813



>ref|XP_007207144.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
 gb|EMJ08343.1| hypothetical protein PRUPE_ppa001491mg [Prunus persica]
Length=814

 Score =   372 bits (954),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVTGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FEM+K
Sbjct  646  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDGFEMAK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAY  TV++IEEHKE VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  706  PYSSKTGAIIDSEVREWVGKAYTRTVEIIEEHKEQVAQIAELLLEKEVLHQDDLLRVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE TNYDRFK+GF E+K+ E         +++D SSPL+P+V+P
Sbjct  766  RPFKSSEVTNYDRFKEGF-EEKDDEKIVEIPLVGSEEDGSSPLEPQVLP  813



>ref|XP_010521866.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Tarenaya hassleriana]
Length=679

 Score =   367 bits (943),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 197/229 (86%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  453  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  512

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ ++ SK
Sbjct  513  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDGYDFSK  572

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT A+ID EVREW++KAYE TV+LIEE KE VAQIAELLLEK VLHQEDLV+VLGE
Sbjct  573  PYSNKTGAMIDEEVREWVSKAYERTVELIEERKEQVAQIAELLLEKEVLHQEDLVKVLGE  632

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDR+K GF   +E E K      +  D    PL+P+VVP
Sbjct  633  RPFKSNEVTNYDRYKSGF---EEAEKKGDEAKPAEDDGGVPPLEPQVVP  678



>ref|XP_004302718.2| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=812

 Score =   371 bits (953),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/220 (82%), Positives = 194/220 (88%), Gaps = 1/220 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQV+LGKISTGAQNDLEKVTKMTYAQVA+YGFSDKVGLLSFP N N FEM K
Sbjct  644  MTLGGRASEQVLLGKISTGAQNDLEKVTKMTYAQVAIYGFSDKVGLLSFPQN-NEFEMMK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+AKAY  T++LIEEHKEHV QIAELLLEK VLHQEDLVRVLGE
Sbjct  703  PYSSKTGAIIDSEVREWVAKAYTRTIELIEEHKEHVGQIAELLLEKEVLHQEDLVRVLGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            RP+KS EPTNYD+FK GF E+ +   + T E K+  D  S
Sbjct  763  RPWKSEEPTNYDKFKQGFQEEDKEAKQTTTEGKNVNDGQS  802



>ref|XP_008356937.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=812

 Score =   371 bits (952),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEMSK
Sbjct  644  MTLGGRAAEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDSFEMSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAY  TV+L+EEHKE +AQIAELLLEK VLHQ+DL++VLGE
Sbjct  704  PYSSKTGALIDGEVREWVGKAYARTVELVEEHKEQIAQIAELLLEKEVLHQDDLLKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFK+GF E+K  E         ++DD SSPL+P+V+P
Sbjct  764  RPYKPAEVTNYDRFKEGF-EEKNDEKTVETPLVGSEDDGSSPLEPQVLP  811



>dbj|BAE98430.1| AAA-type like ATPase [Arabidopsis thaliana]
Length=326

 Score =   355 bits (912),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 190/212 (90%), Gaps = 1/212 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRG AALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  110  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGAAALGFAQYVPNENLLMTKEQLFDMTC  169

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  170  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  229

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  230  PYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLLEKEVLHQDDLLKILGE  289

Query  244  RPFKSSEPTNYDRFKDGFVE-DKETEAKDTAE  152
            RPFKS+E TNYDRFK GF E +K++ A  T E
Sbjct  290  RPFKSAEVTNYDRFKSGFEETEKDSAATPTVE  321



>ref|XP_003539662.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Glycine max]
Length=810

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTK+TYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  642  MTLGGRAAEQVLIGRISTGAQNDLEKVTKLTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVR+W+ KAY+ T+QLIEEHKE V QIAELLLEK VLHQ+DL+RVLGE
Sbjct  702  PYSSKTAAIIDSEVRDWVDKAYKHTIQLIEEHKEQVTQIAELLLEKEVLHQDDLLRVLGE  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++E TNYDRFK GF+E++E   + T +    +   SSPL+P+VVP
Sbjct  762  RPFKATELTNYDRFKQGFIEEEEKVVESTVDTPE-EGGGSSPLEPQVVP  809



>gb|KHN32140.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Glycine 
soja]
Length=810

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 203/229 (89%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVSGWFLEHVEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E ++E SK
Sbjct  642  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPTEGSYEFSK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVR+W+ KAY+ T+QLIEEHKE V +IAELLLEK VLHQ+DL+RVLGE
Sbjct  702  PYSSKTAAIIDSEVRDWVDKAYKHTIQLIEEHKEQVTEIAELLLEKEVLHQDDLLRVLGE  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++E TNYDRFK GF+E++E   + T +    +   SSPL+P+VVP
Sbjct  762  RPFKATELTNYDRFKQGFIEEEEKVVESTVDTPE-EGGGSSPLEPQVVP  809



>ref|XP_010043509.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW85526.1| hypothetical protein EUGRSUZ_B02323 [Eucalyptus grandis]
Length=816

 Score =   370 bits (951),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 184/230 (80%), Positives = 203/230 (88%), Gaps = 3/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVA+YGFSDKVGLLSFP  E+ FEM+K
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAIYGFSDKVGLLSFPQREDGFEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID EVRE + KAYE T++LI EHKEHVAQIAELLLEK VLHQEDL+RVLGE
Sbjct  708  PYSSKTAALIDGEVREVVNKAYERTLELITEHKEHVAQIAELLLEKEVLHQEDLLRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKSSE TNYDR+K GF E  E ++ +T E  + +DD+S  PL P+VVP
Sbjct  768  RPFKSSEMTNYDRYKLGFEE--EEKSTETPETGAVEDDESPPPLDPQVVP  815



>ref|XP_010685724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Beta vulgaris subsp. vulgaris]
Length=819

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 203/231 (88%), Gaps = 5/231 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  591  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  650

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  651  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  710

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+ KAY+ TV+LIEE KE VA IAELLLEK VLHQEDLVRVLGE
Sbjct  711  PYSNKTGAIIDEEVREWVTKAYKRTVELIEEKKEQVATIAELLLEKEVLHQEDLVRVLGE  770

Query  244  RPFKSSEPTNYDRFKDGFVE--DKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+K +E TNYDRFK GF E  DK ++A   ++ ++++D+ S PL P+VVP
Sbjct  771  RPYKPAELTNYDRFKQGFQEEPDKSSQA---SKKQTSEDEGSPPLIPDVVP  818



>ref|XP_009387530.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=818

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 201/229 (88%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLL+TKEQLFDMTC
Sbjct  590  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLLTKEQLFDMTC  649

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFS KVGLLSFP  ++  EM+K
Sbjct  650  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSSKVGLLSFPQRDDTLEMTK  709

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW++KAYE TV LI+EHK+HV QIAELLLEK VLHQEDLVRVLGE
Sbjct  710  PYSSKTGAIIDEEVREWVSKAYERTVALIKEHKDHVIQIAELLLEKEVLHQEDLVRVLGE  769

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPF SSEPTNYD+F  GF +D++  + +  E+ + +DD SSPL  EVVP
Sbjct  770  RPFVSSEPTNYDKFIQGF-QDEDNTSNNLPEDAALEDDGSSPLNGEVVP  817



>ref|XP_010475512.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X2 [Camelina sativa]
Length=813

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  646  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQKEDEF--SK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  704  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  764  RPFKSGETTNYDRFKSGFEETEKDSQKESVTLKPVEDDGVPPLEPQVVP  812



>ref|XP_010475511.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Camelina sativa]
Length=815

 Score =   370 bits (950),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  648  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQKEDEF--SK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  706  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  766  RPFKSGETTNYDRFKSGFEETEKDSQKESVTLKPVEDDGVPPLEPQVVP  814



>gb|KFK32242.1| hypothetical protein AALP_AA6G216200 [Arabis alpina]
Length=802

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 200/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHA+PLLKVTIVPRG+AALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  574  RRTVAYHESGHAVAGWFLEHADPLLKVTIVPRGSAALGFAQYVPSENLLMTKEQLFDMTC  633

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  634  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  693

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW++KAYE TV+LIEEHK+ VAQIAELLLEK VLHQ+DL++VLGE
Sbjct  694  PYSNKTGAIIDQEVREWVSKAYEKTVELIEEHKDQVAQIAELLLEKEVLHQDDLLKVLGE  753

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E+ E E   T  N    +    PL+P+VVP
Sbjct  754  RPFKSAEVTNYDRFKSGF-EESEQEPTTTTVNPVVDEGAPPPLEPQVVP  801



>ref|XP_010487541.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Camelina sativa]
Length=815

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  648  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEF--SK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  706  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  766  RPFKSGETTNYDRFKSGFEETEKESQKESVTVKPVEDDGVPPLEPQVVP  814



>gb|KDP42240.1| hypothetical protein JCGZ_02970 [Jatropha curcas]
Length=803

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/204 (86%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  580  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP E+++EMSK
Sbjct  640  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPREDSYEMSK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID EVREW+ KAYE TVQLIEEHKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  700  PYSSKTGALIDGEVREWVGKAYERTVQLIEEHKEQVAQIAELLLEKEVLHQDDLVRVLGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKET  173
            RPFKSSE TNYDRFK+GF E+++ 
Sbjct  760  RPFKSSEVTNYDRFKEGFKEEEKV  783



>ref|XP_010487557.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X3 [Camelina sativa]
Length=815

 Score =   369 bits (947),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQ+++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  648  MTLGGRAAEQLLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEF--SK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  706  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  766  RPFKSGETTNYDRFKSGFEETEKESQKESVTVKPVEDDGVPPLEPQVVP  814



>gb|EEE63976.1| hypothetical protein OsJ_18802 [Oryza sativa Japonica Group]
Length=792

 Score =   368 bits (945),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  564  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  623

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  624  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  683

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA+IAE+LLEK VLHQ+DLVRVLGE
Sbjct  684  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAKIAEMLLEKEVLHQDDLVRVLGE  743

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYD FK GF +D+E      A      DDD +P   EVVP
Sbjct  744  RPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPDDDGTPSLGEVVP  791



>ref|XP_010521865.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
isoform X1 [Tarenaya hassleriana]
Length=809

 Score =   369 bits (946),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 197/229 (86%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  583  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  642

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ ++ SK
Sbjct  643  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDGYDFSK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT A+ID EVREW++KAYE TV+LIEE KE VAQIAELLLEK VLHQEDLV+VLGE
Sbjct  703  PYSNKTGAMIDEEVREWVSKAYERTVELIEERKEQVAQIAELLLEKEVLHQEDLVKVLGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDR+K GF   +E E K      +  D    PL+P+VVP
Sbjct  763  RPFKSNEVTNYDRYKSGF---EEAEKKGDEAKPAEDDGGVPPLEPQVVP  808



>ref|XP_002439915.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
 gb|EES18345.1| hypothetical protein SORBIDRAFT_09g022490 [Sorghum bicolor]
Length=815

 Score =   369 bits (946),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 202/229 (88%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  648  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKDDGFEMTK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVR+W+ KAY+ TV+LI EHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  708  PYSNQTASIIDDEVRDWVGKAYKKTVELITEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYD FK GF +D + +++ T+EN    DD S PL  EVVP
Sbjct  768  RPFKALEPTNYDLFKQGF-QDDDDKSQATSENAELPDDSSPPLG-EVVP  814



>ref|XP_010920548.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Elaeis guineensis]
Length=819

 Score =   369 bits (946),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  ++ FEMSK
Sbjct  652  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQRDDGFEMSK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY+ TV+L++EHK+HV QIAELLLEK VLHQ+DLVRVLGE
Sbjct  712  PYSSKTGAIIDAEVREWVTKAYQRTVELMKEHKDHVIQIAELLLEKEVLHQDDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNYDRFK GF E  E + K    +K+  +DD S     VVP
Sbjct  772  RPFKSSEPTNYDRFKQGFQE--EEDDKGGEPSKAVDEDDGSSSLCGVVP  818



>gb|EEC79350.1| hypothetical protein OsI_20217 [Oryza sativa Indica Group]
Length=829

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  601  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  660

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  661  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  720

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA+IAE+LLEK VLHQ+DLVRVLGE
Sbjct  721  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAKIAEMLLEKEVLHQDDLVRVLGE  780

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYD FK GF +D+E      A      DDD +P   EVVP
Sbjct  781  RPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPDDDGTPSLGEVVP  828



>ref|NP_001055745.1| Os05g0458400 [Oryza sativa Japonica Group]
 sp|Q0DHL4.1|FTSH8_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 8, mitochondrial; 
Short=OsFTSH8; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAF17659.1| Os05g0458400 [Oryza sativa Japonica Group]
Length=822

 Score =   368 bits (945),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 199/229 (87%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  654  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  713

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VA+IAE+LLEK VLHQ+DLVRVLGE
Sbjct  714  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAKIAEMLLEKEVLHQDDLVRVLGE  773

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+SEPTNYD FK GF +D+E      A      DDD +P   EVVP
Sbjct  774  RPFKASEPTNYDLFKQGF-QDEEDSKNQEAAKTPQPDDDGTPSLGEVVP  821



>ref|XP_003568313.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial 
[Brachypodium distachyon]
Length=814

 Score =   368 bits (944),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/228 (77%), Positives = 203/228 (89%), Gaps = 1/228 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEM+K
Sbjct  645  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDGFEMNK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID EVR+W++KAY+ TV+L+ EHKE VAQIAELLLEK VLHQ+DL+RVLGE
Sbjct  705  PYSNQTASIIDEEVRDWVSKAYKKTVELVTEHKEQVAQIAELLLEKEVLHQDDLMRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFK+ E TNYD FK GF +D++ ++ + A+N    DDD SP+ P+VV
Sbjct  765  RPFKAVELTNYDLFKQGF-QDEDGKSPEAAKNAEVPDDDGSPVLPDVV  811



>ref|XP_010469994.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010469995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=812

 Score =   367 bits (942),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/230 (77%), Positives = 202/230 (88%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  583  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  642

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  643  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW++KAYE T++L+EEHKE VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  703  PYSNKTGAIIDQEVREWVSKAYERTLELVEEHKEKVAEIAELLLEKEVLHQDDLLKILGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKS+E TNYDRFK GF ED E ++  T   +   D+ +  PL+P+VVP
Sbjct  763  RPFKSAEVTNYDRFKSGF-EDSEKDSAATPRVEPVVDEGAPPPLEPQVVP  811



>ref|XP_002881027.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57286.1| hypothetical protein ARALYDRAFT_344684 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   367 bits (942),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 196/229 (86%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  649  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  708

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+AKAYE TV+L+EEHK  VAQIAELLLEK VLHQ+DL++VLGE
Sbjct  709  PYSNKTGAIIDEEVREWVAKAYERTVELVEEHKVKVAQIAELLLEKEVLHQDDLLKVLGE  768

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E ++  A          +    PL+P+V+P
Sbjct  769  RPFKSAEVTNYDRFKSGFEESEKDSAPTPTVEPVVDEGVPPPLEPQVIP  817



>ref|XP_010414442.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Camelina sativa]
Length=812

 Score =   366 bits (940),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 202/230 (88%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  583  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  642

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  643  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW++KAYE T++L+EEHKE VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  703  PYSNKTGAIIDQEVREWVSKAYERTIELVEEHKEKVAEIAELLLEKEVLHQDDLLKILGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKS+E TNYDRFK GF E+ E ++  T   +   D+ +  PL+P+VVP
Sbjct  763  RPFKSAEVTNYDRFKSGF-EESEKDSAATPRVEPVVDEGAPPPLEPQVVP  811



>ref|XP_009781386.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana sylvestris]
Length=808

 Score =   366 bits (940),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/220 (80%), Positives = 199/220 (90%), Gaps = 2/220 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVVGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++ FE +K
Sbjct  642  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTFE-AK  700

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID+EVREW+AKAY+ TV+L+EEH+EHVAQIAELLLEK VLHQEDLVRVLGE
Sbjct  701  PYGSKTAAIIDSEVREWVAKAYDNTVKLVEEHREHVAQIAELLLEKEVLHQEDLVRVLGE  760

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            RPF+SSEPTNYDRF  GF E++ +E  D+ E K+ +D+ S
Sbjct  761  RPFQSSEPTNYDRFTQGF-EEENSETTDSTEEKTAEDNGS  799



>ref|XP_002313426.1| FtsH protease family protein [Populus trichocarpa]
 gb|EEE87381.1| FtsH protease family protein [Populus trichocarpa]
Length=786

 Score =   365 bits (937),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 199/229 (87%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL TKEQLFDMTC
Sbjct  560  RKTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLFTKEQLFDMTC  619

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEM+K
Sbjct  620  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQKEDSFEMTK  679

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T AIID+EVREW+ KAY  TVQL+E+HKE VAQIAELLLEK VLHQEDL+RVLGE
Sbjct  680  PYSNETGAIIDSEVREWVGKAYGHTVQLVEKHKEQVAQIAELLLEKEVLHQEDLIRVLGE  739

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE +NYD FK GF E++E + +  A      +D SSP+  E VP
Sbjct  740  RPFKSSEVSNYDIFKQGF-EEEEKKVETPASTTDGDEDQSSPI--EAVP  785



>gb|AFW82207.1| hypothetical protein ZEAMMB73_958383 [Zea mays]
Length=815

 Score =   366 bits (939),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  648  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKDGGFEMSK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  708  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYD FK GF ED    ++  AEN    DD S P+  +VVP
Sbjct  768  RPFKALEPTNYDLFKKGF-EDGGDNSQAPAENAELPDDSSPPVG-DVVP  814



>emb|CDP09082.1| unnamed protein product [Coffea canephora]
Length=821

 Score =   366 bits (939),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 202/229 (88%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSF P  + FEM++
Sbjct  654  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSF-PQRDEFEMTR  712

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID EVREW+ KAY  TV+LIEEHKE VA+IAELLLEK VLHQ+DLV+VLG+
Sbjct  713  PYGSKTAAIIDAEVREWVGKAYNRTVELIEEHKERVAKIAELLLEKEVLHQDDLVQVLGK  772

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPF+S+E TNYDR+K GF E++  + K   ++++T DD  SPL+PEVVP
Sbjct  773  RPFESAEVTNYDRYKQGF-EEEVQKTKQAIDDRTTNDDGPSPLEPEVVP  820



>ref|XP_006306790.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
 gb|EOA39688.1| hypothetical protein CARUB_v10008328mg [Capsella rubella]
Length=811

 Score =   365 bits (938),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 199/229 (87%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  645  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEF--SK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  703  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ E TNYDRFK GF E +E++ K++   K  + D   PL+P+VVP
Sbjct  763  RPFKTGETTNYDRFKSGFEETEESQ-KESVTVKPVEGDGVPPLEPQVVP  810



>ref|XP_010510537.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Camelina sativa]
Length=809

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 202/230 (88%), Gaps = 2/230 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  580  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  640  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W++KAYE T++L+EEHKE VA+IAELLL+K VLHQ+DL+++LGE
Sbjct  700  PYSNKTGAIIDQEVRDWVSKAYERTLELVEEHKEKVAEIAELLLDKEVLHQDDLLKILGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKS+E TNYDRFK GF ED E ++  T   +   D+ +  PL+P+VVP
Sbjct  760  RPFKSAEVTNYDRFKSGF-EDSEKDSAATPRVEPVVDEGAPPPLEPQVVP  808



>ref|NP_850129.1| FTSH protease 3 [Arabidopsis thaliana]
 sp|Q84WU8.1|FTSH3_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=AtFTSH3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO22572.1| putative AAA-type ATPase [Arabidopsis thaliana]
 gb|AEC08208.1| FTSH protease 3 [Arabidopsis thaliana]
Length=809

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  580  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  640  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  700  PYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLLEKEVLHQDDLLKILGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E ++  A          D    P +P+VVP
Sbjct  760  RPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDDGAPPPFEPQVVP  808



>gb|AAC33234.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=807

 Score =   365 bits (936),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 195/229 (85%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  578  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  637

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  638  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  697

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  698  PYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLLEKEVLHQDDLLKILGE  757

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E ++  A          D    P +P+VVP
Sbjct  758  RPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDDGAPPPFEPQVVP  806



>ref|XP_009125053.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial 
[Brassica rapa]
Length=814

 Score =   364 bits (935),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  646  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+ KAYE TV+LIE HKE VA+IAELLLEK VLHQ+DL++VLGE
Sbjct  706  PYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVAEIAELLLEKEVLHQDDLLKVLGE  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK +E TNYDRFK GF E ++ EA  T       +    PL+P+VVP
Sbjct  766  RPFKPAEVTNYDRFKSGFEESEKEEATPTVA-PVVDEGAPPPLEPQVVP  813



>ref|XP_010542637.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
 ref|XP_010542639.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Tarenaya hassleriana]
Length=817

 Score =   365 bits (936),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/230 (75%), Positives = 198/230 (86%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  587  RRTVAYHEAGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFS+K+GLLSFPP E  F+ SK
Sbjct  647  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKIGLLSFPPREEGFDFSK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT A+ID EVREW++KAYE TV+LI EHKE VAQ+AELLLE+ VLHQ+DLV+VLGE
Sbjct  707  PYSNKTGAMIDEEVREWVSKAYERTVELIMEHKEQVAQVAELLLEREVLHQDDLVKVLGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS-PLQPEVVP  98
            RPF+S E TNYDRFK GF E  +  + + + +   +D   + PL+P+VVP
Sbjct  767  RPFQSMEVTNYDRFKSGFEESDKPASHEGSSSAPVEDSGGAPPLEPQVVP  816



>ref|XP_009611240.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=811

 Score =   364 bits (935),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 198/221 (90%), Gaps = 2/221 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLE+AEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  584  RRTVAYHEAGHAVVGWFLEYAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FE +K
Sbjct  644  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDTFE-AK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY +KTAAIID+EVREW+AKAY+ TV+LIEEH+EHVAQIAELLLEK VLHQEDLV+VLG 
Sbjct  703  PYGSKTAAIIDSEVREWVAKAYDNTVKLIEEHREHVAQIAELLLEKEVLHQEDLVQVLGA  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS  122
            RPFKSSEPTNYDRF  GF E++ +E   + E K+ +D+ SS
Sbjct  763  RPFKSSEPTNYDRFTQGF-EEENSETTASTEEKTAEDNGSS  802



>emb|CDY39531.1| BnaC04g15300D [Brassica napus]
Length=822

 Score =   364 bits (935),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 198/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  654  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  713

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+ KAYE TV+LIE HKE VA+IAELLLEK VLHQ+DL++VLGE
Sbjct  714  PYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVAEIAELLLEKEVLHQDDLLKVLGE  773

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK +E TNYDRFK GF E+++ EA  T       +    PL+P+VVP
Sbjct  774  RPFKPAEVTNYDRFKSGFEENEKEEATPTVA-PVVDEGAPPPLEPQVVP  821



>emb|CDY47876.1| BnaA07g14210D [Brassica napus]
Length=830

 Score =   364 bits (935),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 197/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  602  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  661

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ +K
Sbjct  662  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFNK  721

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVREW+ KAYE TV+LIE HKE VA+IAELLLEK VLHQ+DL++VLGE
Sbjct  722  PYSNKTGAIIDEEVREWVGKAYEKTVELIETHKEKVAEIAELLLEKEVLHQDDLLKVLGE  781

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK +E TNYDRFK GF E ++ EA  T       +    PL+P+VVP
Sbjct  782  RPFKPAEVTNYDRFKSGFEESEKEEATPTVA-PVVDEGAPPPLEPQVVP  829



>ref|XP_006655377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Oryza brachyantha]
Length=798

 Score =   363 bits (933),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 202/229 (88%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  571  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  630

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+K
Sbjct  631  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTK  690

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI +HKE VA+IAE+LLEK VLHQ+DLVRVLGE
Sbjct  691  PYSNQTASIIDDEVREWVGKAYKNTVELITKHKEQVAKIAEMLLEKEVLHQDDLVRVLGE  750

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EPTNYD FK GF +D++ + ++  +N    DDD +P   EVVP
Sbjct  751  RPFKAVEPTNYDLFKQGF-QDEDNKNQEVVKNPQP-DDDGTPSLGEVVP  797



>ref|XP_009118433.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial 
[Brassica rapa]
 emb|CDY06264.1| BnaA09g49390D [Brassica napus]
Length=800

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 181/230 (79%), Positives = 200/230 (87%), Gaps = 7/230 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  576  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  635

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E  F  SK
Sbjct  636  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREEEF--SK  693

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  694  PYSNRTGALIDEEVREWVAKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLAKVLGE  753

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSS-PLQPEVVP  98
            RPFKS E TNYDRFK GF   +ET+ K+    K  +DD +S PL+P+VVP
Sbjct  754  RPFKSGETTNYDRFKSGF---EETD-KENVTVKPVEDDGASPPLEPQVVP  799



>gb|AAL36270.1| putative AAA-type ATPase [Arabidopsis thaliana]
Length=809

 Score =   363 bits (933),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 194/229 (85%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  580  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  640  MTLGGRAPEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W+AKAYE TV+L+EEHK  VA+IAELLLEK VLHQ+DL+++LGE
Sbjct  700  PYSNKTGAIIDEEVRDWVAKAYERTVELVEEHKVKVAEIAELLLEKEVLHQDDLLKILGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E ++  A          D    P +P+VVP
Sbjct  760  RPFKSAEVTNYDRFKSGFEETEKDSAATPTVEPVVDDGAPPPFEPQVVP  808



>ref|XP_007133225.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
 gb|ESW05219.1| hypothetical protein PHAVU_011G162000g [Phaseolus vulgaris]
Length=811

 Score =   364 bits (934),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 186/230 (81%), Positives = 207/230 (90%), Gaps = 1/230 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRG+AALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  581  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGSAALGFAQYVPSENLLMTKEQLFDMTC  640

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFPP E++FEMSK
Sbjct  641  MTLGGRAAEQVLVGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPPREDSFEMSK  700

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAYE TVQLIEEHKE VAQIAELLLEK VLHQEDL R+LGE
Sbjct  701  PYSSKTAAIIDSEVREWVNKAYERTVQLIEEHKEQVAQIAELLLEKEVLHQEDLHRILGE  760

Query  244  RPFKSSEPTNYDRFKDGFVEDKETE-AKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS EPTNYDRFK+GF E++E + A+    +   +   SSPL+P+VVP
Sbjct  761  RPFKSIEPTNYDRFKEGFKEEEEEKVAESIIVDVPEQGGGSSPLEPQVVP  810



>ref|NP_172231.2| FTSH protease 10 [Arabidopsis thaliana]
 sp|Q8VZI8.1|FTSHA_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 10, mitochondrial; 
Short=AtFTSH10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL36045.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AAM70517.1| At1g07510/F22G5_9 [Arabidopsis thaliana]
 gb|AEE28137.1| FTSH protease 10 [Arabidopsis thaliana]
Length=813

 Score =   363 bits (933),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 198/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+  E SK
Sbjct  646  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQRED--EFSK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  704  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLTKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  764  RPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDDGIPPLEPQVVP  812



>ref|XP_006409951.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
 gb|ESQ51404.1| hypothetical protein EUTSA_v10016261mg [Eutrema salsugineum]
Length=813

 Score =   363 bits (931),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 198/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  585  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  644

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ ++ SK
Sbjct  645  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPRDDGYDFSK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIID EVR+W++KAYE TV+LIEEHKE VAQIAELLLEK VLHQ+DL++VLGE
Sbjct  705  PYSNKTGAIIDEEVRDWVSKAYEKTVELIEEHKEQVAQIAELLLEKEVLHQDDLLKVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+E TNYDRFK GF E  E E   T       +    PL+P+VVP
Sbjct  765  RPFKSAEVTNYDRFKSGFEE-SEKEETTTTVTPVVDEGAPPPLEPQVVP  812



>ref|XP_011032280.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
 ref|XP_011042728.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Populus euphratica]
Length=813

 Score =   362 bits (928),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 180/229 (79%), Positives = 198/229 (86%), Gaps = 3/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL TKEQLFDMTC
Sbjct  587  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLFTKEQLFDMTC  646

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E++FEM+K
Sbjct  647  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQKEDSFEMTK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T AIID EVREW+ KAY  T+QL+E+HKE VAQIAELLLEK VLHQEDL+R+LGE
Sbjct  707  PYSNETGAIIDGEVREWVGKAYGHTLQLVEKHKEQVAQIAELLLEKEVLHQEDLIRILGE  766

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKSSE +NYD FK GF E +E + +  A      +D SSP+  EVVP
Sbjct  767  RPFKSSEASNYDIFKQGFEE-EEEKVETPASTTDGDEDQSSPI--EVVP  812



>gb|AAK77908.1|AF397903_1 AAA-metalloprotease FtsH [Pisum sativum]
Length=810

 Score =   361 bits (927),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 199/229 (87%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEH +PLLKVTIVPRGTAALGFAQYVPNENLL TKEQLFDMTC
Sbjct  583  RRTVAYHEAGHAVTGWFLEHTDPLLKVTIVPRGTAALGFAQYVPNENLLKTKEQLFDMTC  642

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E++ EM+K
Sbjct  643  MTLGGRAAEKVLIGTISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDSMEMTK  702

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAYE T+QLIEEHK  VA+IAELLLEK VLHQEDL+RVLGE
Sbjct  703  PYSSKTGAIIDTEVREWVNKAYERTIQLIEEHKAKVAEIAELLLEKEVLHQEDLLRVLGE  762

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPF+S+EPT+YDRFK GF +  E +  +T  N++  D  SSPL+PEVVP
Sbjct  763  RPFQSAEPTHYDRFKLGFQD--EEKVVETTVNEAKDDGGSSPLEPEVVP  809



>emb|CDY09913.1| BnaC08g45380D [Brassica napus]
Length=767

 Score =   360 bits (923),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 195/228 (86%), Gaps = 5/228 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  543  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  602

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E  F  SK
Sbjct  603  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREEEF--SK  660

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+AKAY+ TV+LIEEHKE VA+IAELLLEK VLHQ+DL +VLGE
Sbjct  661  PYSNRTGALIDEEVREWVAKAYKRTVELIEEHKEQVAEIAELLLEKEVLHQDDLAKVLGE  720

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFKS E TNYDRFK GF   +ET+ ++        D  S PL+P+VV
Sbjct  721  RPFKSGETTNYDRFKSGF---EETDKENVTVKPVEDDGASPPLEPQVV  765



>ref|XP_002889652.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65911.1| FTSH10 [Arabidopsis lyrata subsp. lyrata]
Length=813

 Score =   361 bits (926),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 197/229 (86%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDK+GLLSFP  E+ F  SK
Sbjct  646  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLLSFPQREDEF--SK  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  704  PYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLTKVLGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS E TNYDRFK GF E ++   K++   K  +D    PL+P+VVP
Sbjct  764  RPFKSGERTNYDRFKSGFEETEKESEKESVPVKPVEDGGVPPLEPQVVP  812



>ref|XP_008784613.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=817

 Score =   360 bits (924),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 188/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASE+V+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDK+GL+SFP  ++AFEMSK
Sbjct  652  MTLGGRASEEVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKIGLVSFPQRDDAFEMSK  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAY+ TV+LI+EHK+H+ +IAELLLEK VLHQ+DLV VLGE
Sbjct  712  PYSSKTGAIIDAEVREWVTKAYQRTVELIKEHKDHITRIAELLLEKEVLHQDDLVGVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAE  152
            R FKSSEPTNYDRFK GF E+ E E     E
Sbjct  772  RTFKSSEPTNYDRFKQGFQEEDEREPSKVVE  802



>gb|EAY76461.1| hypothetical protein OsI_04395 [Oryza sativa Indica Group]
Length=802

 Score =   357 bits (917),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPN+NLLMTKEQLFDMTC
Sbjct  579  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNDNLLMTKEQLFDMTC  638

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEMSK
Sbjct  639  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDGFEMSK  698

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++TA+IID EVREW+AKAYE TV+LI++HK+ VAQIAELLLEK VLHQ+DLV+VLGE
Sbjct  699  PYSSQTASIIDTEVREWVAKAYEKTVELIKQHKDQVAQIAELLLEKEVLHQDDLVQVLGE  758

Query  244  RPFKSSEPTNYDRFKDGFVED  182
            RPFK+ EPTNYDRFK GF ++
Sbjct  759  RPFKTLEPTNYDRFKQGFQDE  779



>ref|NP_001044774.1| Os01g0842600 [Oryza sativa Japonica Group]
 sp|Q8S2A7.1|FTSH3_ORYSJ RecName: Full=ATP-dependent zinc metalloprotease FTSH 3, mitochondrial; 
Short=OsFTSH3; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAB86453.1| putative AAA-metalloprotease FtsH [Oryza sativa Japonica Group]
 dbj|BAF06688.1| Os01g0842600 [Oryza sativa Japonica Group]
 gb|EAZ14117.1| hypothetical protein OsJ_04041 [Oryza sativa Japonica Group]
 dbj|BAG94510.1| unnamed protein product [Oryza sativa Japonica Group]
Length=802

 Score =   357 bits (917),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 188/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPN+NLLMTKEQLFDMTC
Sbjct  579  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNDNLLMTKEQLFDMTC  638

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ FEMSK
Sbjct  639  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDGFEMSK  698

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++TA+IID EVREW+AKAYE TV+LI++HK+ VAQIAELLLEK VLHQ+DLV+VLGE
Sbjct  699  PYSSQTASIIDTEVREWVAKAYEKTVELIKQHKDQVAQIAELLLEKEVLHQDDLVQVLGE  758

Query  244  RPFKSSEPTNYDRFKDGFVED  182
            RPFK+ EPTNYDRFK GF ++
Sbjct  759  RPFKTLEPTNYDRFKQGFQDE  779



>ref|XP_006845226.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
 gb|ERN06901.1| hypothetical protein AMTR_s00005p00256120 [Amborella trichopoda]
Length=825

 Score =   358 bits (918),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 195/229 (85%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRG+AALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  597  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAALGFAQYVPNENLLMTKEQLFDMTC  656

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQ++LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E AFEM+K
Sbjct  657  MTLGGRASEQILLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREEAFEMTK  716

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN T  IID EVR+W++ AY+ T++LIEE +E VA++AELLLEK VLHQ+DL++VLGE
Sbjct  717  PYSNGTGEIIDKEVRDWVSNAYKRTLELIEEKREQVAKVAELLLEKEVLHQDDLLKVLGE  776

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RP+KSSEPTNYDRF  GF E++E E  D        +DD+  L   VVP
Sbjct  777  RPYKSSEPTNYDRFTKGFQEEQE-EKSDAPSEGVVMEDDTPSLDGAVVP  824



>gb|KJB16965.1| hypothetical protein B456_002G257200 [Gossypium raimondii]
Length=782

 Score =   356 bits (914),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD+TC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDVTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFSDK GLLSFP    AFEM+ 
Sbjct  648  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKAGLLSFPRTHYAFEMTM  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+ T AIID+EVREW+ KAY+ TVQLIEEHKEHVAQI ELLLEK +LHQEDLVRVLGE
Sbjct  708  PYSSTTGAIIDSEVREWVGKAYDRTVQLIEEHKEHVAQITELLLEKDILHQEDLVRVLGE  767

Query  244  RPFKSSEPTNYDRF  203
            RPFKSSEPTNYDRF
Sbjct  768  RPFKSSEPTNYDRF  781



>dbj|BAJ98147.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91973.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK03446.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93081.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=811

 Score =   355 bits (912),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 196/228 (86%), Gaps = 1/228 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  582  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  642  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMNK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID EVREW+AKAY+ TV L+ E KE VA IAELLLEK VLHQ+DL RVLG+
Sbjct  702  PYSNQTASIIDTEVREWVAKAYKRTVDLLTEKKEQVALIAELLLEKEVLHQDDLTRVLGD  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVV  101
            RPFK++E TNYD FK GF +D+E +  +  ++    DDD S + P VV
Sbjct  762  RPFKAAELTNYDLFKQGF-QDEEGKTAEPTKDTEVPDDDGSAVLPNVV  808



>ref|XP_006644995.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Oryza brachyantha]
Length=807

 Score =   355 bits (910),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 193/215 (90%), Gaps = 0/215 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHA+PLLKVTIVPRGTAALGFAQYVPN+NLLMTKEQLFDMTC
Sbjct  584  RRTVAYHESGHAVAGWFLEHADPLLKVTIVPRGTAALGFAQYVPNDNLLMTKEQLFDMTC  643

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++ KISTGAQNDLEKVTKMTYAQVA+YGFS+KVGLLSFP  E+ FEMS+
Sbjct  644  MTLGGRAAEEVLIRKISTGAQNDLEKVTKMTYAQVAIYGFSEKVGLLSFPQREDGFEMSR  703

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++TA+IID EVREW+AKAYE TV+LI++HK+ VAQIAELLLEK V+HQ+DLVR+LGE
Sbjct  704  PYSSQTASIIDTEVREWVAKAYETTVELIKKHKDQVAQIAELLLEKEVIHQDDLVRILGE  763

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKST  140
            RPFK+ EPTNYDRFK GF ++  + + + ++   T
Sbjct  764  RPFKTLEPTNYDRFKQGFEDEGSSNSAEVSDVDGT  798



>ref|XP_004970544.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Setaria italica]
Length=810

 Score =   354 bits (908),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 171/216 (79%), Positives = 192/216 (89%), Gaps = 1/216 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  588  RQTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ F MSK
Sbjct  648  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDGFGMSK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PY  +TA+IID EVREW+AKAYE T+ LI+ HKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  708  PYGGETASIIDTEVREWVAKAYEKTLDLIKTHKEQVAQIAELLLEKEVLHQDDLVRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGF-VEDKETEAKDTAENKST  140
            RPFK++EPTNYDRFK GF VE+ +  A+ +  N S+
Sbjct  768  RPFKTAEPTNYDRFKQGFQVEESDKSAEVSDANPSS  803



>ref|XP_003606687.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES88884.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=807

 Score =   353 bits (907),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 174/229 (76%), Positives = 195/229 (85%), Gaps = 4/229 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEH EPLLKVTIVPRGTAALGFAQYVP+ENLL TKEQL DMTC
Sbjct  582  RRTVAYHEAGHAVAGWFLEHCEPLLKVTIVPRGTAALGFAQYVPSENLLRTKEQLLDMTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G ISTGAQNDLEKVTKMTYAQVA+YGFS+KVGLLSFP NE+ F   K
Sbjct  642  MTLGGRAAEQVLIGAISTGAQNDLEKVTKMTYAQVAIYGFSEKVGLLSFPQNEDQF--GK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  T  IID EVR+W+  AYE TVQLIEEHKE +AQIAELLLEK VLHQEDLVR+LGE
Sbjct  700  PYSGDTGNIIDQEVRDWVNHAYERTVQLIEEHKEKLAQIAELLLEKEVLHQEDLVRILGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFKS+EPTNYDRFK GF +  E +A +T  +++ +   SSPL+PEVVP
Sbjct  760  RPFKSAEPTNYDRFKLGFQD--EEKAAETTVDEAEEGSGSSPLEPEVVP  806



>ref|XP_008799731.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 8, mitochondrial-like 
[Phoenix dactylifera]
Length=820

 Score =   354 bits (908),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLL+TKEQLFDMTC
Sbjct  592  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLLTKEQLFDMTC  651

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
             TLGGRASE+V+LGKISTGAQ+DLEKVTKMTYAQVAVYGFSDKVGLLSFP  ++   M  
Sbjct  652  RTLGGRASEEVLLGKISTGAQDDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRDDTSAMIM  711

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW++KAY+ TV+LI+EH +HV QIAELLLEK VL Q+DLVRVLGE
Sbjct  712  PYSSKTAAIIDAEVREWVSKAYQRTVELIKEHTDHVIQIAELLLEKEVLRQDDLVRVLGE  771

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK  EPTNYDRFK GF E+ + E ++ ++    +DD SS L  EVVP
Sbjct  772  RPFKLGEPTNYDRFKQGFQEEVDDEGREPSKVME-EDDRSSSLSGEVVP  819



>gb|EMS50561.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=748

 Score =   352 bits (902),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  518  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  577

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP   + FEM+K
Sbjct  578  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQRGDGFEMNK  637

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID EVREW+AKAY+ TV+L+ E KE VA IAELLLEK VLHQ+DL RVLG+
Sbjct  638  PYSNQTASIIDTEVREWVAKAYKRTVELLTEKKEQVALIAELLLEKEVLHQDDLTRVLGD  697

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD--SSPLQPEVVP  98
            RPFK++E TNYD FK GF +D++++  + A+N    DDD  ++ L   VVP
Sbjct  698  RPFKAAELTNYDLFKQGF-QDEDSKTTEPAKNAEVPDDDGPAAALPDVVVP  747



>gb|EMT04659.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=703

 Score =   350 bits (899),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  473  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  532

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++G+ISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  533  MTLGGRAAEEVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQREDGFEMNK  592

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID EVREW+AKAY+ TV L+ E KE VA IAELLLEK VLHQ+DL RVLG+
Sbjct  593  PYSNQTASIIDTEVREWVAKAYKRTVDLLTEKKEQVALIAELLLEKEVLHQDDLTRVLGD  652

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDD--SSPLQPEVVP  98
            RPFK++E TNYD FK GF +D+E +  + A+     DDD  ++ L   VVP
Sbjct  653  RPFKAAELTNYDLFKQGF-QDEEGKTTEPAKPAEVPDDDGPAAALPDVVVP  702



>ref|XP_003567261.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 3, mitochondrial-like 
[Brachypodium distachyon]
Length=635

 Score =   348 bits (892),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 196/229 (86%), Gaps = 9/229 (4%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R T AYH SGHAVAG FLEHAE LLKVTIVPRGTAALGFAQYV N+NLLMTKEQLFDMTC
Sbjct  415  RLTVAYHESGHAVAGWFLEHAELLLKVTIVPRGTAALGFAQYVQNDNLLMTKEQLFDMTC  474

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVA+YGFS+KVGLLSFP  ++ FEM+K
Sbjct  475  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVALYGFSEKVGLLSFPQRDDGFEMNK  534

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++TA+IID EVREW+A+AY+ T++LI++HKE VAQIAELLLEK VLHQ+DLVRVLGE
Sbjct  535  PYSSQTASIIDTEVREWVAEAYKHTIELIKKHKEQVAQIAELLLEKEVLHQDDLVRVLGE  594

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK+ EP NYDRFK GF+        D   NKST+ D SS L  E VP
Sbjct  595  RPFKTVEPINYDRFKHGFI--------DADNNKSTEVDPSSSLG-EAVP  634



>ref|XP_007132051.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
 gb|ESW04045.1| hypothetical protein PHAVU_011G062800g [Phaseolus vulgaris]
Length=809

 Score =   350 bits (899),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R T AYH SGHAVAG FLEHAEPLLKVTIVPRG+AALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  580  RHTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGSAALGFAQYVPSENLLMTKEQLFDMTC  639

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E++FEMSK
Sbjct  640  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPSREDSFEMSK  699

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAA+ID+EVR+W+ KAYE T+ LIEEHKE VAQ+A+LLLEK VLHQEDL  +LGE
Sbjct  700  PYSSKTAALIDSEVRDWVNKAYERTLHLIEEHKEQVAQLAQLLLEKEVLHQEDLRGILGE  759

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++EPTNYDRFK+GF E++E  A+ +  +   +   SSPL+P+VVP
Sbjct  760  RPFKATEPTNYDRFKEGFEEEEEKVAESSIVDVPEEGGGSSPLEPQVVP  808



>gb|AAF79577.1|AC022464_35 F22G5.10 [Arabidopsis thaliana]
Length=843

 Score =   351 bits (901),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 178/251 (71%), Positives = 198/251 (79%), Gaps = 24/251 (10%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQ----------------------VMLGKISTGAQNDLEKVTKMTYAQVAVY  491
            MTLGGRA+EQ                      V++G+ISTGAQNDLEKVTKMTYAQVAVY
Sbjct  654  MTLGGRAAEQLVGRQFVELFPLTEVKNSLRFQVLIGRISTGAQNDLEKVTKMTYAQVAVY  713

Query  490  GFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQ  311
            GFSDK+GLLSFP  E+  E SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQ
Sbjct  714  GFSDKIGLLSFPQRED--EFSKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQ  771

Query  310  IAELLLEKGVLHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD  131
            IAELLLEK VLHQ+DL +VLGERPFKS E TNYDRFK GF E ++   K++   K  +DD
Sbjct  772  IAELLLEKEVLHQDDLTKVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDD  831

Query  130  DSSPLQPEVVP  98
               PL+P+VVP
Sbjct  832  GIPPLEPQVVP  842



>gb|EYU38460.1| hypothetical protein MIMGU_mgv1a001496mg [Erythranthe guttata]
Length=808

 Score =   350 bits (898),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 175/230 (76%), Positives = 191/230 (83%), Gaps = 15/230 (7%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G  LEHA+PLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQLFDMTC
Sbjct  594  RRTVAYHESGHAVVGWLLEHADPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTC  653

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  E+ +EM K
Sbjct  654  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQREDGYEMMK  713

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID EVREW AKAY+ TV+LIEEHKE VAQIAELLLEK  LHQEDLV+VLG 
Sbjct  714  PYSSKTAAIIDTEVREWAAKAYKRTVELIEEHKEQVAQIAELLLEKETLHQEDLVQVLGP  773

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVPV  95
            RPF+SSE TNYDR+K GF ++   EA                + PEVVPV
Sbjct  774  RPFQSSEMTNYDRYKKGFQDEAAEEA---------------VVLPEVVPV  808



>gb|KCW85527.1| hypothetical protein EUGRSUZ_B02324 [Eucalyptus grandis]
Length=799

 Score =   349 bits (896),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 198/230 (86%), Gaps = 6/230 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTA LGFAQYVPNE+LL+TKEQLFD TC
Sbjct  574  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTANLGFAQYVPNEDLLVTKEQLFDRTC  633

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+EQV+LGKI+TGA++DLE VTK TYAQVAVYGFSDKVGLLSFP     +EM+K
Sbjct  634  MALGGRAAEQVLLGKITTGARSDLEGVTKATYAQVAVYGFSDKVGLLSFP---QGYEMTK  690

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAYE T++LI EHKEHVAQIAELLLEK VLH EDL+RVLGE
Sbjct  691  PYSSKTAAIIDSEVREWVTKAYEHTLELITEHKEHVAQIAELLLEKEVLHHEDLLRVLGE  750

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKSSE TNYDR+K GF+E  E ++ +T+E    +DD+S  PL P+VVP
Sbjct  751  RPFKSSEVTNYDRYKLGFLE--EEKSAETSETDVVEDDESPPPLDPQVVP  798



>ref|XP_010043510.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Eucalyptus grandis]
Length=813

 Score =   349 bits (896),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 198/230 (86%), Gaps = 6/230 (3%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEH EPLLKVTIVPRGTA LGFAQYVPNE+LL+TKEQLFD TC
Sbjct  588  RRTVAYHESGHAVAGWFLEHTEPLLKVTIVPRGTANLGFAQYVPNEDLLVTKEQLFDRTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+EQV+LGKI+TGA++DLE VTK TYAQVAVYGFSDKVGLLSFP     +EM+K
Sbjct  648  MALGGRAAEQVLLGKITTGARSDLEGVTKATYAQVAVYGFSDKVGLLSFP---QGYEMTK  704

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KTAAIID+EVREW+ KAYE T++LI EHKEHVAQIAELLLEK VLH EDL+RVLGE
Sbjct  705  PYSSKTAAIIDSEVREWVTKAYEHTLELITEHKEHVAQIAELLLEKEVLHHEDLLRVLGE  764

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS-SPLQPEVVP  98
            RPFKSSE TNYDR+K GF+E  E ++ +T+E    +DD+S  PL P+VVP
Sbjct  765  RPFKSSEVTNYDRYKLGFLE--EEKSAETSETDVVEDDESPPPLDPQVVP  812



>ref|XP_002458748.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
 gb|EES03868.1| hypothetical protein SORBIDRAFT_03g039540 [Sorghum bicolor]
Length=808

 Score =   348 bits (894),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 188/211 (89%), Gaps = 5/211 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPN++LLMTKEQLFDMTC
Sbjct  589  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNDSLLMTKEQLFDMTC  648

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E++++GKISTGAQNDLEKVT+MTYAQVAVYGFS+KVGLLSFP  +  FEMSK
Sbjct  649  MTLGGRAAEEILIGKISTGAQNDLEKVTQMTYAQVAVYGFSEKVGLLSFP--QKGFEMSK  706

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+ TA+IID EVREW+AKAY+ TV LI+ HKE VAQIAELLLEK VLH +DLVRVLGE
Sbjct  707  PYSSHTASIIDTEVREWVAKAYQRTVDLIKTHKEQVAQIAELLLEKEVLHHDDLVRVLGE  766

Query  244  RPFKSSEPTNYDRFKDGF---VEDKETEAKD  161
            RPFK++EPTNYDRFK GF   V DK +E  D
Sbjct  767  RPFKTAEPTNYDRFKQGFQAEVVDKSSEVAD  797



>gb|EPS71434.1| hypothetical protein M569_03325, partial [Genlisea aurea]
Length=778

 Score =   346 bits (887),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/198 (83%), Positives = 179/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  579  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  638

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVT+MTYAQVAVYGFSDKVGLLSFP  E+ FEM+K
Sbjct  639  MTLGGRAAEQVLLGKISTGAQNDLEKVTRMTYAQVAVYGFSDKVGLLSFPQREDGFEMTK  698

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKTAAIID EVREWIA+AYE T+ LIEE +E VA++AELLL K  LHQEDLV+ LGE
Sbjct  699  PYSNKTAAIIDGEVREWIARAYEKTLSLIEERREEVAKVAELLLAKETLHQEDLVQALGE  758

Query  244  RPFKSSEPTNYDRFKDGF  191
            RPF+ +E +NYD FK GF
Sbjct  759  RPFRPAETSNYDIFKHGF  776



>ref|XP_001785268.1| predicted protein [Physcomitrella patens]
 gb|EDQ49920.1| predicted protein [Physcomitrella patens]
Length=693

 Score =   340 bits (873),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 165/229 (72%), Positives = 188/229 (82%), Gaps = 2/229 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV+G FLEHAEPLLKV+IVPRGTAALGFAQY+PNENLLMTKEQL DMTC
Sbjct  451  RRTVAYHEAGHAVSGWFLEHAEPLLKVSIVPRGTAALGFAQYLPNENLLMTKEQLLDMTC  510

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++GKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPP ++ FEMSK
Sbjct  511  MTLGGRAAEQVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPKDDGFEMSK  570

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T  IID EVR+W+A AY  T+ LI EHK  V  +A  LLEK VLHQEDLV +LGE
Sbjct  571  PYSNETGEIIDQEVRDWVASAYARTLALITEHKAGVEALALKLLEKEVLHQEDLVAILGE  630

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++E +NYD+FK GF   +E +AK  +   S  +D  SP QP   P
Sbjct  631  RPFKNAELSNYDKFKLGFAPSREDQAKLGSSQPS--EDGISPEQPSSTP  677



>ref|XP_004507174.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=800

 Score =   343 bits (879),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 189/229 (83%), Gaps = 11/229 (5%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEH EPLLKVTIVPRGTAALGFAQY+PNENLLMTKE LFD TC
Sbjct  582  RRTVAYHEAGHAVVGWFLEHTEPLLKVTIVPRGTAALGFAQYLPNENLLMTKEHLFDRTC  641

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E++++G I+TGAQNDLEKVTKMTY QVAVYGFSDKVGLLSFP  E+++ M+K
Sbjct  642  MTLGGRAAEEILIGTITTGAQNDLEKVTKMTYDQVAVYGFSDKVGLLSFPQREDSYGMAK  701

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID EVREW+ KAYE T+QLIE+HKE VAQIAELLLEK VLHQ+DL +VLGE
Sbjct  702  PYSSKTGAIIDTEVREWVNKAYEHTLQLIEKHKEQVAQIAELLLEKEVLHQDDLRQVLGE  761

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK++E +NYDRFK GF ED +                SSPL PEVVP
Sbjct  762  RPFKNAELSNYDRFKLGFQEDDKEGG-----------GSSSPLDPEVVP  799



>gb|KJB36698.1| hypothetical protein B456_006G171800 [Gossypium raimondii]
Length=617

 Score =   337 bits (865),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 191/230 (83%), Gaps = 16/230 (7%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRG A LGFAQYVPNENLLMTKEQL D+ C
Sbjct  402  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGIATLGFAQYVPNENLLMTKEQLSDVAC  461

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA++QV+L KISTGAQ+DL+KVTKMTYAQVAVYGFSDKVGLLS  P  +AFEM+K
Sbjct  462  MTLGGRAAKQVLLRKISTGAQSDLKKVTKMTYAQVAVYGFSDKVGLLSV-PQRDAFEMTK  520

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIID+EVREW+ KAYE T+QLIEEHKEHVA             QEDL+R+LG+
Sbjct  521  PYSSKTGAIIDSEVREWVVKAYEPTMQLIEEHKEHVA-------------QEDLIRILGK  567

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTA-ENKSTKDDDSSPLQPEVVP  98
            RPFKSSEPTNY+RFK GF E+ + E KDT  E ++  DD S+PL+PEVVP
Sbjct  568  RPFKSSEPTNYERFKQGFQEENK-EPKDTKDEGRTAGDDGSTPLKPEVVP  616



>ref|NP_001145329.1| uncharacterized protein LOC100278654 [Zea mays]
 gb|ACG46821.1| hypothetical protein [Zea mays]
Length=485

 Score =   332 bits (852),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 1/191 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC
Sbjct  247  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  306

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  +  FE+SK
Sbjct  307  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKDGGFELSK  366

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+TA+IID+EVREW+ KAY+ TV+LI EHKE VAQIAELLLEK VLHQ+DL RVLGE
Sbjct  367  PYSNQTASIIDDEVREWVGKAYKKTVELITEHKEQVAQIAELLLEKEVLHQDDLTRVLGE  426

Query  244  RPFKS-SEPTN  215
            RPFK+  +PT 
Sbjct  427  RPFKALDQPTT  437



>ref|XP_008358519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 10, mitochondrial-like 
[Malus domestica]
Length=800

 Score =   341 bits (875),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAV G FLEHAEPLLKVTIVPRGTAALGFAQYV NENLLMTKEQLFDMTC
Sbjct  586  RRTVAYHESGHAVTGWFLEHAEPLLKVTIVPRGTAALGFAQYVLNENLLMTKEQLFDMTC  645

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKIST AQNDLEKVTKMTYAQ+AV+GF+DKVGLLSFP  E +FEMSK
Sbjct  646  MTLGGRAAEQVMLGKISTVAQNDLEKVTKMTYAQIAVHGFNDKVGLLSFPQREESFEMSK  705

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT A+ID+EVREW+ KAY  TV+L+EEHKE VAQIAELLLEK VLHQ+DL++VLG 
Sbjct  706  PYSSKTGALIDSEVREWVGKAYARTVELVEEHKEQVAQIAELLLEKEVLHQDDLLKVLGG  765

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTA  155
            RP+K +E TNYDRFK+GF    + +  +TA
Sbjct  766  RPYKPAEATNYDRFKEGFEGKGDEKTVETA  795



>emb|CDM84966.1| unnamed protein product [Triticum aestivum]
Length=760

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 0/214 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQ FD TC
Sbjct  540  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQFFDRTC  599

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAVYGFS+KVGLLSFP  ++ F M K
Sbjct  600  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYQQVAVYGFSEKVGLLSFPQRDDGFWMDK  659

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS +TA++ID EVRE +AKAY  T +LI +HK+ VAQ+AELLLEK VLHQ+DL+RVLGE
Sbjct  660  PYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVAQVAELLLEKEVLHQDDLIRVLGE  719

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKS  143
            RPFK+ EPTNYDRFK GF++ +++++ +   + S
Sbjct  720  RPFKTDEPTNYDRFKQGFMDSEDSKSGEVDPSSS  753



>gb|EMS48627.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Triticum 
urartu]
Length=808

 Score =   336 bits (861),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/229 (73%), Positives = 189/229 (83%), Gaps = 9/229 (4%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQ FD TC
Sbjct  588  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQFFDRTC  647

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAVYGFS+KVGLLSFP   + F M K
Sbjct  648  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYEQVAVYGFSEKVGLLSFPQRYDGFGMDK  707

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS +TA++ID EVRE +AKAY  T +LI +HK+ VAQ+AELLLEK VLHQ+DLVRVLGE
Sbjct  708  PYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVAQVAELLLEKEVLHQDDLVRVLGE  767

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            RPFK  EPTNYDRFK GF+        D+ ++KS + D SS +  E VP
Sbjct  768  RPFKPDEPTNYDRFKQGFM--------DSEDSKSAEVDPSSSVG-EAVP  807



>gb|EMT07840.1| Cell division protease ftsH-like protein, mitochondrial [Aegilops 
tauschii]
Length=953

 Score =   338 bits (866),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH SGHAVAG FLEHAEPLLKVTIVPRGTAALGFAQYVP+ENLLMTKEQ FD TC
Sbjct  602  RRTVAYHESGHAVAGWFLEHAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQFFDRTC  661

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+V++GKISTGAQNDLEKVTKMTY QVAVYGFS+KVGLLSFP   + F M K
Sbjct  662  MTLGGRAAEEVLIGKISTGAQNDLEKVTKMTYEQVAVYGFSEKVGLLSFPQRYDGFGMDK  721

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS +TA++ID EVRE +AKAY  T +LI +HK+ VAQ+AELLLEK VLHQ+DLVRVLGE
Sbjct  722  PYSGQTASMIDTEVRELVAKAYNTTTELIRKHKDKVAQVAELLLEKEVLHQDDLVRVLGE  781

Query  244  RPFKSSEPTNYDRFKDGFVEDKET  173
            RPFK++EPTNYDRFK GF++ +++
Sbjct  782  RPFKTAEPTNYDRFKQGFMDSEDS  805



>ref|XP_006845235.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]
 gb|ERN06910.1| hypothetical protein AMTR_s00005p00257870 [Amborella trichopoda]
Length=369

 Score =   317 bits (811),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 149/203 (73%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLE+AEPL KVTIV RGTAALGFAQY+PNENLLMTKEQLFD+TC
Sbjct  165  RRTVAYHEAGHAVAGWFLEYAEPLFKVTIVRRGTAALGFAQYIPNENLLMTKEQLFDITC  224

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRASEQ++LGKISTGAQ+DLEK TKMTYAQVAVYGFS+KVGLLSFP  +  +E +K
Sbjct  225  MTLGGRASEQILLGKISTGAQDDLEKETKMTYAQVAVYGFSEKVGLLSFPQKDEGYERTK  284

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T  IID EVR+WI KAY+ T++LIEE +  V +IAELLL+K VLH+ DL+++LGE
Sbjct  285  PYSNRTEEIIDKEVRDWITKAYDRTLELIEEKRGQVVKIAELLLQKEVLHKHDLLKMLGE  344

Query  244  RPFKSSEPTNYDRFKDGFVEDKE  176
            RPF SSEPTNYD F  GF ++++
Sbjct  345  RPFMSSEPTNYDPFTKGFQDEQQ  367



>ref|XP_001782950.1| predicted protein [Physcomitrella patens]
 gb|EDQ52248.1| predicted protein [Physcomitrella patens]
Length=872

 Score =   326 bits (835),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLE+AEPLLKV+IVPRGTAALGFAQY+PNENLLMTKEQL DMTC
Sbjct  630  RRTVAYHEAGHAVTGWFLEYAEPLLKVSIVPRGTAALGFAQYLPNENLLMTKEQLLDMTC  689

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFPP ++  EMSK
Sbjct  690  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPPKDDGLEMSK  749

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T  IID E R+W+A AYE T+ LI  HKE V  +A  LLEK VLHQEDLV +LGE
Sbjct  750  PYSNETGEIIDKEARDWVALAYERTLALITRHKEGVEALALKLLEKEVLHQEDLVAILGE  809

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAK  164
            RPFK +E +NYD+FK GF   ++ + K
Sbjct  810  RPFKHAELSNYDKFKLGFPSSRDDQVK  836



>gb|KEH23850.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=701

 Score =   320 bits (820),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEH +PLLKVTIVPRGT+ALGFAQYVPNENLLMTKEQLFD TC
Sbjct  502  RRTVAYHEAGHAVAGWFLEHTDPLLKVTIVPRGTSALGFAQYVPNENLLMTKEQLFDRTC  561

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G ISTGAQ+DLEKVTKMTYAQVAVYGFS+KVGLLSFP  E++ EMSK
Sbjct  562  MTLGGRAAEQVLIGTISTGAQDDLEKVTKMTYAQVAVYGFSEKVGLLSFPQKEDSLEMSK  621

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSNKT AIIDNEVREW+ KAYE TVQLIE+ KE VAQ+AELLLEK VLHQ+DL+ +LG 
Sbjct  622  PYSNKTGAIIDNEVREWVDKAYERTVQLIEKQKEKVAQLAELLLEKEVLHQDDLLPILGV  681

Query  244  RPFKSSE  224
            RPFKS+E
Sbjct  682  RPFKSTE  688



>ref|XP_001759881.1| predicted protein [Physcomitrella patens]
 gb|EDQ75385.1| predicted protein [Physcomitrella patens]
Length=670

 Score =   319 bits (817),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLE+AEPLLKV+IVPRGTAALGFAQY+PNENLLMTKEQL DMTC
Sbjct  428  RRTVAYHEAGHAVTGWFLEYAEPLLKVSIVPRGTAALGFAQYLPNENLLMTKEQLLDMTC  487

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV+LGKISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFPP ++  EMSK
Sbjct  488  MTLGGRAAEQVLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPPKDDGLEMSK  547

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYSN+T  IID EVR+W+  AY  T+ LI +HK  V  +A  LLEK VLHQEDLV +LG 
Sbjct  548  PYSNETGEIIDQEVRDWMGTAYARTLALITKHKAGVEALALRLLEKEVLHQEDLVAILGP  607

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAK  164
            RPF  SE +NYD+FK GF   KE +AK
Sbjct  608  RPFHHSELSNYDKFKLGFEPSKEDQAK  634



>gb|AES75793.2| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=681

 Score =   312 bits (800),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 5/210 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GH VAG FLEH EPLLKVTIVPRGTAALGFAQ+VPN++ LMTKEQLFD TC
Sbjct  459  RRTVAYHEAGHVVAGWFLEHTEPLLKVTIVPRGTAALGFAQFVPNDDHLMTKEQLFDRTC  518

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQV VYGFS+KVGLLSFP  E++FE SK
Sbjct  519  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVTVYGFSEKVGLLSFPSIEDSFETSK  578

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++T+AIIDNEVR+W+ KAY+ T++LIEE+K  VA++AELLLEK VLHQ++L++VLG 
Sbjct  579  PYSSETSAIIDNEVRDWVKKAYKHTIELIEEYKGKVAEVAELLLEKEVLHQDELLKVLGV  638

Query  244  R-PFKSSEPTNYDRFKDGFVEDKETEAKDT  158
            R PFKS+E  NYD+ K G     + EAKD 
Sbjct  639  RLPFKSAEHDNYDQIKLGI----QDEAKDV  664



>ref|XP_003619575.1| Cell division protease ftsH-like protein [Medicago truncatula]
Length=765

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 5/210 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GH VAG FLEH EPLLKVTIVPRGTAALGFAQ+VPN++ LMTKEQLFD TC
Sbjct  489  RRTVAYHEAGHVVAGWFLEHTEPLLKVTIVPRGTAALGFAQFVPNDDHLMTKEQLFDRTC  548

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G+ISTGAQNDLEKVTKMTYAQV VYGFS+KVGLLSFP  E++FE SK
Sbjct  549  MTLGGRAAEQVLIGRISTGAQNDLEKVTKMTYAQVTVYGFSEKVGLLSFPSIEDSFETSK  608

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++T+AIIDNEVR+W+ KAY+ T++LIEE+K  VA++AELLLEK VLHQ++L++VLG 
Sbjct  609  PYSSETSAIIDNEVRDWVKKAYKHTIELIEEYKGKVAEVAELLLEKEVLHQDELLKVLGV  668

Query  244  R-PFKSSEPTNYDRFKDGFVEDKETEAKDT  158
            R PFKS+E  NYD+ K G     + EAKD 
Sbjct  669  RLPFKSAEHDNYDQIKLGI----QDEAKDV  694



>ref|XP_003624038.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AES80256.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=643

 Score =   308 bits (788),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 2/189 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEH EPLLKVTIVPRGTAALGFAQYV NENLLMTKEQLFD TC
Sbjct  454  RRTIAYHEAGHAVVGWFLEHTEPLLKVTIVPRGTAALGFAQYVSNENLLMTKEQLFDRTC  513

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQV++G ISTGAQNDLEKVTKMTYAQVA+YGFS+KVGLLSFP  E++ E SK
Sbjct  514  MTLGGRAAEQVLIGTISTGAQNDLEKVTKMTYAQVAIYGFSEKVGLLSFPQREDSSETSK  573

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT AIIDNEVREW+ KAY+ T+QLIEE K  VA+IAELLLEK VLHQ+DL++VLG 
Sbjct  574  PYSSKTGAIIDNEVREWVNKAYKHTIQLIEERKGKVAEIAELLLEKEVLHQDDLLQVLGP  633

Query  244  R--PFKSSE  224
            R  PFKS+E
Sbjct  634  RPSPFKSAE  642



>ref|XP_002981661.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
 gb|EFJ17143.1| hypothetical protein SELMODRAFT_115113, partial [Selaginella 
moellendorffii]
Length=737

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  RRT AYH +GHAVAG FLEHAEPL+KV+IVPRG+AALGFAQY PNENLLMTKEQ+ D
Sbjct  502  PEERRTVAYHEAGHAVAGWFLEHAEPLIKVSIVPRGSAALGFAQYFPNENLLMTKEQMLD  561

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
            MTCM LGGRA+EQVMLGKISTGAQNDLE+VT++TYAQVAVYGFS+KVGLLSFP  E+  E
Sbjct  562  MTCMALGGRAAEQVMLGKISTGAQNDLERVTRLTYAQVAVYGFSEKVGLLSFPQKEDGME  621

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            +SKPYSN+T  +ID EVREW  +AY+ TV L+EEHKE + ++A+ LL + VLH  DLV V
Sbjct  622  LSKPYSNETGELIDREVREWTDRAYKRTVALLEEHKEGLEKLAQQLLAREVLHYNDLVEV  681

Query  253  LGERPFKSSEPTNYDRFKDGF  191
            LG RPFK++E    DR +  F
Sbjct  682  LGPRPFKTAESGQLDRIRQRF  702



>ref|XP_002967857.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
 gb|EFJ31204.1| hypothetical protein SELMODRAFT_169256 [Selaginella moellendorffii]
Length=828

 Score =   301 bits (772),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  RRT AYH +GHAVAG FLEHAEPL+KV+IVPRG+AALGFAQY PNENLLMTKEQ+ D
Sbjct  593  PEERRTVAYHEAGHAVAGWFLEHAEPLIKVSIVPRGSAALGFAQYFPNENLLMTKEQMLD  652

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
            MTCM LGGRA+EQVMLGKISTGAQNDLE+VT++TYAQVAVYGFS+KVGLLSFP  E+  E
Sbjct  653  MTCMALGGRAAEQVMLGKISTGAQNDLERVTRLTYAQVAVYGFSEKVGLLSFPQKEDGME  712

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            +SKPYSN+T  +ID EVREW  +AY+ TV L+EEHKE + ++A+ LL + VLH  DLV V
Sbjct  713  LSKPYSNETGELIDREVREWTDRAYKRTVALLEEHKEGLEKLAQQLLAREVLHYNDLVEV  772

Query  253  LGERPFKSSEPTNYDRFKDGF  191
            LG RPFK++E    DR +  F
Sbjct  773  LGPRPFKTAESGQLDRIRQRF  793



>ref|XP_002980658.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
 gb|EFJ18309.1| hypothetical protein SELMODRAFT_233533 [Selaginella moellendorffii]
Length=453

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 4/208 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRG+AALGFAQYVPNE+LLMTK+Q  D+ C
Sbjct  245  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAALGFAQYVPNEDLLMTKQQFNDIIC  304

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+E+V+LG+I+TGAQNDLEKVT M YAQVA YGFSDKVGL+SF P ++  E+ K
Sbjct  305  MALGGRAAEEVLLGRITTGAQNDLEKVTLMAYAQVAEYGFSDKVGLVSF-PRKSQTELLK  363

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            P+SN T+ ++D E R  +  AY  T  LI++H++ VA+IAELLLEK VL QEDL+ VLGE
Sbjct  364  PFSNNTSKLMDEEARAIVNDAYARTRALIDKHRDGVAKIAELLLEKEVLRQEDLLAVLGE  423

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKD  161
            RPF      NYD ++ GF   K+ EA D
Sbjct  424  RPFAQGSRNNYDIYRHGF---KQEEAND  448



>ref|XP_002984562.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
 gb|EFJ14207.1| hypothetical protein SELMODRAFT_234574 [Selaginella moellendorffii]
Length=453

 Score =   275 bits (704),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 164/208 (79%), Gaps = 4/208 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEHAEPLLKVTIVPRG+AALGFAQYVPNE+LLMTK+Q  D+ C
Sbjct  245  RRTVAYHEAGHAVAGWFLEHAEPLLKVTIVPRGSAALGFAQYVPNEDLLMTKQQFNDIIC  304

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+E+V+LG+I+TGAQNDLEKVT M YAQVA YGFSDKVGL+SF P ++  E+ K
Sbjct  305  MALGGRAAEEVLLGRITTGAQNDLEKVTLMAYAQVAEYGFSDKVGLVSF-PRKSQTELLK  363

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            P+SN T+ ++D E R  ++ AY  T  LI++H++ VA+IAELLLEK VL QEDL+ VLGE
Sbjct  364  PFSNNTSKLMDEEARAIVSDAYARTRALIDKHRDGVAKIAELLLEKEVLRQEDLLAVLGE  423

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKD  161
            RPF      NYD ++ GF   K  EA D
Sbjct  424  RPFAQGSRNNYDIYRHGF---KPEEAND  448



>ref|XP_005651157.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26613.1| ATP-dependent metallopeptidase Hfl [Coccomyxa subellipsoidea 
C-169]
Length=712

 Score =   275 bits (703),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 164/203 (81%), Gaps = 2/203 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R+T A+H +GHAV   FLE+AEPLLKV+IVPRGTAALGFAQY+PNENLLMT EQ+ DMTC
Sbjct  469  RKTVAFHEAGHAVVAWFLEYAEPLLKVSIVPRGTAALGFAQYLPNENLLMTMEQMRDMTC  528

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+EQ+MLGKISTGAQNDLE+VTKM YAQVA+YG + KVGL+SFP  +  F  SK
Sbjct  529  MALGGRAAEQIMLGKISTGAQNDLERVTKMAYAQVAIYGMNKKVGLVSFPAEDGQF--SK  586

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS++TA +ID EVRE +  AYE T++L+ E K+ V ++A  LLEK V++ EDL  +LGE
Sbjct  587  PYSDETAQLIDKEVREMVNDAYERTLELLTEKKDLVEKLALTLLEKEVVNSEDLTEILGE  646

Query  244  RPFKSSEPTNYDRFKDGFVEDKE  176
            RP++S+E  N D+F+DGF +  E
Sbjct  647  RPYRSAELRNIDKFRDGFAKKIE  669



>ref|XP_002505472.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66730.1| predicted protein [Micromonas sp. RCC299]
Length=680

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 5/217 (2%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R T AYH +GHAV G FLEHAEPLLKV+IVPRG+AALGFAQY+PNENLL T +QL DM C
Sbjct  439  RNTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGSAALGFAQYLPNENLLATTQQLTDMMC  498

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+VMLGKISTGAQNDLEKVTKM Y +VAVYG ++KVG+LSFP ++  F+  K
Sbjct  499  MTLGGRAAEEVMLGKISTGAQNDLEKVTKMAYNRVAVYGMNEKVGMLSFPSDDQQFQ--K  556

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  TA +ID EVRE + +AY+ TV L++E KE V  +A+ LLE+ VL + DLV++LG+
Sbjct  557  PYSQDTARMIDEEVRELVDQAYKRTVALVKEKKEAVEALAQGLLEREVLQRHDLVKILGD  616

Query  244  RPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKD  134
            RPFK     N D   +GF   K  E K TAE+ + +D
Sbjct  617  RPFKYEGQQNIDILNEGF---KMPELKTTAEDDAKED  650



>dbj|BAF01982.1| hypothetical protein [Arabidopsis thaliana]
Length=173

 Score =   253 bits (645),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 146/174 (84%), Gaps = 2/174 (1%)
 Frame = -3

Query  619  FDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENA  440
            F+MTCMTLGGRA+EQV++G+ISTGAQNDLEKVTK+TYAQVAVYGFSDK+GLLSFP  E+ 
Sbjct  1    FNMTCMTLGGRAAEQVLIGRISTGAQNDLEKVTKLTYAQVAVYGFSDKIGLLSFPQREDE  60

Query  439  FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLV  260
            F  SKPYSN+T A+ID EVREW+ KAY+ TV+LIEEHKE VAQIAELLLEK VLHQ+DL 
Sbjct  61   F--SKPYSNRTGAMIDEEVREWVGKAYKRTVELIEEHKEQVAQIAELLLEKEVLHQDDLT  118

Query  259  RVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            +VLGERPFKS E TNYDRFK GF E ++   K++   K  +DD   PL+P+VVP
Sbjct  119  KVLGERPFKSGETTNYDRFKSGFEESEKESQKESVPVKPVEDDGIPPLEPQVVP  172



>ref|XP_001422694.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01011.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=476

 Score =   261 bits (668),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/232 (59%), Positives = 165/232 (71%), Gaps = 12/232 (5%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKV+IVPRG+AALGFAQY+PNENLL T +QL DM C
Sbjct  247  RRTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGSAALGFAQYLPNENLLATTQQLIDMMC  306

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVT+M Y  VAVYG ++K+GLLSFP +E +  +  
Sbjct  307  MTLGGRAAEQVMLGKISTGAQNDLEKVTQMAYNTVAVYGMNEKIGLLSFPKDEQS--LKS  364

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  TA +ID EVR  +  AY+ T+ L++E K  V  +A+ LL+K VL + DLV++LG+
Sbjct  365  PYSEDTARMIDEEVRLLVDTAYKRTLALVKEKKHLVEAMAQGLLDKEVLQRHDLVKLLGD  424

Query  244  RPFKSSEPTNYDRFKDGF-------VEDKETEAKDTAENKSTKDDDSSPLQP  110
            RPF S  P N D   +GF           E E  DT E    +DD+ SP  P
Sbjct  425  RPFVSENPQNIDILNEGFKMHYPKTATAPEDEPADTDE---PEDDEPSPAFP  473



>gb|KEH16019.1| ATP-dependent zinc metalloprotease FTSH protein, partial [Medicago 
truncatula]
Length=553

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 150/169 (89%), Gaps = 1/169 (1%)
 Frame = -3

Query  742  GXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRASEQVMLG  563
            G FLEH EPLLKVTIVPRGT  LGFAQY+ NENLLMTKEQLFD TCM LGGRA+EQV++G
Sbjct  261  GWFLEHTEPLLKVTIVPRGTETLGFAQYLSNENLLMTKEQLFDRTCMALGGRAAEQVLIG  320

Query  562  KISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPN-ENAFEMSKPYSNKTAAIIDNE  386
             ISTGAQ+DLEKVTKMTYAQVAVYGFS++VGLLSFP + E++FEMSKPYS++T AIID E
Sbjct  321  TISTGAQDDLEKVTKMTYAQVAVYGFSEQVGLLSFPHHKEDSFEMSKPYSSETGAIIDKE  380

Query  385  VREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGERP  239
            VREW+ KA++ T+QLIEEHK  VA+IAELLLEK VL+Q+DL++VL + P
Sbjct  381  VREWVNKAFKHTIQLIEEHKGKVAEIAELLLEKEVLYQDDLLQVLEKLP  429



>ref|XP_003082962.1| FtsH protease, putative (ISS) [Ostreococcus tauri]
 emb|CAL56917.1| Peptidase M41, FtsH extracellular [Ostreococcus tauri]
Length=809

 Score =   265 bits (677),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 153/198 (77%), Gaps = 2/198 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FLEHAEPLLKV+IVPRG+AALGFAQY+PNENLL T +QL DM C
Sbjct  578  RRTVAYHEAGHAVVGWFLEHAEPLLKVSIVPRGSAALGFAQYLPNENLLATTQQLVDMMC  637

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+EQVMLGKISTGAQNDLEKVT+M Y  VAVYG ++K+GLLSFP +E +  +  
Sbjct  638  MTLGGRAAEQVMLGKISTGAQNDLEKVTQMAYNTVAVYGMNEKIGLLSFPKDEQS--LKS  695

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  TA +ID EVR  + KAY+ TV L+EE K  V  +A  LL+K VL + DLV++LGE
Sbjct  696  PYSEDTARMIDEEVRLLVDKAYQRTVALVEEKKHLVEAMARGLLDKEVLQRHDLVQLLGE  755

Query  244  RPFKSSEPTNYDRFKDGF  191
            RPF S  P N D   +GF
Sbjct  756  RPFVSENPQNIDILNEGF  773



>ref|XP_007509883.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18998.1| predicted protein [Bathycoccus prasinos]
Length=922

 Score =   263 bits (671),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 139/241 (58%), Positives = 166/241 (69%), Gaps = 15/241 (6%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R T AYH +GHAV G F+EHAEPLLKV+IVPRG+AALGFAQY+PNEN+L T EQL DM C
Sbjct  685  RETVAYHEAGHAVVGWFMEHAEPLLKVSIVPRGSAALGFAQYLPNENVLATTEQLSDMMC  744

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E VMLGKISTGAQNDLEKVTKM Y   AVYG + K+GLLSFP  +N F+   
Sbjct  745  MTLGGRAAEDVMLGKISTGAQNDLEKVTKMAYNMTAVYGLNQKIGLLSFPKGDNDFK--S  802

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  TA +ID EVRE + KAY  TV L+ E K  V  +A  LL+K VL + DLV+VLGE
Sbjct  803  PYSEDTARMIDEEVRELVDKAYLRTVALVREKKAVVESLARALLDKEVLQRHDLVKVLGE  862

Query  244  RPFKSSEPTNYDRFKDGFVEDK-----ETEAKDTAENKSTKD------DDSSPLQPEVVP  98
            RPFK     N D    GF ++K      + ++D A N + +D      D S P+ P  +P
Sbjct  863  RPFKYEGQQNIDILNQGFRDEKLLPKTPSSSEDAATNDNDEDSKKEDGDASIPVTP--IP  920

Query  97   V  95
            V
Sbjct  921  V  921



>ref|XP_005850885.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
 gb|EFN58783.1| hypothetical protein CHLNCDRAFT_140544 [Chlorella variabilis]
Length=751

 Score =   260 bits (664),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/195 (65%), Positives = 155/195 (79%), Gaps = 2/195 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAV G FL+HAEPLLKV+IVPRG+AALGFAQY+PNEN+LMT EQL DM  
Sbjct  462  RRTVAYHEAGHAVTGWFLQHAEPLLKVSIVPRGSAALGFAQYLPNENVLMTTEQLNDMMA  521

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            M LGGRA+EQVMLG+ISTGAQNDLE+VTKM Y+QVA+YG + KVGLLSFPP E   +++K
Sbjct  522  MALGGRAAEQVMLGRISTGAQNDLERVTKMAYSQVAIYGMNPKVGLLSFPPEEG--QLNK  579

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+ TA IID EVR  +  AY+ TVQL+EE K  V  +A+ LL+K VL  E+L  +LG 
Sbjct  580  PYSDDTARIIDGEVRSLVDLAYQRTVQLLEEKKHLVEGMAQALLKKEVLGTEELEALLGA  639

Query  244  RPFKSSEPTNYDRFK  200
            RP++S+E  N D+ K
Sbjct  640  RPYRSAELRNIDKLK  654



>ref|XP_006845231.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]
 gb|ERN06906.1| hypothetical protein AMTR_s00005p00257390 [Amborella trichopoda]
Length=504

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 127/215 (59%), Positives = 159/215 (74%), Gaps = 13/215 (6%)
 Frame = -3

Query  781  RTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCM  602
            RT AYH +GH VAG FLE+AEPLLKVTI PRGTAALGFAQY+PNENLLMTKEQLFD+TCM
Sbjct  288  RTVAYHEAGHGVAGWFLEYAEPLLKVTIAPRGTAALGFAQYIPNENLLMTKEQLFDITCM  347

Query  601  TLGGRASEQVMLGK---ISTGAQNDLEKVTKMTYAQVAVYGFS----------DKVGLLS  461
            TLGGRASE  +      +  G +N +   + + Y  +  +G S          +KVGLLS
Sbjct  348  TLGGRASELSLHPADLALLYGKENIIIIGSLIYYMYIFCWGRSRLGLRMTWRSEKVGLLS  407

Query  460  FPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGV  281
            FP  +  +E ++PYSN+T  IID EVR+W+ KAY+ T++LIEE +E V +IAELLLE+ V
Sbjct  408  FPQKDEGYERTQPYSNRTEEIIDKEVRDWVTKAYDRTLELIEEKREQVVKIAELLLEREV  467

Query  280  LHQEDLVRVLGERPFKSSEPTNYDRFKDGFVEDKE  176
            LH+ DL++VLGERPFKSSEPTNYD F  GF E+++
Sbjct  468  LHKHDLLKVLGERPFKSSEPTNYDPFTKGFQEEQQ  502



>ref|XP_011400128.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM27161.1| ATP-dependent zinc metalloprotease FTSH 10, mitochondrial [Auxenochlorella 
protothecoides]
Length=1210

 Score =   263 bits (672),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 155/197 (79%), Gaps = 2/197 (1%)
 Frame = -3

Query  784   RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
             RRT AYH +GHAV G FL HAEPLLKV+IVPRG+AALGFAQY+PNENLL T EQ+ DM  
Sbjct  1015  RRTVAYHEAGHAVVGWFLRHAEPLLKVSIVPRGSAALGFAQYLPNENLLATGEQMADMMA  1074

Query  604   MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
             M LGGRA+EQVMLG+ISTGAQNDLE+VTKM YAQVAVYG +D VGL+SFP  E AF  +K
Sbjct  1075  MALGGRAAEQVMLGRISTGAQNDLERVTKMAYAQVAVYGMNDAVGLVSFPQEEGAF--NK  1132

Query  424   PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
             PYS+ TA +ID EVR  +A AY  T+ L+EE +  V  +A+ LLE+ VL  E+L  +LGE
Sbjct  1133  PYSDDTARLIDGEVRALVAGAYRRTLALLEEKRGAVEAMAQALLEREVLGTEELEALLGE  1192

Query  244   RPFKSSEPTNYDRFKDG  194
             RP++S+E  N D+F+DG
Sbjct  1193  RPYRSAELRNIDKFRDG  1209



>ref|XP_003059742.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55694.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=651

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 149/198 (75%), Gaps = 2/198 (1%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            R T AYH +GHAV G  LEHAEPLLKV+IVPRG+AALGFAQY+PNENLL T +QL DM C
Sbjct  451  RNTVAYHEAGHAVVGWMLEHAEPLLKVSIVPRGSAALGFAQYLPNENLLATTQQLTDMMC  510

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
            MTLGGRA+E+VMLGKISTGAQNDLEKVTKM Y +VAVYG ++KVG+LSFP ++  F+  K
Sbjct  511  MTLGGRAAEEVMLGKISTGAQNDLEKVTKMAYNRVAVYGMNEKVGMLSFPSDDQQFQ--K  568

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS  TA +ID EVR  +A AY+ T+ LI + +  V  +A+ LLEK VL + DLV VLG 
Sbjct  569  PYSQDTAKLIDEEVRLLVANAYQRTLDLITKERSKVEALAQALLEKEVLQRHDLVTVLGA  628

Query  244  RPFKSSEPTNYDRFKDGF  191
            RPF      N D   +GF
Sbjct  629  RPFAYDGQQNIDILNEGF  646



>ref|XP_003631103.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET05579.1| peptidase family M41 protein [Medicago truncatula]
Length=406

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 126/197 (64%), Positives = 151/197 (77%), Gaps = 17/197 (9%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            RRT AYH +GHAVAG FLEH  P LKVTIVPRGTAALGFAQYVPNEN LMT+        
Sbjct  150  RRTVAYHEAGHAVAGWFLEHTNPFLKVTIVPRGTAALGFAQYVPNENHLMTR--------  201

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSK  425
                      V++G ISTGAQ+DLEKVTKM YAQVAVYGFS+KVGLLSFPP+E++FE SK
Sbjct  202  ---------AVLIGTISTGAQDDLEKVTKMIYAQVAVYGFSEKVGLLSFPPSEDSFETSK  252

Query  424  PYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGE  245
            PYS+KT+AIIDNEVR+ + KAY+ T+QLIEE+K  +A+IA+LLLEK VLHQ+DL++VLG 
Sbjct  253  PYSSKTSAIIDNEVRDRVNKAYKHTIQLIEEYKGKLAEIAKLLLEKEVLHQDDLLQVLGF  312

Query  244  RPFKSSEPTNYDRFKDG  194
            +     E  + +   DG
Sbjct  313  KLGLQDEAEDVEIIVDG  329



>gb|ABR26136.1| osftsh8 - oryza sativa ftsh protease, homologue of atftsh3/10 
[Oryza sativa Indica Group]
Length=157

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 130/157 (83%), Gaps = 1/157 (1%)
 Frame = -3

Query  568  LGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDN  389
            +G+ISTGAQNDLEKVTKMTYAQVAVYGFS+KVGLLSFP  ++ FEM+KPYSN+TA+IID+
Sbjct  1    IGRISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDDGFEMTKPYSNQTASIIDD  60

Query  388  EVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGERPFKSSEPTNYD  209
            EVREW+ KAY+ TV+LI EHKE VA+IAE+LLEK VLHQ+DLVRVLGERPFK+SEPTNYD
Sbjct  61   EVREWVGKAYKKTVELITEHKEQVAKIAEMLLEKEVLHQDDLVRVLGERPFKASEPTNYD  120

Query  208  RFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
             FK GF +D+E      A      DDD +P   EVVP
Sbjct  121  LFKQGF-QDEEDSKNQEAAKTPQPDDDGTPSLGEVVP  156



>ref|XP_001689949.1| membrane AAA-metalloprotease [Chlamydomonas reinhardtii]
 gb|EDP09687.1| membrane AAA-metalloprotease, partial [Chlamydomonas reinhardtii]
Length=752

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 156/210 (74%), Gaps = 15/210 (7%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTK--------  629
            RRT AYH SGHAV   FL++AEPLLKV+IVPRGTA LGFAQY+PNE++L+TK        
Sbjct  545  RRTVAYHESGHAVVSWFLQYAEPLLKVSIVPRGTATLGFAQYLPNESVLLTKARHGGGRE  604

Query  628  -----EQLFDMTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLL  464
                 EQL D  C TLGGRA+EQVMLGKISTGA NDLE++T+M Y+QVAVYG ++KVGL+
Sbjct  605  PGGMGEQLLDRVCATLGGRAAEQVMLGKISTGAVNDLERITQMAYSQVAVYGMNEKVGLV  664

Query  463  SFPPNENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKG  284
            SF  + +AF+  KPYS+ TA +ID EVR +I +AY  T+ L+E+H+  +  + + LL K 
Sbjct  665  SFRMDRDAFD--KPYSDTTAQLIDEEVRSFIDEAYRRTLGLVEQHRGLIEAMTQELLHKE  722

Query  283  VLHQEDLVRVLGERPFKSSEPTNYDRFKDG  194
            VL+ +D+ R+LG+RPF S+E  N DRF+ G
Sbjct  723  VLNLDDVERLLGKRPFVSAELRNIDRFRHG  752



>emb|CBI30537.3| unnamed protein product [Vitis vinifera]
Length=271

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 153/211 (73%), Gaps = 5/211 (2%)
 Frame = -3

Query  727  HAEPLLKVTI-VPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAS--EQVMLGKI  557
            H  P L +T  V +  +      Y    NL +   +   ++C   G  +S    V+LGKI
Sbjct  47   HNTPKLLITFGVIKRNSCFSLLNYHLLRNLKLLGNEPTAVSCAMCGEGSSLIYIVLLGKI  106

Query  556  STGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSKPYSNKTAAIIDNEVRE  377
            STGAQNDLEKVTKM YAQVAVYGFS+KVGLLSFP  ++AFEM+KPYS+KT+A+IDNEVRE
Sbjct  107  STGAQNDLEKVTKMIYAQVAVYGFSEKVGLLSFPQRDDAFEMTKPYSSKTSAVIDNEVRE  166

Query  376  WIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLGERPFKSSEPTNYDRFKD  197
            W+AKAY+ TV+LIEEHKE VA IAEL LEK VLHQ+DLVRVLGERPFK+SEPTNYDRFK 
Sbjct  167  WVAKAYDRTVKLIEEHKEPVAMIAELSLEK-VLHQDDLVRVLGERPFKTSEPTNYDRFKQ  225

Query  196  GFVEDKETEAKDTAENKSTKDDDSSPLQPEV  104
             F +D + + ++  E++  +   SS  +PE+
Sbjct  226  WF-QDGDKKNREVTESECVEIGRSSTFKPEM  255



>gb|KHG19679.1| ATP-dependent zinc metalloprotease FTSH 8, mitochondrial [Gossypium 
arboreum]
Length=404

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 129/165 (78%), Gaps = 24/165 (15%)
 Frame = -3

Query  781  RTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCM  602
            +T AYH SGHAVAG                       FAQYVPNENLLMTKEQL D+TCM
Sbjct  253  QTVAYHESGHAVAG-----------------------FAQYVPNENLLMTKEQLSDVTCM  289

Query  601  TLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFEMSKP  422
            TLGGR ++QV+L KISTGAQ+DL+KVTKMTY QVAVYGFSDKVGLLSF P  +AFEM+KP
Sbjct  290  TLGGRDAKQVLLRKISTGAQSDLKKVTKMTYTQVAVYGFSDKVGLLSF-PQRDAFEMTKP  348

Query  421  YSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEK  287
            YS+KT AIID+EVR+W+ KAYE T+QLIEEHKEHV Q+AELLLEK
Sbjct  349  YSSKTGAIIDSEVRKWVVKAYERTMQLIEEHKEHVTQVAELLLEK  393



>ref|WP_041883641.1| peptidase M41 [Pedobacter sp. NL19]
 gb|KIO76076.1| peptidase M41 [Pedobacter sp. NL19]
Length=697

 Score =   231 bits (588),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/226 (51%), Positives = 153/226 (68%), Gaps = 2/226 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  466  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  525

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +YG +  +G +SF   +N + 
Sbjct  526  GMCMTMGGRVAEDLVFGKISTGAQNDLERITKLSYAMVTIYGMNTTIGNVSFHDPQNEYN  585

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +ID EVR  I + YE T+QL+ E +E + ++AE LLEK +L Q DL  +
Sbjct  586  FNKPYSEKTSELIDIEVRTLINQVYERTMQLLIEKREGLEKLAEKLLEKEILFQADLEEI  645

Query  253  LGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPL  116
            LG+RPF +   T YD F +G  + K        E      D SSPL
Sbjct  646  LGKRPFDNR--TTYDEFVNGTGDQKPAAEGLLHEGVGETTDPSSPL  689



>ref|XP_002410299.1| ATPase, putative [Ixodes scapularis]
 gb|EEC12875.1| ATPase, putative [Ixodes scapularis]
Length=368

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/225 (51%), Positives = 156/225 (69%), Gaps = 7/225 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E  L T +QLFD
Sbjct  128  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-LGYAQYLPKEQYLYTTQQLFD  186

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SEQ+  GKI+TGAQ+DL+KVT+  YAQV  +G ++KVG LSF  P     
Sbjct  187  RMCMTLGGRVSEQIFFGKITTGAQDDLKKVTQSAYAQVVQFGMNEKVGNLSFDMPQPGDM  246

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS +TA +ID+EVR+ + +AY+ T+ L+ EHK  V +IA+ LLEK +L +ED++ 
Sbjct  247  VLDKPYSEETAQMIDSEVRKMVQQAYDHTMTLLTEHKADVEKIAKRLLEKEILSREDMIE  306

Query  256  VLGERPFKSSEPTNYDRFKDG---FVEDKETEAKDTAENKSTKDD  131
            +LG+RPF   E + Y+ F +G   F ED        + NK  +D+
Sbjct  307  LLGKRPF--PEKSTYEEFVEGTGSFEEDTTLPKGLESWNKGPEDE  349



>ref|XP_002741203.1| PREDICTED: AFG3-like protein 2, partial [Saccoglossus kowalevskii]
Length=560

 Score =   227 bits (579),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E  L +KEQL D
Sbjct  313  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-LGYAQYLPKEQYLYSKEQLLD  371

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SE+++ G+I+TGAQ+DL+KVT+  YAQV  +G S+KVG +SF  P +   
Sbjct  372  RMCMTLGGRVSEELVFGRITTGAQDDLKKVTQTAYAQVVQFGMSEKVGNVSFDMPQQGEM  431

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             M KPYS +TA +IDNEVR  I  AY+ TV L++ H+E++ ++A+ LL K VL +ED+V 
Sbjct  432  VMDKPYSEQTAQLIDNEVRSIIRSAYDRTVSLLQNHRENIEKVAQRLLNKEVLSKEDMVE  491

Query  256  VLGERPFKSSEPTNYDRFKDG  194
            +LGERPF  +E + Y++F +G
Sbjct  492  LLGERPF--AEKSTYEQFVEG  510



>ref|WP_026897433.1| peptidase M41 [Pedobacter oryzae]
Length=696

 Score =   229 bits (585),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/223 (50%), Positives = 157/223 (70%), Gaps = 3/223 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  467  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  526

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR +E ++ GKISTGAQNDLE++TK++YA V +YG +++VG +SF   +  ++
Sbjct  527  GMCMTLGGRVAEDIVFGKISTGAQNDLERITKLSYAMVTIYGMNERVGNVSFNDTQGEYQ  586

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ IID EVRE I ++Y+ T  L+ E ++ + ++A  LLEK +L Q DL  +
Sbjct  587  FNKPYSEKTSEIIDIEVREQIDRSYQRTKALLTEKRDGLEKLAHKLLEKEILFQSDLEEI  646

Query  253  LGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
            LG+RPF +   T YD F +G V +   E ++  E++   D ++
Sbjct  647  LGKRPFDNR--TTYDEFVNG-VPEVGNEVRENLEHEGVIDHNA  686



>ref|XP_638674.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL65313.1| peptidase M41, FtsH domain-containing protein [Dictyostelium 
discoideum AX4]
Length=764

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 146/197 (74%), Gaps = 2/197 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +RT AYH +GHAV   FL+H  PLLKV+IVPRG AALG+AQY+P E  L  +EQ+FD
Sbjct  557  PTEKRTVAYHEAGHAVVSWFLKHCHPLLKVSIVPRGVAALGYAQYLPKEQFLQNQEQIFD  616

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
            M CM LGGR +EQ+  G I+TGAQ+DLEK+TKM Y+QV++YG ++K+G LS+   ++  +
Sbjct  617  MMCMALGGRVAEQLTFGTITTGAQDDLEKITKMAYSQVSIYGMNEKIGPLSYQKGQDGSD  676

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            ++KPYS +TA ++D EVR+ +  AY+ T Q+++EH+E +  +A LLLEK V+H E++  V
Sbjct  677  LTKPYSEETAEVMDEEVRKLLKSAYDRTTQVLQEHREGLISVANLLLEKEVIHFEEVEAV  736

Query  253  LGERPF--KSSEPTNYD  209
            LG RPF  K+ EP N +
Sbjct  737  LGPRPFNNKTEEPKNIN  753



>ref|XP_003292084.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]
 gb|EGC31386.1| hypothetical protein DICPUDRAFT_39991 [Dictyostelium purpureum]
Length=514

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAV   FL+H  PLLKV+IVPRG AALG+AQY+P E  L  KEQ+FD
Sbjct  301  PQEKKTVAYHEAGHAVVSWFLKHCHPLLKVSIVPRGVAALGYAQYLPKEQFLQNKEQIFD  360

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
            M CM LGGR +EQ+  G I+TGAQ+DL+K+TKM Y+Q+++YG ++KVG LSFP  +N+ +
Sbjct  361  MMCMALGGRVAEQLTFGTITTGAQDDLQKITKMAYSQISIYGMNEKVGPLSFPRRDNS-D  419

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            +++PYS +TA ++D EVR+ +  AY+ T +L+ EHK+ +  +A+LLLEK V+H E++  V
Sbjct  420  LTRPYSEETAELVDEEVRKLLKAAYDRTKELLIEHKDGLESVAKLLLEKEVIHYEEVENV  479

Query  253  LGERPFKSSE  224
            LG+RPF+ ++
Sbjct  480  LGKRPFEKTK  489



>dbj|GAM28243.1| hypothetical protein SAMD00019534_114190 [Acytostelium subglobosum 
LB1]
Length=838

 Score =   230 bits (587),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 143/191 (75%), Gaps = 1/191 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAV   FLEH  PLLKV+IVPRG AALG+AQY+P E  L TKEQ+FD
Sbjct  613  PQEKKTVAYHEAGHAVVSWFLEHCNPLLKVSIVPRGVAALGYAQYMPKEEFLNTKEQIFD  672

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CM LGGR +EQ+  G I+TGAQ+DLEK+TKM Y+QV +YG +DKVG LS+P  +++ +
Sbjct  673  KMCMALGGRVAEQMTFGTITTGAQDDLEKITKMAYSQVGIYGMNDKVGPLSYPRKDSS-D  731

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            ++KPYS +TA I+D EVR  + +AY+ T ++++EHKE +  +A LLL K V+H ED+ ++
Sbjct  732  LTKPYSEETAEIMDQEVRILLQRAYDKTTEVLKEHKEGLEAVAALLLSKEVIHAEDIEKI  791

Query  253  LGERPFKSSEP  221
            LG RPF   EP
Sbjct  792  LGPRPFGIPEP  802



>ref|WP_037443193.1| peptidase M41 [Sphingobacterium antarcticum]
 gb|KEQ28898.1| peptidase M41 [Sphingobacterium antarcticus 4BY]
Length=696

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 147/200 (74%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  466  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  525

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +YG +  +G +SF   +N + 
Sbjct  526  GMCMTMGGRVAEDLVFGKISTGAQNDLERITKLSYAMVTIYGMNSTIGNVSFHDPQNEYN  585

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +ID EVR+ ++  YE T+QL+ + +E + ++AE LLEK +L Q DL  +
Sbjct  586  FNKPYSEKTSELIDIEVRKLVSGVYERTMQLLTDQREGLEKLAEKLLEKEILFQTDLEEI  645

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF++   T YD F +G
Sbjct  646  LGKRPFENR--TTYDEFVNG  663



>ref|WP_037533932.1| peptidase M41 [Sphingobacterium thalpophilum]
Length=695

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  461  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYTTEQLID  520

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++T+++YA +A+YG +DKVG +SF  +  A  
Sbjct  521  SLCMTMGGRVAEDITFGRISTGAQNDLERITQLSYAMIAIYGMNDKVGNVSFRDSSEA-S  579

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS+KTA +ID EVR  I   Y  T QL+ E +E + +IAE LLEK +L Q DL  +
Sbjct  580  FQKPYSDKTAELIDAEVRNLINDVYARTKQLLLEKREGLIKIAEKLLEKEILFQSDLEEI  639

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF++   T YD F +G
Sbjct  640  LGKRPFETK--TTYDEFVNG  657



>ref|WP_013664355.1| peptidase M41 [Sphingobacterium sp. 21]
 gb|ADZ77627.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. 21]
Length=707

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  469  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLID  528

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  GKISTGAQNDLE++TK+ YA VAVYG ++KVG +SF  ++ + +
Sbjct  529  GMCMTMGGRVAEDLTFGKISTGAQNDLERITKLAYAMVAVYGMNNKVGNISFNDSQES-Q  587

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS KTA +ID EVR+ I+  YE T QL+ E  + +  +AE LLEK +L Q DL  +
Sbjct  588  FQKPYSEKTAELIDEEVRKLISDVYEKTRQLLSEKSDGLKALAEKLLEKEILFQSDLEEI  647

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  648  LGKRPFDNR--TTYDEFVNG  665



>ref|WP_008241678.1| peptidase M41 [Pedobacter sp. BAL39]
 gb|EDM36319.1| cell division protein, ATP-dependent metalloprotease [Pedobacter 
sp. BAL39]
Length=697

 Score =   227 bits (578),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 145/200 (73%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  467  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  526

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR +E +  GKISTGAQNDLE++TK++YA V +YG +  +G +SF   +N + 
Sbjct  527  GMCMTLGGRVAEDITFGKISTGAQNDLERITKLSYAMVTIYGMNSTIGNVSFHDPQNEYN  586

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +ID EVR+ I +AYE T QL+ + +E + ++A+ LLEK +L Q DL  +
Sbjct  587  FNKPYSEKTSEMIDVEVRKLIEEAYEKTKQLLLDKREGLEKLAQKLLEKEILFQADLEEI  646

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  647  LGKRPFDNR--TTYDEFVNG  664



>ref|WP_039053642.1| peptidase M41, partial [Sphingobacterium sp. T2]
Length=652

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 110/200 (55%), Positives = 145/200 (73%), Gaps = 3/200 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  456  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLID  515

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VAVYG ++KVG +SF  +  + +
Sbjct  516  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAVYGMNEKVGNVSFNDSSES-Q  574

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS +TA +ID EVR+ IA  Y+ T +L+ E +E + +IAE LLEK +L Q DL  +
Sbjct  575  FHKPYSERTAELIDEEVRQLIANVYKRTKELLLEKQEGLIKIAEKLLEKEILFQSDLEEI  634

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF  S  T YD F +G
Sbjct  635  LGKRPF--SHRTTYDEFVNG  652



>gb|EIE80123.1| hypothetical protein RO3G_04828 [Rhizopus delemar RA 99-880]
Length=645

 Score =   225 bits (574),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 159/225 (71%), Gaps = 10/225 (4%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHA+AG +L++A+PLLKV+++PRG+AALG+AQY+P +  L +++QL D
Sbjct  424  PEEKKTVAYHEAGHAIAGWYLQYADPLLKVSVIPRGSAALGYAQYLPKDQYLYSRKQLLD  483

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF--PPNENA  440
              CMTLGGR SEQ+    I+TGAQ+DL+KVTKM YAQ+  YG ++K+G LSF  P NEN+
Sbjct  484  RMCMTLGGRVSEQIFFKTITTGAQDDLQKVTKMAYAQITAYGMNEKIGPLSFSDPQNENS  543

Query  439  FEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLV  260
            F+  KP+S +T  +IDNE R  +++AY+ T+QL+ E K  + ++A+LLL K VL +ED+ 
Sbjct  544  FQ--KPFSEQTGTMIDNEARALVSEAYDRTLQLLTEKKNDIEKVAQLLLSKEVLTREDME  601

Query  259  RVLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDS  125
             +LG+RPF  +E T YD     +V  K ++     +     DDDS
Sbjct  602  NLLGKRPF--NEVTVYDE----YVRRKPSDTSAPPDFSKPSDDDS  640



>ref|WP_012780210.1| peptidase M41 [Pedobacter heparinus]
 gb|ACU02256.1| ATP-dependent metalloprotease FtsH [Pedobacter heparinus DSM 
2366]
Length=696

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/228 (48%), Positives = 153/228 (67%), Gaps = 2/228 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  466  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  525

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +YG +  +G +SF   +N + 
Sbjct  526  GMCMTMGGRVAEDIVFGKISTGAQNDLERITKLAYAMVTIYGMNSTIGNVSFHDPQNEYN  585

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +IDNEVR  I++ Y  T  L+ + +E + ++A+ L+EK +L Q DL  +
Sbjct  586  FNKPYSEKTSEMIDNEVRILISEVYTRTKSLLTDKREGLEKLAQKLIEKEILFQADLEEI  645

Query  253  LGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQP  110
            LG+RPF +   T YD F +G  + K        +  S   D ++P+ P
Sbjct  646  LGKRPFDNR--TTYDEFVNGTGDQKPAAEGLLHDGVSQPADPATPITP  691



>ref|WP_014682322.1| peptidase M41 [Solitalea canadensis]
 gb|AFD09100.1| ATP-dependent metalloprotease FtsH [Solitalea canadensis DSM 
3403]
Length=692

 Score =   226 bits (575),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  465  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQYLYTTEQLTD  524

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +YG ++KVG +SF   +N + 
Sbjct  525  GMCMTMGGRVAEDIIFGKISTGAQNDLERITKLAYAMVTIYGMNEKVGNVSFNDQQNEYG  584

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             SKPYS KT+ +ID+EVR+ I   Y  T  L+ E +  +  +A+ LLEK +L Q DL  +
Sbjct  585  FSKPYSEKTSELIDHEVRDLINNIYARTKDLLTEKRSGLEALAQKLLEKEILFQSDLEEI  644

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  645  LGKRPFDTR--TTYDEFVNG  662



>gb|EQB80316.1| hypothetical protein L950_08340 [Sphingobacterium sp. IITKGP-BTPF85]
Length=601

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 139/197 (71%), Gaps = 4/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  369  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYTTEQLVD  428

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+YG +DKVG +SF      F 
Sbjct  429  SLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAIYGMNDKVGNVSFRDGSEQFH  488

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS+KTA +ID+EVR  I   Y  T QL+ + +E +  IAE LLEK +L Q DL  +
Sbjct  489  --KPYSDKTAELIDSEVRNLITDVYARTKQLLLDKQEGLVAIAEKLLEKEILFQSDLEEI  546

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF +   T YD F
Sbjct  547  LGKRPFDTK--TTYDEF  561



>ref|XP_003979383.1| PREDICTED: AFG3-like protein 2-like [Takifugu rubripes]
Length=332

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E  L TKEQL D
Sbjct  93   PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-LGYAQYLPKEQYLYTKEQLLD  151

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SE++  G+I+TGAQ+DL KVT+  YAQ+  +G + KVG +SF  P +   
Sbjct  152  RMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNPKVGQVSFDLPRQGEM  211

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS  TA +ID EVR  I++AY+ T+QL++E K  V ++A  LLEK VL + D+V 
Sbjct  212  VLEKPYSEATARLIDTEVRALISEAYQRTLQLLKEKKAEVEKVALRLLEKEVLDKNDMVE  271

Query  256  VLGERPFKSSEPTNYDRFKDG  194
            +LG+RPF  +E + Y+ F +G
Sbjct  272  LLGKRPF--AEKSTYEEFVEG  290



>gb|EFA84387.1| peptidase M41 [Polysphondylium pallidum PN500]
Length=803

 Score =   226 bits (576),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 144/189 (76%), Gaps = 1/189 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAV   FLEH  PLLKV+IVPRG AALG+AQY+P E  L TKEQ+FD
Sbjct  592  PQEKKTVAYHEAGHAVVSWFLEHCNPLLKVSIVPRGVAALGYAQYLPKEEFLNTKEQIFD  651

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CM LGGR +EQ++ G I+TGAQ+DLEK+TKM Y+QV +YG ++KVG LS+P  +++ +
Sbjct  652  KMCMALGGRVAEQLVFGTITTGAQDDLEKITKMAYSQVGLYGMNEKVGPLSYPRKDSS-D  710

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            ++KPYS++TA IID EVR  +  AY  T +++E HKE + ++A LLLEK V+H ED+ ++
Sbjct  711  LTKPYSDETAEIIDQEVRLLLQSAYNKTQEVLEAHKEGLEKVALLLLEKEVIHAEDIEQI  770

Query  253  LGERPFKSS  227
            LG RPF ++
Sbjct  771  LGPRPFANT  779



>ref|WP_040539886.1| peptidase M41 [Pedobacter arcticus]
Length=695

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  466  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLSD  525

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  GKISTGAQNDLE++TK+ YA V +YG S+KVG +SF      + 
Sbjct  526  GMCMTMGGRVAEDITFGKISTGAQNDLERITKLAYAMVTLYGMSEKVGNVSFNDQGGEYN  585

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             SKPYS+KTA +ID+EVRE I+  Y+ T  L+ E ++ +  +A  LLEK +L Q DL  +
Sbjct  586  FSKPYSDKTAELIDSEVRELISGVYQKTKDLLIEKRDGLEALAVKLLEKEILFQSDLEEI  645

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  646  LGKRPFDNR--TTYDEFVNG  663



>ref|WP_009033571.1| peptidase M41 [Indibacter alkaliphilus]
 gb|EOZ95809.1| Cell division protein FtsH [Indibacter alkaliphilus LW1]
Length=695

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 166/241 (69%), Gaps = 13/241 (5%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  452  PEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYQTEQLID  511

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENA-F  437
              CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V+VYG ++K+G +SF  ++++ +
Sbjct  512  EMCMTLGGRAAEEIIFGKISTGALSDLERITKMAYSIVSVYGMNEKIGNVSFYDSKSSEY  571

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             M+KPYS KT+  ID+EVR+ I+ AYE T  L+ E ++ +  +A+ LLEK +L Q DL +
Sbjct  572  RMTKPYSEKTSETIDDEVRKLISFAYEKTKVLLTERRDELEVLAKELLEKEILFQSDLEK  631

Query  256  VLGERPFKSSEPTNYDRFK----------DGFVEDKETEAKDTAENKSTKDDDSSPLQPE  107
            ++G+RPF   + T Y+ F           D  ++DK+  A+DT       +D +SP + +
Sbjct  632  LIGKRPF--GKETTYEAFTKKDQKKKSIPDAEIKDKQNNAEDTKSEDGKPEDPNSPKEQQ  689

Query  106  V  104
            V
Sbjct  690  V  690



>ref|WP_021069372.1| peptidase M41 [Sphingobacterium paucimobilis]
 gb|ERJ57782.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]
 gb|ERJ60233.1| peptidase M41 [Sphingobacterium paucimobilis HER1398]
Length=692

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  459  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  518

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  519  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNVSFRDSSGESQ  578

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  +A  YE T QL+ + ++ + +IAE LLEK +L Q DL  +
Sbjct  579  FQKPYSDQTAELIDEEVRVLVAAVYERTRQLLLDKQDGLIRIAEKLLEKEILFQADLEEI  638

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF  S  T YD F +G
Sbjct  639  LGKRPF--SNRTTYDEFVNG  656



>gb|ESA05195.1| hypothetical protein GLOINDRAFT_66340 [Rhizophagus irregularis 
DAOM 181602]
Length=647

 Score =   223 bits (569),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKVTI+PRG AALG+AQY+P +  L +  QL D
Sbjct  430  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVTIIPRGVAALGYAQYLPKDQYLYSTAQLLD  489

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  YG +  VG LSF  PN+N  
Sbjct  490  RMCMTLGGRVSEQIFFNIITTGAHDDLQRVTKLAYAQVTTYGMNPNVGPLSFNSPNDNEP  549

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V ++A+LLL K VL+++D++ 
Sbjct  550  QFQKPYSEETAKMIDEEVRKLVASAYERTVKLLTDKKNDVEKVAQLLLSKEVLNRDDMIS  609

Query  256  VLGERPFKSSEPTNYDRF  203
            +LG+RPF   E  NY+ +
Sbjct  610  LLGKRPF--VEKNNYEEY  625



>gb|EGI59447.1| AFG3-like protein 2 [Acromyrmex echinatior]
Length=670

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 7/208 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHA+ G FLEHA+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  420  PEEKKTVAYHEAGHAITGWFLEHADPLLKVSIIPRGKG-LGYAQYLPRELYLYTKEQLFD  478

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CM LGGRASE++  G+I+TGAQ+DL+K+TK+ YAQ+  YG ++K+G +SF  PN    
Sbjct  479  RMCMMLGGRASEEIFFGRITTGAQDDLQKITKVAYAQITQYGMNEKIGNVSFEMPNTGEL  538

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
               KPYS  TA +IDNEVR+ I KA++ T+ L+ EHKE V ++AE LL++ +L ++D++ 
Sbjct  539  VFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLNEHKEDVIKVAERLLKQEILSRDDMIE  598

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED  182
            +LG RPF+  E + Y+ F +G   F ED
Sbjct  599  LLGPRPFR--EKSTYEEFVEGTGSFEED  624



>ref|WP_037497088.1| peptidase M41 [Sphingobacterium sp. ACCC 05744]
 gb|KGE14923.1| ATP-dependent metalloprotease FtsH [Sphingobacterium sp. ACCC 
05744]
Length=690

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/197 (54%), Positives = 141/197 (72%), Gaps = 2/197 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLE+A+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PDEKKIVAYHEAGHAIAGWFLEYADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG +DKVG +SF  +    +
Sbjct  518  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNDKVGNVSFRDSSGDSQ  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  I+  YE T QL+ + ++ + +IAE LLEK +L Q DL  +
Sbjct  578  FQKPYSDQTAELIDEEVRTLISAVYERTKQLLIDKQDGLVKIAEKLLEKEILFQSDLEEI  637

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF +   T YD F
Sbjct  638  LGKRPFDNR--TTYDEF  652



>ref|WP_010600005.1| peptidase M41 [Pedobacter agri]
Length=701

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 145/200 (73%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  469  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLID  528

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  GKISTGAQNDLE++TK++YA V++YG ++ VG +SF   +N + 
Sbjct  529  GMCMTMGGRVAEDITFGKISTGAQNDLERITKLSYAMVSIYGMNEAVGNVSFHDPQNEYN  588

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS+KT+ +ID EVR+ I   Y  T QL+ + ++ + ++A+ LLEK +L Q DL  +
Sbjct  589  FNKPYSDKTSELIDVEVRKLIGDVYIKTKQLLLDKQDGLEKLAQKLLEKEILFQADLEEI  648

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  649  LGKRPFDTR--TTYDEFVNG  666



>gb|ETZ19316.1| peptidase M41 [Pedobacter sp. V48]
Length=696

 Score =   224 bits (570),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 146/200 (73%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  466  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  525

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK++YA V +YG +  +G +SF   +N + 
Sbjct  526  GMCMTMGGRVAEDIVFGKISTGAQNDLERITKLSYAMVTIYGMNSTIGNVSFHDPQNEYN  585

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +ID+EVR  I++ Y+ T QL+ + ++ + ++A+ L+EK +L Q DL  +
Sbjct  586  FNKPYSEKTSEMIDHEVRILISQVYDRTKQLLTDKRDGLEKLAQKLIEKEILFQADLEEI  645

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  646  LGKRPFDNR--TTYDEFVNG  663



>ref|XP_004362632.1| peptidase M41 [Dictyostelium fasciculatum]
 gb|EGG24781.1| peptidase M41 [Dictyostelium fasciculatum]
Length=1234

 Score =   228 bits (581),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 141/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  793   PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
             P  ++T AYH +GHAV   FLEH  PLLKV+IVPRG AALG+AQY+P E  L TKEQ+FD
Sbjct  1001  PVEKKTVAYHEAGHAVVSWFLEHCSPLLKVSIVPRGMAALGYAQYLPKEEFLHTKEQIFD  1060

Query  613   MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
               CM LGGR +EQ+  G I+TGAQ+DLEKVTKM Y+Q+ +YG +DKVG +S+P  +N+ +
Sbjct  1061  KMCMALGGRVAEQLTFGTITTGAQDDLEKVTKMAYSQIGIYGMNDKVGCVSYPRKDNS-D  1119

Query  433   MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              +KPYS +TA ++D EVR  +  AYE TVQ++E+H++ + ++A LLLEK V+H +D+  +
Sbjct  1120  FTKPYSEQTAEMMDEEVRILLNSAYEKTVQVLEQHRDGLEKVATLLLEKEVIHSDDIKTL  1179

Query  253   LGERPF  236
             LG RPF
Sbjct  1180  LGPRPF  1185



>ref|XP_009698917.1| PREDICTED: AFG3-like protein 2, partial [Cariama cristata]
Length=250

 Score =   213 bits (541),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/201 (53%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E  L TKEQL D
Sbjct  10   PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRG-KGLGYAQYLPKEQYLYTKEQLLD  68

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SEQ+  G+I+TGAQ+DL+KVT+  YAQ+  +G ++KVG +SF  P +   
Sbjct  69   RMCMTLGGRVSEQIFFGRITTGAQDDLKKVTQSAYAQIVQFGMNEKVGQISFDLPRQGDM  128

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS  TA +ID EVR  I  AY+ T+ L+ E K  V ++A  LLEK VL + D++ 
Sbjct  129  VLEKPYSEATARLIDEEVRSLINIAYDRTLSLLTEKKAEVEKVALRLLEKEVLDKSDMLD  188

Query  256  VLGERPFKSSEPTNYDRFKDG  194
            +LG RPF  +E + Y+ F +G
Sbjct  189  LLGPRPF--AEKSTYEEFVEG  207



>gb|EXX70583.1| m-AAA protease subunit YTA12 [Rhizophagus irregularis DAOM 197198w]
Length=813

 Score =   225 bits (573),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKVTI+PRG AALG+AQY+P +  L +  QL D
Sbjct  596  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVTIIPRGVAALGYAQYLPKDQYLYSTAQLLD  655

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGR SEQ+    I+TGA +DL++VTK+ YAQV  YG +  VG LSF  PN+N  
Sbjct  656  RMCMTLGGRVSEQIFFNIITTGAHDDLQRVTKLAYAQVTTYGMNPNVGPLSFNSPNDNEP  715

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +  KPYS +TA +ID EVR+ +A AYE TV+L+ + K  V ++A+LLL K VL+++D++ 
Sbjct  716  QFQKPYSEETAKMIDEEVRKLVASAYERTVKLLTDKKNDVEKVAQLLLSKEVLNRDDMIS  775

Query  256  VLGERPFKSSEPTNYDRF  203
            +LG+RPF   E  NY+ +
Sbjct  776  LLGKRPF--VEKNNYEEY  791



>ref|XP_001744500.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90449.1| predicted protein [Monosiga brevicollis MX1]
Length=637

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 161/230 (70%), Gaps = 12/230 (5%)
 Frame = -3

Query  784  RRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTC  605
            +RT AYH +GHAV G +LEHA+PLLKV+I+PRG+AALG+AQY+P E  L + +QL D  C
Sbjct  397  KRTVAYHEAGHAVCGWYLEHADPLLKVSIIPRGSAALGYAQYLPQERFLFSTQQLLDRMC  456

Query  604  MTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAFEMS  428
            M LGGR SEQ+   +I+TGAQ+DL+KVT++ Y+Q+AVYG + KVG LSF  P++N     
Sbjct  457  MMLGGRVSEQIFFERITTGAQDDLQKVTRLAYSQIAVYGMNTKVGNLSFKMPDDNEPAFD  516

Query  427  KPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRVLG  248
            KPYS  TA +ID E R  +  A+  T++L+ E ++ V ++A+LLL++ VL ++D+V +LG
Sbjct  517  KPYSEATAQMIDEEARNLVQTAFTRTLELLTEKRDAVEKVAQLLLDREVLSRQDMVDLLG  576

Query  247  ERPFKSSEPTNYDRF-KDGFVEDKETEA--------KDTAENKSTKDDDS  125
             RPFK  E  +YD+F +D   +D+E +         +++A+ +  +D DS
Sbjct  577  TRPFK--EKHDYDQFMEDAGSDDQEVQLPPGLRNLERESAQKRHDRDADS  624



>ref|WP_037460377.1| peptidase M41, partial [Sphingobacterium spiritivorum]
Length=655

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  518  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNISFRDSSGESQ  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  I+  YE T +L+  ++E + +IAE LLEK +L Q DL  +
Sbjct  578  FQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLIKIAEKLLEKEILFQSDLEEI  637

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  638  LGKRPFVNR--TTYDEFVNG  655



>ref|WP_039990218.1| peptidase M41, partial [Sphingobacterium spiritivorum]
Length=655

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  518  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNISFRDSSGESQ  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  I+  YE T +L+  ++E + +IAE LLEK +L Q DL  +
Sbjct  578  FQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLIKIAEKLLEKEILFQSDLEEI  637

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  638  LGKRPFVNR--TTYDEFVNG  655



>emb|CEJ01398.1| Putative Cell division protease ftsH [Rhizopus microsporus]
Length=751

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG +L+HA+PLLKV+++PRG+AALG+AQY+P +  L +KEQL D
Sbjct  535  PEEKKTVAYHEAGHAVAGWYLKHADPLLKVSVIPRGSAALGYAQYLPKDQYLYSKEQLLD  594

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  YG ++KVG LSF  ++N  +
Sbjct  595  RMCMTLGGRVSEQIFFDSITTGAHDDLQKVTKIAYAQITQYGMNEKVGALSF-TDQNEQQ  653

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            + KPYS +TA +IDNE R  + +AYE T++L+ E K+ + ++A LLL+K VL +ED+ ++
Sbjct  654  LQKPYSEQTATLIDNEARRMVNEAYERTLKLLSEKKQDIEKVARLLLDKEVLTREDMEKL  713

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF   E T YD +
Sbjct  714  LGKRPF--DEHTVYDEY  728



>gb|EFK59817.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33861]
Length=689

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  518  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNISFRDSSGESQ  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  I+  YE T +L+  ++E + +IAE LLEK +L Q DL  +
Sbjct  578  FQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLIKIAEKLLEKEILFQSDLEEI  637

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  638  LGKRPFVNR--TTYDEFVNG  655



>ref|XP_011064066.1| PREDICTED: AFG3-like protein 2 isoform X1 [Acromyrmex echinatior]
Length=810

 Score =   224 bits (571),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 7/208 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHA+ G FLEHA+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  560  PEEKKTVAYHEAGHAITGWFLEHADPLLKVSIIPRGKG-LGYAQYLPRELYLYTKEQLFD  618

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CM LGGRASE++  G+I+TGAQ+DL+K+TK+ YAQ+  YG ++K+G +SF  PN    
Sbjct  619  RMCMMLGGRASEEIFFGRITTGAQDDLQKITKVAYAQITQYGMNEKIGNVSFEMPNTGEL  678

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
               KPYS  TA +IDNEVR+ I KA++ T+ L+ EHKE V ++AE LL++ +L ++D++ 
Sbjct  679  VFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLNEHKEDVIKVAERLLKQEILSRDDMIE  738

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED  182
            +LG RPF+  E + Y+ F +G   F ED
Sbjct  739  LLGPRPFR--EKSTYEEFVEGTGSFEED  764



>gb|EEI91234.1| ATP-dependent metallopeptidase HflB [Sphingobacterium spiritivorum 
ATCC 33300]
Length=690

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  518  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNISFRDSSGESQ  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID EVR  I+  YE T +L+  ++E + +IAE LLEK +L Q DL  +
Sbjct  578  FQKPYSDQTAELIDEEVRTLISAVYERTRELLLANQEGLIKIAEKLLEKEILFQSDLEEI  637

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  638  LGKRPFVNR--TTYDEFVNG  655



>ref|XP_011064067.1| PREDICTED: AFG3-like protein 2 isoform X2 [Acromyrmex echinatior]
Length=787

 Score =   224 bits (570),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 151/208 (73%), Gaps = 7/208 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHA+ G FLEHA+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  537  PEEKKTVAYHEAGHAITGWFLEHADPLLKVSIIPRGKG-LGYAQYLPRELYLYTKEQLFD  595

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CM LGGRASE++  G+I+TGAQ+DL+K+TK+ YAQ+  YG ++K+G +SF  PN    
Sbjct  596  RMCMMLGGRASEEIFFGRITTGAQDDLQKITKVAYAQITQYGMNEKIGNVSFEMPNTGEL  655

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
               KPYS  TA +IDNEVR+ I KA++ T+ L+ EHKE V ++AE LL++ +L ++D++ 
Sbjct  656  VFDKPYSEYTAQLIDNEVRDLIEKAHKRTLALLNEHKEDVIKVAERLLKQEILSRDDMIE  715

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED  182
            +LG RPF+  E + Y+ F +G   F ED
Sbjct  716  LLGPRPFR--EKSTYEEFVEGTGSFEED  741



>gb|EFN79635.1| AFG3-like protein 2 [Harpegnathos saltator]
Length=438

 Score =   216 bits (551),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 160/242 (66%), Gaps = 18/242 (7%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLE+A+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  184  PEEKKTVAYHEAGHAVAGWFLEYADPLLKVSIIPRGKG-LGYAQYLPREQYLYTKEQLFD  242

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SE++  G+I+TGAQ+DL+K+T++ YAQ+  +G ++KVG +SF  P     
Sbjct  243  RMCMTLGGRVSEEIFFGRITTGAQDDLQKITEIAYAQITQFGMNEKVGNVSFQVPKPGDV  302

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS  TA +IDNEVR  +  A++ T  L+ EHKE V ++AE LL++ +L ++D++ 
Sbjct  303  VLDKPYSEYTAQLIDNEVRSLVDSAHKRTRTLLSEHKEDVIKVAERLLKQEILSRDDMIE  362

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED-----------KETEAKDTAENKSTKDDDSSP  119
            +LG RPF+  E + Y+ F +G   F ED           K  E      NK +K+ +S+ 
Sbjct  363  LLGARPFR--EKSTYEEFVEGTGSFEEDTTLPEGLKEWNKPQEEDSEDGNKKSKETESNK  420

Query  118  LQ  113
             Q
Sbjct  421  FQ  422



>ref|WP_028295325.1| peptidase M41 [Olivibacter sitiensis]
Length=694

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/236 (50%), Positives = 152/236 (64%), Gaps = 14/236 (6%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  460  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  519

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  GKISTGAQNDLE++TK+ YA V VYG ++KVG +SF  ++ + +
Sbjct  520  GMCMTMGGRVAEDITFGKISTGAQNDLERITKLAYAMVTVYGMNNKVGNISFNDSQES-Q  578

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS KTA +ID EVR  I   Y  T  L+ + +E +  +AE LLEK +L Q DL ++
Sbjct  579  FHKPYSEKTAELIDGEVRGLIEDVYAKTKALLTDKQEGLKALAEKLLEKEILFQSDLEQI  638

Query  253  LGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAE---------NKSTKDDDSSPLQ  113
            LG+RPF     T YD F +G   D   + K  AE         N  T D  +SP Q
Sbjct  639  LGKRPFDHR--TTYDEFVNG--NDDAADQKPAAEGLIHDGVGDNSGTFDPKASPDQ  690



>ref|WP_026968576.1| peptidase M41 [Algoriphagus terrigena]
Length=688

 Score =   222 bits (565),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 158/233 (68%), Gaps = 5/233 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  452  PEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYQTEQLMD  511

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGRA+EQ++ GKISTGA +DLE++TK+ Y+ V+VYG ++K+G +SF     + +
Sbjct  512  EMCMTLGGRAAEQIIFGKISTGALSDLERITKLAYSIVSVYGMNEKIGNVSFYDSKSDGY  571

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +M+KPYS  TA +ID EV   I  AYE T+ L+ EH+EH+  +A+ LLEK +L Q DL  
Sbjct  572  KMTKPYSEATAEMIDQEVSSLIQNAYERTLDLLNEHREHLEVLAKELLEKEILFQADLES  631

Query  256  VLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            ++G+RPF  ++ T Y  F +   E K  E    A  +   ++ S PL  + +P
Sbjct  632  LIGKRPF--AKETTYQAFTNKKKEPKVPEL--IAGEEEVPEESSDPLTSKPIP  680



>ref|WP_009053651.1| peptidase M41 [Nitritalea halalkaliphila]
 gb|EIM78320.1| ATP-dependent metalloprotease FtsH [Nitritalea halalkaliphila 
LW7]
Length=684

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 156/226 (69%), Gaps = 4/226 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  452  PDEKRIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYQTEQLMD  511

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENA-F  437
              CMTLGGRA+E+++ GKISTGA +DLE+VTKM Y+ V+VYG +DK+G +SF  ++ + +
Sbjct  512  EMCMTLGGRAAEELIFGKISTGALSDLERVTKMAYSIVSVYGMNDKIGNVSFYDSKGSEY  571

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             M KPYS+KTA  ID EVR+ I   YE T  L++E  E + ++A+ LL+K +L Q DL+ 
Sbjct  572  RMQKPYSDKTAETIDEEVRKLITLCYERTKVLLQERMEELEKLAQELLKKEILFQTDLIA  631

Query  256  VLGERPFKSSEPTNYDRFKDGFVE-DKETEAKDTAENKSTKDDDSS  122
            ++G+RPF   + T Y+ F     E D++ E K      ST + D +
Sbjct  632  LIGKRPF--DKETTYEAFTKKVDENDRKREEKQQTPQASTGNSDET  675



>emb|CEI94349.1| Putative AFG3 family protein [Rhizopus microsporus]
Length=817

 Score =   223 bits (568),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 148/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG +L+HA+PLLKV+++PRG+AALG+AQY+P +  L +K+QL D
Sbjct  605  PEEKKTVAYHEAGHAVAGWYLKHADPLLKVSVIPRGSAALGYAQYLPKDQYLYSKDQLLD  664

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  YG ++KVG LSF  ++N  +
Sbjct  665  RMCMTLGGRVSEQIFFDSITTGAHDDLQKVTKIAYAQITQYGMNEKVGALSF-TDQNEQQ  723

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            + KPYS +TA +IDNE R  + +AYE T++L+ E K+ + ++A LLL+K VL +ED+ ++
Sbjct  724  LQKPYSEQTATLIDNEARRMVNEAYERTLKLLSEKKQDIEKVARLLLDKEVLTREDMEKL  783

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF   E T YD +
Sbjct  784  LGKRPF--DEHTVYDEY  798


 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 58/83 (70%), Gaps = 2/83 (2%)
 Frame = -3

Query  451  NENAFEMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQ  272
            ++N  ++ KPYS +TA +IDNE R  + +AYE T+ L+ E K+ + ++A LLL+K VL +
Sbjct  443  HQNEQQLQKPYSEQTATLIDNEARRIVNEAYERTLNLLNEKKQDIEKVARLLLDKEVLTR  502

Query  271  EDLVRVLGERPFKSSEPTNYDRF  203
            ED+ ++LG+RPF   E T YD +
Sbjct  503  EDMEKLLGKRPF--DEHTVYDEY  523



>ref|WP_026902710.1| peptidase M41 [Pedobacter glucosidilyticus]
Length=694

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 140/200 (70%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  465  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLSD  524

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++ GKISTGAQNDLE++TK+ YA V +YG + KVG +SF    N + 
Sbjct  525  GLCMTMGGRVAEDIIFGKISTGAQNDLERITKLAYAMVTIYGMNPKVGNVSFHDPNNEYN  584

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             SKPYS+KTA +ID EVR  I   Y  T +L+ E +E +  +A+ LLEK +L Q DL  +
Sbjct  585  FSKPYSDKTAELIDIEVRLLIEGIYNRTKELLTEKREGLELLAQKLLEKEILFQSDLEEI  644

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF     T YD F +G
Sbjct  645  LGKRPFDHR--TTYDEFVNG  662



>ref|WP_038701774.1| peptidase M41 [Sphingobacterium sp. ML3W]
 gb|AIM39226.1| peptidase M41 [Sphingobacterium sp. ML3W]
Length=690

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 139/197 (71%), Gaps = 4/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG +LEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWYLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYTTEQLVD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+YG +DKVG +SF      F 
Sbjct  518  SLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAIYGMNDKVGNVSFRDGSEQFH  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS+KTA +ID+EVR  I   Y  T QL+ + ++ +  IAE LLEK +L Q DL  +
Sbjct  578  --KPYSDKTAELIDSEVRNLITDVYARTKQLLLDKQDGLVAIAEKLLEKEILFQSDLEEI  635

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF +   T YD F
Sbjct  636  LGKRPFDTK--TTYDEF  650



>emb|CDT09988.1| ATP-dependent zinc metalloprotease FtsH [Sphingobacterium sp. 
PM2-P1-29]
Length=690

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 139/197 (71%), Gaps = 4/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  458  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYTTEQLVD  517

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA VA+YG ++KVG +SF      F 
Sbjct  518  SLCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVAIYGMNEKVGNVSFRDGSEQFH  577

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS+KTA +ID+EVR  I   Y  T QL+ E ++ +  IAE LLEK +L Q DL  +
Sbjct  578  --KPYSDKTAELIDSEVRNLITDVYTRTKQLLLEKQDGLIAIAEKLLEKEILFQSDLEEI  635

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF +   T YD F
Sbjct  636  LGKRPFDTK--TTYDEF  650



>ref|WP_019597947.1| peptidase M41 [Rhodonellum psychrophilum]
 gb|ERM84443.1| peptidase M41 [Rhodonellum psychrophilum GCM71 = DSM 17998]
Length=684

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/228 (49%), Positives = 157/228 (69%), Gaps = 3/228 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  452  PEEKRIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAALGYAQYLPKEQFLYQTEQLLD  511

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNE-NAF  437
              CMTLGGRA+E+++ GKISTGA +DLE+VTK+ Y+ V VYG +DK+G +SF  ++ N +
Sbjct  512  EICMTLGGRAAEEIIFGKISTGALSDLERVTKVAYSMVTVYGMNDKIGNVSFYESKGNDY  571

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +M+KPYS  TA  ID EVR+ I++AYE T  L+   K  V  +A+ LLEK ++ Q DL R
Sbjct  572  KMTKPYSETTAETIDEEVRKLISQAYERTKALLNSKKAEVETLAQELLEKEIIFQSDLER  631

Query  256  VLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQ  113
            ++G+RPF  ++ T Y+ +        E   K+ A+++  +D   + +Q
Sbjct  632  LIGKRPF--AKETTYEAYTKKVPVKVEVSEKEVAKDEKPEDPAEAEVQ  677



>ref|WP_033563684.1| peptidase M41 [Sphingobacteriaceae bacterium DW12]
Length=688

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  457  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLLD  516

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA  AVYG + KVG +SF  +    +
Sbjct  517  SMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMTAVYGMNHKVGNVSFRDSSGESQ  576

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS++TA +ID+EVR  ++  Y+ T +L+ E ++ +  IAE LLEK +L Q DL  +
Sbjct  577  FQKPYSDQTAELIDDEVRTLVSAVYDRTKELLLEKQDGLVAIAEKLLEKEILFQSDLEEI  636

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  637  LGKRPFANR--TAYDEFVNG  654



>ref|WP_036676326.1| peptidase M41 [Pedobacter sp. R20-19]
Length=702

 Score =   221 bits (564),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 143/200 (72%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +R  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  470  PEEKRIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLTD  529

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E +  G+ISTGAQNDLE++TK+ YA V++YG ++ VG +SF   +N + 
Sbjct  530  GMCMTMGGRVAEDITFGRISTGAQNDLERITKLAYAMVSIYGMNEAVGNVSFHDPQNEYN  589

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             +KPYS KT+ +ID EVR+ I   Y  T QL+ + +E + ++A+ LLEK +L Q DL  +
Sbjct  590  FNKPYSEKTSELIDVEVRKLIGDVYIKTKQLLIDKQEGLEKLAQKLLEKEILFQADLEEI  649

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF +   T YD F +G
Sbjct  650  LGKRPFDTR--TTYDEFVNG  667



>emb|CEG68111.1| Putative Cell division protease ftsH [Rhizopus microsporus]
Length=736

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG +L+HA+PLLKV+++PRG+AALG+AQY+P +  L +K+QL D
Sbjct  535  PEEKKTVAYHEAGHAVAGWYLKHADPLLKVSVIPRGSAALGYAQYLPKDQYLYSKDQLLD  594

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  YG ++KVG LSF  ++N  +
Sbjct  595  RMCMTLGGRVSEQIFFDSITTGAHDDLQKVTKIAYAQITQYGMNEKVGALSF-TDQNEQQ  653

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            + KPYS +TA +IDNE R  + +AYE T+ L+ E K+ + ++A LLL+K VL +ED+ ++
Sbjct  654  LQKPYSEQTATLIDNEARRIVNEAYERTLNLLNEKKQDIEKVARLLLDKEVLTREDMEKL  713

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF   E T YD +
Sbjct  714  LGKRPF--DEHTVYDEY  728



>gb|AFM03376.1| membrane protease FtsH catalytic subunit [Flexibacter litoralis 
DSM 6794]
Length=674

 Score =   221 bits (562),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +   AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  463  PEEKEIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAALGYAQYLPKEQFLYTIEQLTD  522

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+VYG + K+G +SF   + +  
Sbjct  523  EMCMALGGRAAEDIIFGKISTGALSDLERITKMAYSMVSVYGMNPKIGNVSFYDAQRSDF  582

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS  TA IID EV+E + +AY  T +L+ EHK+ +  IA+ LLEK VL Q DL R+
Sbjct  583  AGKPYSEATAQIIDEEVKEMVERAYTFTKELLTEHKDALETIAQELLEKEVLFQIDLERL  642

Query  253  LGERPFKSSEPTNYDRF-KDGF  191
            +G+RPF   +PTNY++  K+GF
Sbjct  643  IGKRPF--DKPTNYEKHTKNGF  662



>emb|CEG68110.1| Putative YALI0A10615p [Rhizopus microsporus]
Length=751

 Score =   222 bits (565),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 147/197 (75%), Gaps = 3/197 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG +L+HA+PLLKV+++PRG+AALG+AQY+P +  L +K+QL D
Sbjct  535  PEEKKTVAYHEAGHAVAGWYLKHADPLLKVSVIPRGSAALGYAQYLPKDQYLYSKDQLLD  594

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMTLGGR SEQ+    I+TGA +DL+KVTK+ YAQ+  YG ++KVG LSF  ++N  +
Sbjct  595  RMCMTLGGRVSEQIFFDSITTGAHDDLQKVTKIAYAQITQYGMNEKVGALSF-TDQNEQQ  653

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
            + KPYS +TA +IDNE R  + +AYE T+ L+ E K+ + ++A LLL+K VL +ED+ ++
Sbjct  654  LQKPYSEQTATLIDNEARRIVNEAYERTLNLLNEKKQDIEKVARLLLDKEVLTREDMEKL  713

Query  253  LGERPFKSSEPTNYDRF  203
            LG+RPF   E T YD +
Sbjct  714  LGKRPF--DEHTVYDEY  728



>ref|WP_039450881.1| peptidase M41 [Pedobacter glucosidilyticus]
 gb|KHJ38295.1| ATP-dependent zinc metalloprotease FtsH 4 [Pedobacter glucosidilyticus]
Length=694

 Score =   221 bits (562),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 139/200 (70%), Gaps = 2/200 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHA+AG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  465  PEEKKIVAYHEAGHAIAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYTTEQLSD  524

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CMT+GGR +E ++  KISTGAQNDLE++TK+ YA V +YG + KVG +SF    N + 
Sbjct  525  GLCMTMGGRVAEDIIFNKISTGAQNDLERITKLAYAMVTIYGMNPKVGNVSFHDPNNEYN  584

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
             SKPYS+KTA +ID EVR  I   Y  T QL+ E +E +  +A+ LLEK +L Q DL  +
Sbjct  585  FSKPYSDKTAELIDIEVRLLIEGIYNRTKQLLTEKREGLELLAQKLLEKEILFQSDLEEI  644

Query  253  LGERPFKSSEPTNYDRFKDG  194
            LG+RPF     T YD F +G
Sbjct  645  LGKRPFDHR--TTYDEFVNG  662



>ref|XP_003737319.1| PREDICTED: LOW QUALITY PROTEIN: AFG3-like protein 2-like [Metaseiulus 
occidentalis]
Length=647

 Score =   220 bits (560),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 158/232 (68%), Gaps = 11/232 (5%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E  L T EQLFD
Sbjct  404  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-LGYAQYLPKEQYLYTTEQLFD  462

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SEQ+   KI+TGAQ+DL+KVT+  YAQ+  +G +DK+G LSF  P     
Sbjct  463  RMCMTLGGRVSEQIFFKKITTGAQDDLQKVTRSAYAQIVQFGMNDKIGNLSFEMPQPGDM  522

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             M KPYS +TA +ID+EVR  + +AY+ T++L+ +H+  V ++A  LL K +L++ED++ 
Sbjct  523  VMEKPYSEETAQMIDSEVRSLVDRAYDTTMKLLTDHRSDVEKVAVRLLSKEILNREDMIE  582

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED----KETEAKDTAENKSTKDDDSS  122
            +LG+RPF   E + Y+ F  G   F ED    K  E+ + A+ + T + + S
Sbjct  583  LLGKRPF--PEKSTYEEFVQGTGSFEEDVTLPKGLESWNKAKEERTSEGEKS  632



>ref|XP_783782.2| PREDICTED: AFG3-like protein 2 [Strongylocentrotus purpuratus]
Length=792

 Score =   222 bits (565),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/231 (49%), Positives = 162/231 (70%), Gaps = 13/231 (6%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLEHA+PLLKV+I+PRG   LG+AQY+P E+ L T+EQ+  
Sbjct  558  PEEKKTVAYHEAGHAVAGWFLEHADPLLKVSIIPRGKG-LGYAQYLPKEHFLFTQEQMLH  616

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGRASEQ+   K+++GAQ+DL+KVT+M YAQV  +G SDKVG +SF  P +   
Sbjct  617  RMCMTLGGRASEQIFFDKVTSGAQDDLKKVTQMAYAQVVQFGMSDKVGNVSFDMPQQGEM  676

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS +TA +ID EVR  I  AY+ T+ L++++K++V  +A+ LLE+ VL+++D+V 
Sbjct  677  VLEKPYSEQTAQMIDEEVRSMIKSAYDSTLDLLKKNKDNVEMVAQRLLEREVLNKDDMVE  736

Query  256  VLGERPFKSSEPTNYDRFKDG---FVEDK------ETEAKDTAENKSTKDD  131
            +LG+RPF  +E T Y+ F +G   F ED       E   +++ + K  KDD
Sbjct  737  LLGKRPF--AERTTYEDFVEGTGSFEEDTSLPKGLEGWNEESEKKKGLKDD  785



>ref|WP_026951332.1| peptidase M41 [Algoriphagus mannitolivorans]
Length=692

 Score =   220 bits (561),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/233 (48%), Positives = 161/233 (69%), Gaps = 5/233 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  455  PEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYQTEQLID  514

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGRA+E+++ GKISTGA +DLE++TK+ Y+ V+VYG ++K+G +SF     + +
Sbjct  515  EMCMTLGGRAAEEIVFGKISTGALSDLERITKLAYSIVSVYGMNEKLGNISFYDSKSDGY  574

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +M+KPYS  TA +ID EV + I  AY+ T+ L+ EH+EH+  +A+ LLEK +L Q DL +
Sbjct  575  KMTKPYSEATAEMIDQEVSKLIQFAYQRTLDLLREHREHLEILAKELLEKEILFQSDLEK  634

Query  256  VLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDDDSSPLQPEVVP  98
            ++G+RPF  ++ T Y  + +   +DK    +  A  +  K + S PL  + +P
Sbjct  635  LIGKRPF--AKETTYQAYTNK--KDKVKGPELVAGEEEAKPESSDPLTSDPIP  683



>ref|XP_005816528.1| PREDICTED: AFG3-like protein 1-like [Xiphophorus maculatus]
Length=666

 Score =   219 bits (559),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/233 (49%), Positives = 156/233 (67%), Gaps = 9/233 (4%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHA+ G FL+HA+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  431  PTEKKTVAYHEAGHAIVGWFLQHADPLLKVSIIPRGKG-LGYAQYLPREQYLYTKEQLFD  489

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CM LGGR +EQV  G+I+TGAQ+DL+KVT+  YAQV  +G SDKVG +SF  P +   
Sbjct  490  RMCMMLGGRVAEQVFFGRITTGAQDDLKKVTQSAYAQVVQFGMSDKVGQVSFDLPRQGEM  549

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS  TA +ID EVR  + +AYE T+QLI + KE V ++ + LLEK VL + D+V 
Sbjct  550  VLEKPYSEATAELIDEEVRGLVDRAYERTLQLITDKKEQVDKVGKRLLEKEVLDKADMVE  609

Query  256  VLGERPFKSSEPTNYDRFKDG---FVEDKETE--AKDTAENKSTKDDDSSPLQ  113
            +LG RPF+  E + Y+ F +G   F ED       +D  + +  + +++ P Q
Sbjct  610  LLGPRPFQ--EKSTYEEFVEGTGSFEEDTSLPDGLRDWNQQRGGEAEETDPTQ  660



>ref|WP_041264331.1| peptidase M41, partial [Flexibacter litoralis]
Length=658

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 142/196 (72%), Gaps = 2/196 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +   AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  463  PEEKEIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAALGYAQYLPKEQFLYTIEQLTD  522

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPPNENAFE  434
              CM LGGRA+E ++ GKISTGA +DLE++TKM Y+ V+VYG + K+G +SF   + +  
Sbjct  523  EMCMALGGRAAEDIIFGKISTGALSDLERITKMAYSMVSVYGMNPKIGNVSFYDAQRSDF  582

Query  433  MSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVRV  254
              KPYS  TA IID EV+E + +AY  T +L+ EHK+ +  IA+ LLEK VL Q DL R+
Sbjct  583  AGKPYSEATAQIIDEEVKEMVERAYTFTKELLTEHKDALETIAQELLEKEVLFQIDLERL  642

Query  253  LGERPFKSSEPTNYDR  206
            +G+RPF   +PTNY++
Sbjct  643  IGKRPF--DKPTNYEK  656



>ref|WP_009186129.1| peptidase M41 [Cecembia lonarensis]
 gb|EKB48294.1| ATP-dependent zinc metalloprotease FtsH [Cecembia lonarensis 
LW9]
Length=687

 Score =   219 bits (559),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 158/232 (68%), Gaps = 8/232 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  452  PEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPKEQFLYQTEQLMD  511

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGRA+E+++ GKISTGA +DLE++TKM Y+ V++YG +DK+G +SF     N +
Sbjct  512  EMCMTLGGRAAEEIIFGKISTGALSDLERITKMAYSMVSIYGMNDKIGNVSFYDSKSNEY  571

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             M+KPYS  TA  ID EVR+ I+ AYE T +L+ E +  +  +++ LLEK +L Q DL +
Sbjct  572  RMTKPYSETTAETIDEEVRKLISIAYERTKKLLTEKRNELEILSKELLEKEILFQTDLEK  631

Query  256  VLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTA----ENKSTKDDDSSPLQ  113
            ++G+RPF  ++ T Y+ F    VE+KE   K  +    E+ S K  D+   Q
Sbjct  632  LIGKRPF--AKETTYEAFTKK-VEEKEKAQKAASIAKEESDSVKGTDAEKAQ  680



>ref|WP_020892866.1| Cell division protein FtsH [Cyclobacterium qasimii]
 gb|EPR68329.1| Cell division protein FtsH [Cyclobacterium qasimii M12-11B]
Length=678

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 153/222 (69%), Gaps = 5/222 (2%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++  AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L   EQL D
Sbjct  451  PEEKKIVAYHEAGHAVAGWFLEHADPLVKVSIVPRGIAALGYAQYLPKEQFLYQTEQLID  510

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CM LGGRA+EQ++ GKISTGA +DLE++TKM Y+ V+VYG +DK+G +SF     N +
Sbjct  511  EMCMALGGRAAEQIIFGKISTGALSDLERITKMAYSIVSVYGMNDKIGNVSFYDSKSNDY  570

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
            +  KPYS  TA  ID EVR+ I  AY  T+ L+++ K+ + +IA+ LLEK +L Q DL +
Sbjct  571  KFDKPYSENTAQTIDEEVRKLIEFAYTKTLDLLKDKKDELVKIAKELLEKEILFQADLEK  630

Query  256  VLGERPFKSSEPTNYDRFKDGFVEDKETEAKDTAENKSTKDD  131
            ++G+RPF   + T Y++F    V+++ET   +  E     DD
Sbjct  631  LIGKRPF--DKETTYEKFTK--VKEEETALIEVKEETPESDD  668



>ref|XP_011254538.1| PREDICTED: AFG3-like protein 2 isoform X2 [Camponotus floridanus]
Length=782

 Score =   220 bits (561),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 152/208 (73%), Gaps = 7/208 (3%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  ++T AYH +GHAVAG FLE+A+PLLKV+I+PRG   LG+AQY+P E  L TKEQLFD
Sbjct  528  PEEKKTVAYHEAGHAVAGWFLEYADPLLKVSIIPRGKG-LGYAQYLPREQYLYTKEQLFD  586

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFP-PNENAF  437
              CMTLGGR SE++  G+I+TGAQ+DL+K+T++ YAQ+  YG ++KVG +SF  P     
Sbjct  587  RMCMTLGGRVSEEIFFGRITTGAQDDLQKITEIAYAQIMQYGMNEKVGNVSFQMPKPGDM  646

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
             + KPYS  TA +IDNEVR+ I +A++ T  L+ EHKE+V ++AE LL++ +L ++D++ 
Sbjct  647  VLDKPYSEYTAQLIDNEVRDLIDRAHKRTRTLLNEHKENVIKVAERLLKQEILSRDDMIE  706

Query  256  VLGERPFKSSEPTNYDRFKDG---FVED  182
            +LG RPF+  E + Y+ F +G   F ED
Sbjct  707  LLGPRPFR--EKSTYEEFVEGTGSFEED  732



>ref|WP_026999681.1| peptidase M41 [Flexibacter elegans]
Length=676

 Score =   219 bits (557),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 139/187 (74%), Gaps = 1/187 (1%)
 Frame = -3

Query  793  PAGRRTXAYHXSGHAVAGXFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFD  614
            P  +RT AYH +GHAVAG FLEHA+PL+KV+IVPRG AALG+AQY+P E  L T EQL D
Sbjct  450  PEEKRTVAYHEAGHAVAGWFLEHADPLVKVSIVPRGVAALGYAQYLPREQFLYTTEQLLD  509

Query  613  MTCMTLGGRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSF-PPNENAF  437
              CMTLGGRA+E ++ GKISTGA +DLE++TKM Y+ V++YG +DK+G +SF    ++ +
Sbjct  510  EMCMTLGGRAAEDIVFGKISTGALSDLERITKMAYSMVSIYGMNDKIGNVSFYDSKQSDY  569

Query  436  EMSKPYSNKTAAIIDNEVREWIAKAYECTVQLIEEHKEHVAQIAELLLEKGVLHQEDLVR  257
              +KPYS+ TA  ID EVR+ I  AYE T  L+ +H+E + ++A+ LL K +L Q DL  
Sbjct  570  SFNKPYSDATAQTIDEEVRKLIDTAYERTKALLTQHREALEKVAQELLSKEILFQTDLEN  629

Query  256  VLGERPF  236
            ++G+RPF
Sbjct  630  LIGKRPF  636



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1739635120055