BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF032B18

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778293.1|  PREDICTED: CASP-like protein 2B1                   308   8e-103   Nicotiana sylvestris
emb|CDP04507.1|  unnamed protein product                                304   4e-101   Coffea canephora [robusta coffee]
ref|XP_004250287.1|  PREDICTED: CASP-like protein 2B1                   301   8e-100   Solanum lycopersicum
ref|XP_009592222.1|  PREDICTED: CASP-like protein 2B1                   300   1e-99    Nicotiana tomentosiformis
ref|XP_006365844.1|  PREDICTED: CASP-like protein GSVIVT000135020...    300   2e-99    Solanum tuberosum [potatoes]
ref|XP_009627397.1|  PREDICTED: CASP-like protein 2B1                   300   2e-99    Nicotiana tomentosiformis
ref|XP_006352330.1|  PREDICTED: CASP-like protein RCOM_0864260-like     300   2e-99    Solanum tuberosum [potatoes]
ref|XP_009789786.1|  PREDICTED: CASP-like protein 2B1                   300   2e-99    Nicotiana sylvestris
ref|XP_002522908.1|  conserved hypothetical protein                     299   5e-99    Ricinus communis
ref|XP_004239817.1|  PREDICTED: CASP-like protein 2B1                   298   8e-99    Solanum lycopersicum
ref|XP_006467305.1|  PREDICTED: CASP-like protein POPTRDRAFT_8189...    298   1e-98    Citrus sinensis [apfelsine]
ref|XP_011095935.1|  PREDICTED: CASP-like protein 2B1                   296   4e-98    Sesamum indicum [beniseed]
sp|A7R385.1|CSPLC_VITVI  RecName: Full=CASP-like protein 2B1; Sho...    295   1e-97    Vitis vinifera
ref|XP_011086255.1|  PREDICTED: CASP-like protein 2B1                   294   3e-97    Sesamum indicum [beniseed]
ref|XP_006449900.1|  hypothetical protein CICLE_v10016754mg             293   9e-97    Citrus clementina [clementine]
ref|XP_002307903.1|  integral membrane family protein                   291   4e-96    Populus trichocarpa [western balsam poplar]
ref|XP_008227444.1|  PREDICTED: CASP-like protein RCOM_0864260          290   2e-95    Prunus mume [ume]
ref|XP_011004511.1|  PREDICTED: CASP-like protein 2B2                   289   3e-95    Populus euphratica
gb|EYU27670.1|  hypothetical protein MIMGU_mgv1a013955mg                288   1e-94    Erythranthe guttata [common monkey flower]
ref|XP_007212067.1|  hypothetical protein PRUPE_ppa011591mg             288   1e-94    Prunus persica
ref|XP_002323133.1|  hypothetical protein POPTR_0016s01010g             285   1e-93    Populus trichocarpa [western balsam poplar]
gb|EYU33843.1|  hypothetical protein MIMGU_mgv1a024377mg                285   1e-93    Erythranthe guttata [common monkey flower]
gb|KDP29302.1|  hypothetical protein JCGZ_19405                         283   7e-93    Jatropha curcas
gb|AGE09573.1|  UPF-like protein                                        279   2e-91    Eucalyptus cladocalyx
ref|XP_007026314.1|  CASP-like protein POPTRDRAFT_818956 isoform 1      278   5e-91    
gb|KJB67396.1|  hypothetical protein B456_010G188700                    278   8e-91    Gossypium raimondii
ref|XP_010052948.1|  PREDICTED: CASP-like protein 2B1                   277   2e-90    Eucalyptus grandis [rose gum]
ref|XP_003534893.1|  PREDICTED: CASP-like protein GSVIVT000135020...    276   4e-90    Glycine max [soybeans]
ref|XP_010087633.1|  hypothetical protein L484_010584                   275   1e-89    Morus notabilis
gb|KHN40811.1|  CASP-like protein                                       275   1e-89    Glycine soja [wild soybean]
ref|XP_003547283.1|  PREDICTED: CASP-like protein RCOM_0864260-like     275   2e-89    Glycine max [soybeans]
gb|KHG12114.1|  CASP-like protein                                       277   2e-89    Gossypium arboreum [tree cotton]
gb|KJB69167.1|  hypothetical protein B456_011G008900                    271   5e-88    Gossypium raimondii
ref|XP_009346047.1|  PREDICTED: CASP-like protein RCOM_0864260          270   9e-88    Pyrus x bretschneideri [bai li]
ref|XP_010270196.1|  PREDICTED: CASP-like protein 2B1                   268   4e-87    Nelumbo nucifera [Indian lotus]
ref|XP_004486332.1|  PREDICTED: CASP-like protein POPTRDRAFT_5759...    268   6e-87    Cicer arietinum [garbanzo]
ref|XP_008384165.1|  PREDICTED: CASP-like protein RCOM_0864260 is...    268   1e-86    
ref|XP_008370988.1|  PREDICTED: CASP-like protein RCOM_0864260          266   3e-86    Malus domestica [apple tree]
gb|KHN32948.1|  CASP-like protein                                       266   6e-86    Glycine soja [wild soybean]
ref|XP_003549509.1|  PREDICTED: CASP-like protein RCOM_0864260-like     265   7e-86    Glycine max [soybeans]
ref|XP_003529670.1|  PREDICTED: CASP-like protein RCOM_0864260-like     265   1e-85    Glycine max [soybeans]
ref|XP_003594276.1|  hypothetical protein MTR_2g026530                  264   3e-85    Medicago truncatula
ref|XP_010540841.1|  PREDICTED: CASP-like protein 2B1                   261   3e-84    Tarenaya hassleriana [spider flower]
ref|XP_007154032.1|  hypothetical protein PHAVU_003G085300g             259   2e-83    Phaseolus vulgaris [French bean]
gb|EPS67628.1|  hypothetical protein M569_07146                         258   7e-83    Genlisea aurea
ref|XP_011040245.1|  PREDICTED: CASP-like protein 2B1                   256   1e-82    Populus euphratica
ref|XP_010252724.1|  PREDICTED: CASP-like protein 2B1                   254   1e-81    
ref|XP_006410744.1|  hypothetical protein EUTSA_v10017259mg             251   2e-80    Eutrema salsugineum [saltwater cress]
ref|XP_010909399.1|  PREDICTED: CASP-like protein 2B1                   251   4e-80    Elaeis guineensis
ref|XP_009133041.1|  PREDICTED: CASP-like protein 1                     248   4e-79    Brassica rapa
ref|XP_010686644.1|  PREDICTED: CASP-like protein 2B1                   248   5e-79    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY69773.1|  BnaAnng31470D                                          243   3e-77    Brassica napus [oilseed rape]
ref|NP_565822.1|  CASP-like protein                                     243   4e-77    Arabidopsis thaliana [mouse-ear cress]
gb|AAM66995.1|  unknown                                                 243   4e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KFK36471.1|  hypothetical protein AALP_AA4G129000                    241   2e-76    Arabis alpina [alpine rockcress]
emb|CDX79621.1|  BnaC03g19570D                                          238   6e-75    
ref|XP_002879572.1|  integral membrane family protein                   235   6e-74    
ref|XP_008463603.1|  PREDICTED: CASP-like protein RCOM_0864260          234   1e-73    Cucumis melo [Oriental melon]
ref|XP_004139530.1|  PREDICTED: CASP-like protein GSVIVT000135020...    231   3e-72    Cucumis sativus [cucumbers]
ref|XP_004293384.1|  PREDICTED: CASP-like protein 2B1                   229   8e-72    Fragaria vesca subsp. vesca
ref|XP_006295017.1|  hypothetical protein CARUB_v10024089mg             229   9e-72    
ref|XP_009407837.1|  PREDICTED: CASP-like protein 2B1                   228   3e-71    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907052.1|  PREDICTED: CASP-like protein 2B1                   227   5e-71    Elaeis guineensis
ref|XP_008800613.1|  PREDICTED: CASP-like protein GSVIVT00013502001     226   1e-70    Phoenix dactylifera
gb|KEH36968.1|  CASP POPTRDRAFT-like protein                            224   4e-70    Medicago truncatula
gb|KFK26539.1|  hypothetical protein AALP_AA8G262200                    224   1e-69    Arabis alpina [alpine rockcress]
ref|XP_009414753.1|  PREDICTED: CASP-like protein 2B1                   222   5e-69    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006849031.1|  hypothetical protein AMTR_s00028p00153320          221   8e-69    Amborella trichopoda
ref|XP_009141516.1|  PREDICTED: CASP-like protein 1                     221   1e-68    Brassica rapa
emb|CDY71930.1|  BnaCnng75140D                                          219   8e-68    Brassica napus [oilseed rape]
emb|CDY40441.1|  BnaA04g20760D                                          216   1e-66    Brassica napus [oilseed rape]
ref|XP_007147633.1|  hypothetical protein PHAVU_006G141200g             215   2e-66    Phaseolus vulgaris [French bean]
ref|XP_009124526.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     213   2e-65    Brassica rapa
emb|CDX90524.1|  BnaA03g42570D                                          211   1e-64    
ref|XP_009136766.1|  PREDICTED: CASP-like protein ARALYDRAFT_915107     210   3e-64    Brassica rapa
emb|CDY34471.1|  BnaC01g21620D                                          209   7e-64    Brassica napus [oilseed rape]
ref|XP_009145991.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    208   1e-63    
ref|XP_010647129.1|  PREDICTED: CASP-like protein 2B1                   205   1e-62    
emb|CDY32244.1|  BnaA01g17400D                                          206   2e-62    Brassica napus [oilseed rape]
ref|XP_006414349.1|  hypothetical protein EUTSA_v10026264mg             203   2e-61    Eutrema salsugineum [saltwater cress]
emb|CDY09694.1|  BnaC07g33670D                                          202   3e-61    Brassica napus [oilseed rape]
gb|KJB67397.1|  hypothetical protein B456_010G188700                    199   5e-61    Gossypium raimondii
ref|XP_010509564.1|  PREDICTED: CASP-like protein 2B2                   200   2e-60    Camelina sativa [gold-of-pleasure]
ref|XP_002868133.1|  integral membrane family protein                   198   8e-60    Arabidopsis lyrata subsp. lyrata
ref|NP_567497.1|  uncharacterized protein                               197   1e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010505095.1|  PREDICTED: CASP-like protein 2B2                   196   8e-59    Camelina sativa [gold-of-pleasure]
ref|XP_008384166.1|  PREDICTED: CASP-like protein GSVIVT000135020...    194   2e-58    
ref|XP_009374906.1|  PREDICTED: LOW QUALITY PROTEIN: CASP-like pr...    194   2e-58    Pyrus x bretschneideri [bai li]
ref|XP_010516779.1|  PREDICTED: CASP-like protein 2B2                   192   2e-57    Camelina sativa [gold-of-pleasure]
ref|XP_010917254.1|  PREDICTED: CASP-like protein 2B1                   189   2e-56    Elaeis guineensis
gb|ACU18779.1|  unknown                                                 184   4e-55    Glycine max [soybeans]
emb|CDY70521.1|  BnaCnng68730D                                          184   2e-54    Brassica napus [oilseed rape]
ref|XP_008791870.1|  PREDICTED: CASP-like protein RCOM_0864260          183   5e-54    Phoenix dactylifera
emb|CDY71889.1|  BnaAnng39180D                                          179   1e-52    Brassica napus [oilseed rape]
ref|XP_010440155.1|  PREDICTED: CASP-like protein 2B1                   174   1e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010434824.1|  PREDICTED: CASP-like protein 2B1                   174   2e-50    Camelina sativa [gold-of-pleasure]
ref|XP_010449792.1|  PREDICTED: CASP-like protein 2B1                   173   4e-50    Camelina sativa [gold-of-pleasure]
sp|B8LQF9.1|CSPL9_PICSI  RecName: Full=CASP-like protein 2BC2; Sh...    173   3e-49    Picea sitchensis
ref|XP_006284611.1|  hypothetical protein CARUB_v10005842mg             171   4e-49    Capsella rubella
ref|XP_003558594.1|  PREDICTED: CASP-like protein 2U2                   168   6e-48    Brachypodium distachyon [annual false brome]
gb|EMT22476.1|  hypothetical protein F775_11012                         171   1e-47    
dbj|BAK05801.1|  predicted protein                                      164   2e-46    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985347.1|  PREDICTED: CASP-like protein Sb01g044070-like      164   2e-46    Setaria italica
emb|CAB10420.1|  LET1 like protein                                      172   4e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002468338.1|  hypothetical protein SORBIDRAFT_01g044070          163   8e-46    Sorghum bicolor [broomcorn]
dbj|BAJ91438.1|  predicted protein                                      161   3e-45    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA43987.1|  TPA: hypothetical protein ZEAMMB73_493857              157   1e-43    
dbj|BAK05387.1|  predicted protein                                      157   1e-43    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q10QH3.2|CSPLL_ORYSJ  RecName: Full=CASP-like protein Os03g019...    130   3e-33    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007026315.1|  CASP-like protein POPTRDRAFT_818956 isoform 2      126   1e-31    
ref|XP_003575478.2|  PREDICTED: CASP-like protein 2B1                   125   2e-31    Brachypodium distachyon [annual false brome]
ref|XP_002443261.1|  hypothetical protein SORBIDRAFT_08g016550          124   4e-31    Sorghum bicolor [broomcorn]
sp|D5A8E6.1|CSPL4_PICSI  RecName: Full=CASP-like protein 2BC1; Sh...    119   9e-29    Picea sitchensis
ref|XP_004162507.1|  PREDICTED: CASP-like protein GSVIVT000135020...    115   1e-28    
ref|XP_004162506.1|  PREDICTED: CASP-like protein GSVIVT000135020...    115   2e-28    
dbj|BAJ98184.1|  predicted protein                                      115   4e-28    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS70050.1|  hypothetical protein M569_04716                         113   8e-28    Genlisea aurea
sp|Q0IN16.2|CSPLE_ORYSJ  RecName: Full=CASP-like protein 2B1; Sho...    114   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004163465.1|  PREDICTED: CASP-like protein RCOM_0864260-li...    111   2e-27    
gb|ABF94455.1|  plant integral membrane protein TIGR01569 contain...    108   9e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008777752.1|  PREDICTED: CASP-like protein GSVIVT00013502001     101   7e-24    
gb|KDP36414.1|  hypothetical protein JCGZ_08683                         100   2e-22    Jatropha curcas
ref|XP_006651131.1|  PREDICTED: CASP-like protein Os03g0196400-like     101   3e-22    
gb|KJB53802.1|  hypothetical protein B456_009G006000                    100   3e-22    Gossypium raimondii
sp|B9IM09.2|CSPLG_POPTR  RecName: Full=CASP-like protein 2C1; Sho...    100   3e-22    Populus trichocarpa [western balsam poplar]
ref|NP_001159013.1|  membrane protein                                   100   3e-22    
ref|XP_007014187.1|  CASP-like protein XL3                            99.4    7e-22    
ref|XP_008800283.1|  PREDICTED: CASP-like protein Os06g0656300        99.4    7e-22    Phoenix dactylifera
ref|XP_004962893.1|  PREDICTED: CASP-like protein Sb08g016550-like    99.0    2e-21    Setaria italica
ref|XP_010913647.1|  PREDICTED: CASP-like protein 2C1 isoform X1      97.1    4e-21    Elaeis guineensis
emb|CDY68034.1|  BnaCnng57380D                                        95.9    5e-21    Brassica napus [oilseed rape]
gb|KHF98180.1|  CASP-like protein XL3                                 96.7    8e-21    Gossypium arboreum [tree cotton]
sp|Q5K4H9.1|CSPL2_GOSHI  RecName: Full=CASP-like protein XL3; Alt...  94.0    6e-20    Gossypium hirsutum [American cotton]
ref|XP_011043990.1|  PREDICTED: CASP-like protein 2C1                 93.6    1e-19    Populus euphratica
ref|XP_010260176.1|  PREDICTED: CASP-like protein XL3                 92.4    2e-19    
gb|EYU42435.1|  hypothetical protein MIMGU_mgv1a014854mg              92.4    3e-19    Erythranthe guttata [common monkey flower]
ref|XP_011069901.1|  PREDICTED: CASP-like protein 2C1 isoform X2      91.3    6e-19    Sesamum indicum [beniseed]
ref|NP_001142330.1|  CASP-like protein 2U1                            90.5    1e-18    Zea mays [maize]
ref|XP_007223970.1|  hypothetical protein PRUPE_ppa014614mg           89.7    2e-18    
emb|CDX94411.1|  BnaC01g17730D                                        89.0    4e-18    
ref|XP_010265455.1|  PREDICTED: CASP-like protein 2C1                 88.2    9e-18    Nelumbo nucifera [Indian lotus]
ref|XP_011069900.1|  PREDICTED: CASP-like protein 2C1 isoform X1      87.4    1e-17    Sesamum indicum [beniseed]
ref|XP_009139582.1|  PREDICTED: CASP-like protein ARALYDRAFT_657503   87.4    2e-17    Brassica rapa
ref|XP_009396107.1|  PREDICTED: CASP-like protein 2C1                 87.4    2e-17    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009396704.1|  PREDICTED: CASP-like protein 2C1                 86.7    3e-17    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008223711.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   86.3    5e-17    Prunus mume [ume]
ref|XP_002869651.1|  predicted protein                                84.7    1e-16    Arabidopsis lyrata subsp. lyrata
ref|XP_010046989.1|  PREDICTED: CASP-like protein 2C1                 85.1    1e-16    Eucalyptus grandis [rose gum]
ref|XP_010433586.1|  PREDICTED: CASP-like protein 2C1                 84.7    1e-16    Camelina sativa [gold-of-pleasure]
ref|XP_010448363.1|  PREDICTED: CASP-like protein 2C1                 84.0    2e-16    Camelina sativa [gold-of-pleasure]
emb|CDP02964.1|  unnamed protein product                              83.6    4e-16    Coffea canephora [robusta coffee]
sp|P0DH82.1|CSPL1_MARPO  RecName: Full=CASP-like protein 2U1; Sho...  83.2    8e-16    Marchantia polymorpha
ref|XP_009341031.1|  PREDICTED: CASP-like protein POPTRDRAFT_578614   82.8    8e-16    Pyrus x bretschneideri [bai li]
ref|XP_006453396.1|  hypothetical protein CICLE_v10009662mg           82.8    8e-16    Citrus clementina [clementine]
ref|XP_004149074.1|  PREDICTED: CASP-like protein POPTRDRAFT_5786...  82.8    9e-16    Cucumis sativus [cucumbers]
ref|XP_010438829.1|  PREDICTED: CASP-like protein 2C1                 82.4    9e-16    Camelina sativa [gold-of-pleasure]
gb|KDO46523.1|  hypothetical protein CISIN_1g030313mg                 82.4    1e-15    Citrus sinensis [apfelsine]
ref|XP_006282730.1|  hypothetical protein CARUB_v10005865mg           82.0    1e-15    Capsella rubella
dbj|BAF00509.1|  hypothetical protein                                 79.0    2e-15    Arabidopsis thaliana [mouse-ear cress]
ref|NP_567729.1|  uncharacterized protein                             80.9    3e-15    Arabidopsis thaliana [mouse-ear cress]
emb|CDY49469.1|  BnaCnng17350D                                        80.5    5e-15    Brassica napus [oilseed rape]
ref|XP_006413266.1|  hypothetical protein EUTSA_v10026381mg           77.8    3e-14    Eutrema salsugineum [saltwater cress]
ref|XP_004242688.1|  PREDICTED: CASP-like protein 2C1                 78.2    4e-14    Solanum lycopersicum
ref|XP_010545424.1|  PREDICTED: CASP-like protein 2C1                 77.4    6e-14    Tarenaya hassleriana [spider flower]
emb|CBI17818.3|  unnamed protein product                              77.4    8e-14    Vitis vinifera
ref|XP_006366193.1|  PREDICTED: CASP-like protein VIT_11s0052g011...  77.0    9e-14    Solanum tuberosum [potatoes]
gb|EAY84708.1|  hypothetical protein OsI_06078                        75.9    2e-13    Oryza sativa Indica Group [Indian rice]
ref|NP_001046070.1|  Os02g0177700                                     75.5    2e-13    
ref|XP_002273403.2|  PREDICTED: CASP-like protein 2C1                 75.5    3e-13    Vitis vinifera
emb|CAB39604.1|  putative mitochondrial protein                       79.0    3e-13    Arabidopsis thaliana [mouse-ear cress]
gb|EEC69375.1|  hypothetical protein OsI_38510                        73.9    4e-13    Oryza sativa Indica Group [Indian rice]
ref|XP_003610149.1|  hypothetical protein MTR_4g128520                74.7    4e-13    
ref|XP_007154779.1|  hypothetical protein PHAVU_003G147200g           74.7    5e-13    Phaseolus vulgaris [French bean]
ref|NP_001066880.1|  Os12g0514300                                     73.9    5e-13    
ref|XP_003553094.1|  PREDICTED: CASP-like protein 10-like             74.7    6e-13    Glycine max [soybeans]
ref|XP_006845610.1|  hypothetical protein AMTR_s00019p00209400        74.3    7e-13    Amborella trichopoda
gb|KHN22710.1|  CASP-like protein 3                                   73.6    1e-12    Glycine soja [wild soybean]
ref|NP_001237350.1|  CASP-like protein 2C1                            73.2    1e-12    Glycine max [soybeans]
gb|EEC69376.1|  hypothetical protein OsI_38511                        72.4    2e-12    Oryza sativa Indica Group [Indian rice]
ref|XP_009798279.1|  PREDICTED: CASP-like protein 2C1                 72.8    3e-12    Nicotiana sylvestris
ref|XP_002989705.1|  hypothetical protein SELMODRAFT_272089           72.0    5e-12    Selaginella moellendorffii
ref|XP_004507839.1|  PREDICTED: CASP-like protein 3-like isoform X1   71.6    5e-12    Cicer arietinum [garbanzo]
ref|XP_002991776.1|  hypothetical protein SELMODRAFT_272229           71.2    8e-12    Selaginella moellendorffii
ref|XP_006657208.1|  PREDICTED: CASP-like protein Os06g0656300-like   71.2    8e-12    Oryza brachyantha
gb|KHN08760.1|  CASP-like protein 10                                  70.9    1e-11    Glycine soja [wild soybean]
gb|AFK47158.1|  unknown                                               70.9    1e-11    Lotus japonicus
ref|XP_006855416.1|  hypothetical protein AMTR_s00057p00159510        70.5    1e-11    Amborella trichopoda
ref|XP_002276206.1|  PREDICTED: CASP-like protein 1E2                 70.9    1e-11    Vitis vinifera
dbj|BAJ84836.1|  predicted protein                                    70.5    2e-11    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009611405.1|  PREDICTED: CASP-like protein 2C1                 70.9    2e-11    Nicotiana tomentosiformis
ref|XP_009783950.1|  PREDICTED: CASP-like protein 2A1                 70.1    2e-11    Nicotiana sylvestris
ref|XP_003549486.1|  PREDICTED: CASP-like protein 3-like              69.7    2e-11    Glycine max [soybeans]
dbj|BAJ85571.1|  predicted protein                                    69.7    3e-11    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT22680.1|  hypothetical protein F775_30108                       69.7    3e-11    
ref|XP_010531897.1|  PREDICTED: CASP-like protein 2A1                 69.3    4e-11    Tarenaya hassleriana [spider flower]
ref|XP_010691480.1|  PREDICTED: CASP-like protein 2C1                 68.9    4e-11    Beta vulgaris subsp. vulgaris [field beet]
sp|D2KQI6.1|CSPL1_BETVM  RecName: Full=CASP-like protein Ni6; Alt...  68.6    8e-11    Beta vulgaris subsp. maritima [sea beet]
ref|XP_007141978.1|  hypothetical protein PHAVU_008G242000g           67.8    1e-10    Phaseolus vulgaris [French bean]
ref|XP_002979076.1|  hypothetical protein SELMODRAFT_444075           70.9    1e-10    
ref|XP_003579514.1|  PREDICTED: CASP-like protein 2A1                 67.8    2e-10    Brachypodium distachyon [annual false brome]
ref|XP_011098144.1|  PREDICTED: CASP-like protein 2A1                 67.4    2e-10    Sesamum indicum [beniseed]
ref|NP_001049263.2|  Os03g0196400                                     65.5    2e-10    
ref|XP_010062716.1|  PREDICTED: CASP-like protein 2A1                 67.0    3e-10    
sp|P0DI24.1|CSPL3_PTEAA  RecName: Full=CASP-like protein 2U1; Sho...  66.6    3e-10    Pteridium aquilinum subsp. aquilinum
ref|XP_004503085.1|  PREDICTED: CASP-like protein 10-like             67.0    3e-10    Cicer arietinum [garbanzo]
sp|P0DH65.1|CSPL8_SELML  RecName: Full=CASP-like protein 2U2; Sho...  66.6    3e-10    Selaginella moellendorffii
sp|P0DH67.1|CSPL9_SELML  RecName: Full=CASP-like protein 2U1; Sho...  66.6    3e-10    Selaginella moellendorffii
gb|KCW69848.1|  hypothetical protein EUGRSUZ_F03189                   66.6    5e-10    Eucalyptus grandis [rose gum]
ref|NP_564017.1|  uncharacterized protein                             66.2    5e-10    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ89574.1|  predicted protein                                    65.9    6e-10    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003600618.1|  hypothetical protein MTR_3g064310                66.2    6e-10    
ref|XP_008451819.1|  PREDICTED: CASP-like protein F16                 65.9    6e-10    Cucumis melo [Oriental melon]
gb|AES70869.2|  CASP POPTRDRAFT-like protein                          66.2    6e-10    Medicago truncatula
gb|AAL36294.1|  unknown protein                                       65.9    6e-10    Arabidopsis thaliana [mouse-ear cress]
sp|D8ST12.2|CSPL3_SELML  RecName: Full=CASP-like protein 2U11; Sh...  66.2    7e-10    Selaginella moellendorffii
ref|XP_002890211.1|  integral membrane family protein                 65.9    7e-10    
sp|P0DH61.1|CSPL6_SELML  RecName: Full=CASP-like protein 2U10; Sh...  66.2    7e-10    Selaginella moellendorffii
gb|EEC81102.1|  hypothetical protein OsI_23961                        65.5    7e-10    Oryza sativa Indica Group [Indian rice]
ref|XP_010327104.1|  PREDICTED: CASP-like protein 2A1                 65.5    7e-10    Solanum lycopersicum
ref|XP_002447595.1|  hypothetical protein SORBIDRAFT_06g005640        65.9    7e-10    Sorghum bicolor [broomcorn]
ref|NP_001058251.1|  Os06g0656300                                     65.5    7e-10    
sp|P0DI21.1|CSPL2_OSMLA  RecName: Full=CASP-like protein 2U1; Sho...  65.1    9e-10    Osmunda lancea
gb|KHN14990.1|  CASP-like protein 10                                  65.5    1e-09    Glycine soja [wild soybean]
ref|NP_001239767.1|  CASP-like protein 2A2                            65.5    1e-09    Glycine max [soybeans]
ref|XP_006304211.1|  hypothetical protein CARUB_v10010315mg           65.1    1e-09    Capsella rubella
emb|CDO98909.1|  unnamed protein product                              65.1    1e-09    Coffea canephora [robusta coffee]
emb|CDX96785.1|  BnaA08g23280D                                        64.7    2e-09    
gb|EPS73896.1|  hypothetical protein M569_00863                       63.9    2e-09    Genlisea aurea
emb|CDX81811.1|  BnaC08g37900D                                        64.3    2e-09    
emb|CDY48478.1|  BnaC05g13380D                                        64.3    2e-09    Brassica napus [oilseed rape]
gb|KFK43914.1|  hypothetical protein AALP_AA1G190800                  64.3    3e-09    Arabis alpina [alpine rockcress]
ref|XP_006465093.1|  PREDICTED: CASP-like protein POPTRDRAFT_5786...  62.8    3e-09    
ref|XP_011030770.1|  PREDICTED: CASP-like protein 2A1                 64.3    3e-09    Populus euphratica
ref|XP_007022201.1|  CASP-like protein isoform 1                      63.9    3e-09    
ref|XP_002317605.1|  integral membrane family protein                 63.9    3e-09    Populus trichocarpa [western balsam poplar]
ref|XP_009790738.1|  PREDICTED: CASP-like protein 2A1                 63.9    3e-09    Nicotiana sylvestris
ref|XP_006360011.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  63.5    3e-09    Solanum tuberosum [potatoes]
ref|XP_002986549.1|  hypothetical protein SELMODRAFT_446616           64.7    4e-09    
ref|XP_010498065.1|  PREDICTED: CASP-like protein 2A1                 63.5    5e-09    
ref|XP_009117714.1|  PREDICTED: CASP-like protein At1g17200           63.2    5e-09    Brassica rapa
ref|XP_004975109.1|  PREDICTED: CASP-like protein 6-like              63.5    6e-09    Setaria italica
ref|XP_010459293.1|  PREDICTED: CASP-like protein 2A1                 63.9    6e-09    Camelina sativa [gold-of-pleasure]
ref|XP_006442224.1|  hypothetical protein CICLE_v10022266mg           63.2    6e-09    Citrus clementina [clementine]
ref|XP_010476864.1|  PREDICTED: CASP-like protein 2A1                 63.2    6e-09    Camelina sativa [gold-of-pleasure]
gb|KDP40019.1|  hypothetical protein JCGZ_02017                       62.8    7e-09    Jatropha curcas
ref|NP_001131228.1|  CASP-like protein 2A1                            63.2    8e-09    Zea mays [maize]
ref|XP_010666392.1|  PREDICTED: CASP-like protein Ni6                 62.4    9e-09    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006366767.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  62.8    9e-09    Solanum tuberosum [potatoes]
emb|CDY26265.1|  BnaA06g11520D                                        62.8    9e-09    Brassica napus [oilseed rape]
ref|XP_009149166.1|  PREDICTED: CASP-like protein At1g17200 isofo...  62.8    9e-09    Brassica rapa
ref|XP_002325065.1|  hypothetical protein POPTR_0018s10260g           61.2    1e-08    
sp|P0DH63.1|CSPL7_SELML  RecName: Full=CASP-like protein 2U9; Sho...  62.8    1e-08    Selaginella moellendorffii
ref|XP_011082822.1|  PREDICTED: CASP-like protein 2A1                 62.4    1e-08    Sesamum indicum [beniseed]
ref|XP_004147759.1|  PREDICTED: CASP-like protein F16-like            62.4    1e-08    Cucumis sativus [cucumbers]
ref|XP_002437393.1|  hypothetical protein SORBIDRAFT_10g026120        62.0    1e-08    Sorghum bicolor [broomcorn]
emb|CDY21755.1|  BnaA09g45060D                                        62.4    1e-08    Brassica napus [oilseed rape]
gb|KJB12801.1|  hypothetical protein B456_002G037500                  62.4    1e-08    Gossypium raimondii
ref|XP_002993217.1|  hypothetical protein SELMODRAFT_431321           64.3    1e-08    
ref|XP_006416730.1|  hypothetical protein EUTSA_v10008792mg           62.0    1e-08    Eutrema salsugineum [saltwater cress]
ref|XP_010913648.1|  PREDICTED: CASP-like protein 2C1 isoform X2      61.2    2e-08    
gb|AFK39780.1|  unknown                                               61.6    2e-08    Lotus japonicus
ref|XP_006342777.1|  PREDICTED: CASP-like protein 5-like              61.6    2e-08    Solanum tuberosum [potatoes]
ref|XP_002517919.1|  conserved hypothetical protein                   61.2    2e-08    Ricinus communis
ref|XP_009602689.1|  PREDICTED: CASP-like protein 2A1                 61.6    2e-08    Nicotiana tomentosiformis
gb|KHG06274.1|  CASP-like protein F16                                 61.6    2e-08    Gossypium arboreum [tree cotton]
ref|XP_004490772.1|  PREDICTED: CASP-like protein 10-like             61.6    2e-08    Cicer arietinum [garbanzo]
emb|CDX83921.1|  BnaC08g17240D                                        61.6    2e-08    
gb|KJB12800.1|  hypothetical protein B456_002G037500                  61.6    3e-08    Gossypium raimondii
gb|KCW69847.1|  hypothetical protein EUGRSUZ_F03189                   61.6    3e-08    Eucalyptus grandis [rose gum]
ref|XP_003616135.1|  hypothetical protein MTR_5g076480                61.2    3e-08    Medicago truncatula
gb|EYU26260.1|  hypothetical protein MIMGU_mgv1a014927mg              60.5    4e-08    Erythranthe guttata [common monkey flower]
emb|CAE05079.2|  OSJNBa0094P09.18                                     60.8    4e-08    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004494327.1|  PREDICTED: CASP-like protein VIT_07s0104g013...  60.5    4e-08    Cicer arietinum [garbanzo]
ref|NP_001052366.1|  Os04g0281900                                     60.8    4e-08    
ref|XP_008645310.1|  PREDICTED: CASP-like protein 9                   60.5    5e-08    Zea mays [maize]
ref|XP_004951716.1|  PREDICTED: CASP-like protein 9-like              60.8    5e-08    Setaria italica
ref|XP_002532825.1|  conserved hypothetical protein                   60.5    6e-08    Ricinus communis
sp|Q8W4Z5.1|CSPL1_GOSHI  RecName: Full=CASP-like protein F16; Alt...  60.5    7e-08    Gossypium hirsutum [American cotton]
sp|A2X2I0.1|CSPL9_ORYSI  RecName: Full=CASP-like protein 2D1; Sho...  60.1    8e-08    Oryza sativa Indica Group [Indian rice]
sp|Q6YW53.1|CSPL9_ORYSJ  RecName: Full=CASP-like protein 2D1; Sho...  60.1    8e-08    
ref|XP_010254228.1|  PREDICTED: CASP-like protein 2A1                 60.1    8e-08    
ref|XP_011036232.1|  PREDICTED: CASP-like protein 2A2                 59.7    9e-08    
ref|XP_007022205.1|  CASP-like protein isoform 5                      59.7    1e-07    
ref|XP_010915912.1|  PREDICTED: CASP-like protein 1F2                 59.3    1e-07    
ref|XP_004965685.1|  PREDICTED: CASP-like protein 11-like             59.3    1e-07    
ref|NP_001174676.1|  Os06g0231050                                     59.3    1e-07    
ref|XP_002300480.2|  hypothetical protein POPTR_0001s42730g           60.1    1e-07    
ref|XP_010501875.1|  PREDICTED: CASP-like protein 2A2                 59.3    1e-07    
ref|XP_002965801.1|  hypothetical protein SELMODRAFT_439258           61.6    1e-07    
ref|XP_002516873.1|  conserved hypothetical protein                   59.3    1e-07    
sp|A9NMM6.1|CSPL8_PICSI  RecName: Full=CASP-like protein 2A1; Sho...  58.9    2e-07    
sp|B6U8R7.1|CSPL9_MAIZE  RecName: Full=CASP-like protein 2C4; Sho...  58.9    2e-07    
ref|NP_001239666.1|  CASP-like protein 1E1                            58.5    3e-07    
ref|NP_567473.1|  uncharacterized protein                             58.5    3e-07    
ref|XP_004243226.1|  PREDICTED: CASP-like protein 2A1                 58.5    3e-07    
ref|XP_009380719.1|  PREDICTED: CASP-like protein Os04g0281900        59.7    3e-07    
emb|CAN63416.1|  hypothetical protein VITISV_007688                   58.2    3e-07    
ref|NP_001067249.1|  Os12g0610800                                     58.5    3e-07    
sp|A2ZMM4.1|CSPL5_ORYSI  RecName: Full=CASP-like protein 1B1; Sho...  58.2    4e-07    
ref|XP_010111509.1|  hypothetical protein L484_021334                 58.5    4e-07    
gb|EEE53590.1|  hypothetical protein OsJ_36834                        58.9    4e-07    
ref|XP_002279766.1|  PREDICTED: CASP-like protein 2D1                 57.8    4e-07    
ref|XP_006655941.1|  PREDICTED: casparian strip membrane protein ...  57.8    4e-07    
gb|KDP24708.1|  hypothetical protein JCGZ_25699                       57.8    4e-07    
ref|XP_010694843.1|  PREDICTED: CASP-like protein 2A1                 57.8    6e-07    
ref|XP_010932312.1|  PREDICTED: CASP-like protein 2A1                 57.8    6e-07    
emb|CDY22743.1|  BnaA08g05730D                                        57.4    6e-07    
gb|ABA99368.1|  plant integral membrane protein TIGR01569 contain...  58.9    6e-07    
gb|EMT20234.1|  hypothetical protein F775_10059                       57.4    6e-07    
ref|XP_004956013.1|  PREDICTED: CASP-like protein Sb02g009660-like    57.4    6e-07    
ref|XP_008804521.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   57.4    7e-07    
ref|XP_004508310.1|  PREDICTED: CASP-like protein 7-like              57.4    7e-07    
ref|NP_001151672.1|  CASP-like protein 1D1                            57.4    8e-07    
ref|XP_002275339.1|  PREDICTED: CASP-like protein 2A1                 57.4    8e-07    
ref|XP_009107849.1|  PREDICTED: CASP-like protein At4g15630           57.4    8e-07    
gb|AAM67044.1|  unknown                                               57.0    8e-07    
ref|XP_006414479.1|  hypothetical protein EUTSA_v10026349mg           57.0    9e-07    
ref|XP_002992808.1|  hypothetical protein SELMODRAFT_448915           58.9    9e-07    
ref|XP_011013658.1|  PREDICTED: CASP-like protein 2A2                 57.0    1e-06    
ref|XP_009630030.1|  PREDICTED: CASP-like protein 2A1                 56.2    1e-06    
ref|XP_010540119.1|  PREDICTED: CASP-like protein 2A1                 56.6    1e-06    
ref|XP_010245909.1|  PREDICTED: casparian strip membrane protein ...  57.0    1e-06    
ref|XP_003544956.1|  PREDICTED: CASP-like protein 11                  56.6    2e-06    
ref|XP_008652280.1|  PREDICTED: CASP-like protein 3                   56.6    2e-06    
sp|P0DI20.1|CSPL1_OSMLA  RecName: Full=CASP-like protein 2U2; Sho...  56.6    2e-06    
gb|KDP34883.1|  hypothetical protein JCGZ_09171                       56.6    2e-06    
ref|XP_010904772.1|  PREDICTED: CASP-like protein 1D1                 56.2    2e-06    
sp|D5A972.1|CSPL3_PICSI  RecName: Full=CASP-like protein 2A3; Sho...  55.8    2e-06    
sp|C6SYW3.1|CSPLB_SOYBN  RecName: Full=CASP-like protein 2A1; Sho...  56.2    2e-06    
ref|XP_004229217.1|  PREDICTED: CASP-like protein 1E2                 55.8    2e-06    
ref|XP_009419511.1|  PREDICTED: CASP-like protein MA4_106O17.52       56.2    3e-06    
emb|CDY09075.1|  BnaC08g10290D                                        55.8    3e-06    
sp|A9P0A6.1|CSPL5_PICSI  RecName: Full=CASP-like protein 1U1; Sho...  55.8    3e-06    
ref|XP_008799290.1|  PREDICTED: CASP-like protein MA4_106O17.52       55.8    3e-06    
ref|NP_001059526.1|  Os07g0442900                                     55.8    3e-06    
tpg|DAA39419.1|  TPA: membrane protein 4                              55.8    3e-06    
gb|KFK29091.1|  hypothetical protein AALP_AA7G087700                  55.5    3e-06    
ref|XP_006289591.1|  hypothetical protein CARUB_v10003142mg           55.5    3e-06    
ref|XP_006407087.1|  hypothetical protein EUTSA_v10021621mg           55.5    3e-06    
sp|D8SJ65.2|CSPL4_SELML  RecName: Full=CASP-like protein 2U4; Sho...  55.5    3e-06    
ref|XP_009401544.1|  PREDICTED: CASP-like protein Os04g0281900        55.8    3e-06    
ref|NP_001236009.1|  CASP-like protein 1E2                            55.1    4e-06    
emb|CBI26107.3|  unnamed protein product                              54.3    4e-06    
ref|XP_010249455.1|  PREDICTED: CASP-like protein 1F1                 54.3    4e-06    
ref|XP_007015764.1|  Casparian strip membrane protein 3, putative     55.5    4e-06    
gb|KJB38474.1|  hypothetical protein B456_006G257500                  55.5    4e-06    
gb|EAZ03696.1|  hypothetical protein OsI_25828                        55.5    4e-06    
ref|XP_002453543.1|  hypothetical protein SORBIDRAFT_04g007720        55.1    4e-06    
ref|XP_004235355.1|  PREDICTED: CASP-like protein 1F1 isoform X1      55.1    4e-06    
sp|D8QNV6.2|CSPL5_SELML  RecName: Full=CASP-like protein 2U3; Sho...  55.1    4e-06    
ref|XP_007154230.1|  hypothetical protein PHAVU_003G101200g           55.1    5e-06    
ref|XP_006361147.1|  PREDICTED: casparian strip membrane protein ...  55.1    5e-06    
sp|Q1EPG7.1|CSPL1_MUSAC  RecName: Full=CASP-like protein 1E1; Sho...  55.1    5e-06    
ref|XP_002268702.1|  PREDICTED: CASP-like protein 1E1                 55.1    6e-06    
ref|XP_002312755.2|  hypothetical protein POPTR_0008s20950g           55.1    6e-06    
ref|XP_008647966.1|  PREDICTED: CASP-like protein 13 isoform X1       54.7    6e-06    
gb|KCW78730.1|  hypothetical protein EUGRSUZ_C00172                   53.9    6e-06    
ref|XP_008799291.1|  PREDICTED: CASP-like protein POPTRDRAFT_820933   54.7    6e-06    
sp|P0DI25.1|CSPL4_PTEAA  RecName: Full=CASP-like protein 2U3; Sho...  54.3    7e-06    
gb|EYU34055.1|  hypothetical protein MIMGU_mgv1a020210mg              54.3    7e-06    
ref|XP_006360012.1|  PREDICTED: CASP-like protein VIT_01s0010g018...  53.5    8e-06    
ref|XP_010271592.1|  PREDICTED: casparian strip membrane protein ...  54.7    8e-06    
ref|XP_007022202.1|  CASP-like protein, putative isoform 2            53.9    8e-06    
ref|XP_002870224.1|  integral membrane family protein                 54.3    1e-05    
ref|XP_006648369.1|  PREDICTED: CASP-like protein Os02g0177700-like   53.9    1e-05    
gb|EPS69398.1|  hypothetical protein M569_05367                       53.5    1e-05    
ref|XP_008458485.1|  PREDICTED: CASP-like protein 6 isoform X1        54.3    1e-05    
sp|A7R333.1|CSPLB_VITVI  RecName: Full=CASP-like protein 1C1; Sho...  53.5    1e-05    
ref|XP_010904767.1|  PREDICTED: CASP-like protein 1E1                 53.9    1e-05    
gb|KFK38804.1|  hypothetical protein AALP_AA3G162100                  53.9    1e-05    
ref|XP_004300689.1|  PREDICTED: CASP-like protein 2A1                 53.9    1e-05    
ref|XP_009136705.1|  PREDICTED: CASP-like protein At4g15630           53.9    1e-05    
emb|CDX90578.1|  BnaA03g42030D                                        53.9    1e-05    
ref|XP_006653237.1|  PREDICTED: CASP-like protein Os04g0281900-like   53.1    1e-05    
ref|XP_007154229.1|  hypothetical protein PHAVU_003G101100g           53.5    2e-05    
sp|P0DI32.1|CASP1_TARKO  RecName: Full=Casparian strip membrane p...  53.9    2e-05    
ref|XP_006284585.1|  hypothetical protein CARUB_v10005811mg           53.5    2e-05    
ref|XP_004486055.1|  PREDICTED: CASP-like protein 5-like              53.5    2e-05    
ref|XP_008237993.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   53.9    2e-05    
emb|CDY09749.1|  BnaC07g33120D                                        53.5    2e-05    
gb|KJB41975.1|  hypothetical protein B456_007G131100                  53.5    2e-05    
ref|XP_010440273.1|  PREDICTED: CASP-like protein 1E1                 53.5    2e-05    
ref|XP_010105027.1|  hypothetical protein L484_008468                 54.7    2e-05    
ref|XP_010241335.1|  PREDICTED: CASP-like protein 1D1                 53.5    2e-05    
gb|EYU43016.1|  hypothetical protein MIMGU_mgv1a014654mg              53.1    2e-05    
ref|XP_004242111.1|  PREDICTED: casparian strip membrane protein ...  53.5    2e-05    
gb|EAZ21949.1|  hypothetical protein OsJ_05601                        52.0    2e-05    
ref|XP_004150813.1|  PREDICTED: CASP-like protein 6-like              53.1    2e-05    
ref|XP_002523839.1|  conserved hypothetical protein                   53.5    2e-05    
ref|XP_006452385.1|  hypothetical protein CICLE_v10009601mg           53.1    2e-05    
ref|XP_010449916.1|  PREDICTED: CASP-like protein 1E1                 53.1    2e-05    
ref|XP_006299393.1|  hypothetical protein CARUB_v10015553mg           52.8    3e-05    
ref|XP_002534086.1|  conserved hypothetical protein                   51.2    3e-05    
gb|AIC33063.1|  integral membrane family protein                      53.1    3e-05    
ref|XP_008663281.1|  PREDICTED: casparian strip membrane protein 2    53.1    3e-05    
ref|XP_002533365.1|  conserved hypothetical protein                   51.2    3e-05    
ref|XP_009146374.1|  PREDICTED: CASP-like protein ARALYDRAFT_478855   53.1    3e-05    
ref|XP_003571714.1|  PREDICTED: CASP-like protein 2D1                 52.8    3e-05    
ref|XP_008808432.1|  PREDICTED: CASP-like protein VIT_19s0090g00570   52.8    3e-05    
ref|XP_006371562.1|  integral membrane family protein                 52.4    3e-05    
ref|XP_009399244.1|  PREDICTED: CASP-like protein MA4_106O17.50       53.1    3e-05    
gb|ACN26856.1|  unknown                                               50.8    3e-05    
ref|NP_001150865.1|  membrane protein                                 52.8    3e-05    
ref|XP_003625864.1|  hypothetical protein MTR_7g108130                52.8    3e-05    
ref|XP_006363994.1|  PREDICTED: CASP-like protein VIT_17s0000g005...  52.4    4e-05    
gb|AFK37260.1|  unknown                                               52.8    4e-05    
ref|XP_011081169.1|  PREDICTED: CASP-like protein 1                   52.8    4e-05    
ref|XP_010923854.1|  PREDICTED: CASP-like protein 2D1                 52.4    4e-05    
ref|XP_004968732.1|  PREDICTED: CASP-like protein Sb03g014480-like    53.5    4e-05    
gb|KJB21715.1|  hypothetical protein B456_004G010900                  52.8    4e-05    
sp|P0DH84.1|CSPL2_ADICA  RecName: Full=CASP-like protein 2U1; Sho...  52.4    4e-05    
gb|EMT22194.1|  hypothetical protein F775_09434                       52.4    5e-05    
ref|XP_009411946.1|  PREDICTED: casparian strip membrane protein ...  52.8    5e-05    
ref|XP_006431199.1|  hypothetical protein CICLE_v10013539mg           52.4    5e-05    
ref|XP_011037328.1|  PREDICTED: CASP-like protein 1C3                 52.0    5e-05    
ref|XP_010492362.1|  PREDICTED: casparian strip membrane protein ...  52.0    6e-05    
ref|XP_003556790.1|  PREDICTED: CASP-like protein 2-like              52.0    6e-05    
gb|KHN33122.1|  CASP-like protein 6                                   52.0    6e-05    
ref|XP_010487237.1|  PREDICTED: CASP-like protein 2A2                 51.6    7e-05    
ref|XP_008799972.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   52.0    7e-05    
sp|A9P1V1.1|CSPL6_PICSI  RecName: Full=CASP-like protein 2A2; Sho...  52.0    8e-05    
sp|P0DI42.1|CASP2_WHEAT  RecName: Full=Casparian strip membrane p...  51.6    8e-05    
ref|XP_010434939.1|  PREDICTED: CASP-like protein 1E1                 51.6    8e-05    
emb|CAN69352.1|  hypothetical protein VITISV_023954                   52.0    8e-05    
ref|XP_003546096.2|  PREDICTED: CASP-like protein 6-like              52.0    8e-05    
ref|XP_009803956.1|  PREDICTED: CASP-like protein 1E1                 51.6    8e-05    
ref|XP_002870226.1|  integral membrane family protein                 51.6    8e-05    
ref|XP_003542918.1|  PREDICTED: CASP-like protein 7-like isoform X1   51.6    8e-05    
ref|XP_002325064.1|  integral membrane family protein                 50.1    9e-05    
ref|XP_004955209.1|  PREDICTED: casparian strip membrane protein ...  51.6    9e-05    
emb|CBI27492.3|  unnamed protein product                              50.8    9e-05    
ref|XP_009393394.1|  PREDICTED: casparian strip membrane protein ...  52.0    9e-05    
sp|A7PJ32.1|CSPL2_VITVI  RecName: Full=CASP-like protein 1C2; Sho...  50.8    9e-05    
ref|XP_002272783.1|  PREDICTED: CASP-like protein 1C2                 50.8    1e-04    
ref|XP_002446616.1|  hypothetical protein SORBIDRAFT_06g018970        51.2    1e-04    
ref|XP_010453663.1|  PREDICTED: casparian strip membrane protein 5    51.2    1e-04    
ref|XP_006844549.1|  hypothetical protein AMTR_s00016p00177260        51.2    1e-04    
ref|XP_009365707.1|  PREDICTED: CASP-like protein VIT_01s0010g01870   51.6    1e-04    
ref|XP_010548920.1|  PREDICTED: CASP-like protein 1D1                 51.2    1e-04    
ref|XP_010683571.1|  PREDICTED: CASP-like protein 1E1                 51.6    1e-04    
ref|XP_004965049.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04    
ref|XP_010420188.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04    
gb|KDO72617.1|  hypothetical protein CISIN_1g045471mg                 51.2    1e-04    
sp|P0DI33.1|CASP1_PANVG  RecName: Full=Casparian strip membrane p...  51.2    1e-04    
gb|KHG13245.1|  CASP-like protein                                     49.7    1e-04    
gb|KDP24131.1|  hypothetical protein JCGZ_25788                       50.4    1e-04    
ref|XP_008438805.1|  PREDICTED: CASP-like protein 5                   51.2    1e-04    
ref|XP_009789373.1|  PREDICTED: casparian strip membrane protein ...  51.2    1e-04    
gb|KHN25032.1|  CASP-like protein 2                                   50.8    1e-04    
ref|XP_009352216.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   50.8    1e-04    
ref|XP_002461872.1|  hypothetical protein SORBIDRAFT_02g009660        51.2    1e-04    
ref|XP_007147871.1|  hypothetical protein PHAVU_006G161900g           52.0    1e-04    
ref|XP_006444237.1|  hypothetical protein CICLE_v10023477mg           50.8    2e-04    
ref|XP_011098938.1|  PREDICTED: CASP-like protein 1F1                 50.8    2e-04    
ref|XP_009630064.1|  PREDICTED: CASP-like protein 1E2 isoform X1      50.8    2e-04    
ref|XP_007050797.1|  CASP protein GSVIVT01010992001, putative         50.8    2e-04    
emb|CDP06128.1|  unnamed protein product                              50.1    2e-04    
ref|NP_001140819.1|  CASP-like protein 2A2                            50.8    2e-04    
ref|XP_007035489.1|  CASP-like protein RCOM_0679870, putative         50.8    2e-04    
ref|XP_006376496.1|  integral membrane family protein                 50.1    2e-04    
ref|XP_009609007.1|  PREDICTED: casparian strip membrane protein ...  50.8    2e-04    
ref|XP_010465330.1|  PREDICTED: CASP-like protein 2A2                 50.4    2e-04    
ref|XP_007146967.1|  hypothetical protein PHAVU_006G085600g           50.1    2e-04    
sp|P0DI62.1|CASP1_CYNCS  RecName: Full=Casparian strip membrane p...  50.4    2e-04    
ref|XP_009393233.1|  PREDICTED: CASP-like protein 5                   50.4    2e-04    
gb|KDO87387.1|  hypothetical protein CISIN_1g036940mg                 50.4    2e-04    
ref|XP_003571287.1|  PREDICTED: casparian strip membrane protein 2    50.8    2e-04    
ref|XP_004170007.1|  PREDICTED: CASP-like protein F16-like            49.3    3e-04    
gb|KJB21732.1|  hypothetical protein B456_004G011000                  50.4    3e-04    
sp|P0DI44.1|CASP1_SOLTU  RecName: Full=Casparian strip membrane p...  50.1    3e-04    
gb|AFK37802.1|  unknown                                               50.1    3e-04    
ref|NP_001148957.1|  casparian strip membrane protein 1               50.1    3e-04    
ref|XP_008799288.1|  PREDICTED: CASP-like protein MA4_106O17.50       50.1    3e-04    
ref|XP_008799284.1|  PREDICTED: CASP-like protein VIT_05s0020g01820   50.1    3e-04    
ref|XP_004975856.1|  PREDICTED: casparian strip membrane protein ...  50.1    3e-04    
ref|XP_006363407.1|  PREDICTED: casparian strip membrane protein ...  50.1    3e-04    
ref|XP_006414480.1|  hypothetical protein EUTSA_v10026308mg           50.1    3e-04    
ref|XP_003609582.1|  hypothetical protein MTR_4g118800                50.1    3e-04    
emb|CDX70605.1|  BnaC03g06890D                                        50.1    3e-04    
ref|XP_002986466.1|  hypothetical protein SELMODRAFT_425414           50.1    3e-04    
ref|XP_011097872.1|  PREDICTED: CASP-like protein 2D1 isoform X2      49.7    3e-04    
gb|EPS74593.1|  hypothetical protein M569_00163                       50.1    3e-04    
ref|XP_006347352.1|  PREDICTED: CASP-like protein VIT_17s0000g005...  49.7    3e-04    
gb|EEE66147.1|  hypothetical protein OsJ_22215                        50.1    3e-04    
ref|XP_006482625.1|  PREDICTED: casparian strip membrane protein ...  49.7    4e-04    
ref|XP_006844548.1|  hypothetical protein AMTR_s00016p00176090        49.7    4e-04    
ref|XP_010917325.1|  PREDICTED: CASP-like protein 2A1                 50.1    4e-04    
ref|XP_006836542.1|  hypothetical protein AMTR_s00131p00032340        50.1    4e-04    
ref|XP_004159824.1|  PREDICTED: CASP-like protein 8-like              49.7    4e-04    
ref|XP_010904769.1|  PREDICTED: CASP-like protein 1E1                 50.1    4e-04    
ref|XP_004506615.1|  PREDICTED: CASP-like protein RCOM_1174750-like   49.3    4e-04    
ref|XP_007022941.1|  CASP-like protein, putative                      49.7    4e-04    
ref|XP_006836401.1|  hypothetical protein AMTR_s00092p00142720        50.1    4e-04    
gb|KJB75708.1|  hypothetical protein B456_012G052700                  49.3    4e-04    
ref|XP_002436759.1|  hypothetical protein SORBIDRAFT_10g008220        49.7    4e-04    
ref|XP_010941794.1|  PREDICTED: CASP-like protein 1E2                 49.7    4e-04    
ref|NP_001235823.1|  CASP-like protein 6                              49.7    4e-04    
ref|XP_003564046.1|  PREDICTED: casparian strip membrane protein 3    49.3    5e-04    
sp|D7M7B3.2|CASP5_ARALL  RecName: Full=Casparian strip membrane p...  49.3    5e-04    
ref|XP_007209731.1|  hypothetical protein PRUPE_ppa012828mg           48.9    5e-04    



>ref|XP_009778293.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=202

 Score =   308 bits (790),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 188/202 (93%), Gaps = 1/202 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RCVICGLAI+GAVLIG DSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+IC+MYGKFCNQVGEGIASSLIV +SMI+L 
Sbjct  121  MAYLTLVAVAAAAQSAVFAKLGQTELQWMKICDMYGKFCNQVGEGIASSLIVSLSMIVLS  180

Query  154  GISAFSLFRLYGDN-KSKCNGR  92
            GISAFSLFRLYG+N K K N R
Sbjct  181  GISAFSLFRLYGNNSKGKGNAR  202



>emb|CDP04507.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   304 bits (779),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 187/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHGSNLKVVD+RVR+AEL+ RC+ICGLA++ AVLIG D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKVVDRRVRIAELVLRCLICGLAVLAAVLIGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+K+AKFT+MKALVFLVI  G+AAAYS VQ++RC  SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   TIKKEAKFTEMKALVFLVITTGIAAAYSFVQVLRCITSMIRGNVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYLSL AVAAAAQSAV+AK+GQ+ELQWM+ICNMYGK+CNQVGEGIAS+L+V +SM++L 
Sbjct  121  MAYLSLAAVAAAAQSAVFAKLGQTELQWMKICNMYGKYCNQVGEGIASALMVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG+NK K + R
Sbjct  181  GISAFSLFRLYGENKGKNSSR  201



>ref|XP_004250287.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   301 bits (770),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 184/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RCVI GLAIVG +LIG D QV+ IF
Sbjct  1    MNYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCVIFGLAIVGVILIGTDKQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +S+I+L 
Sbjct  121  MAYLTLTAVAAAAQSAVFAKLGQAELQWMKICNMYGKFCNQVGEGIASSLIVSLSVIVLS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
            GISAFSLFRLYG++K K N
Sbjct  181  GISAFSLFRLYGNSKGKGN  199



>ref|XP_009592222.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=201

 Score =   300 bits (768),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 158/201 (79%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVP++H SNLKV+DKRVRLAELI RC+ICGLA++ AVLIG DSQVR IF
Sbjct  1    MSYLGIGVSPGNVPIHHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMK+LVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIQKKAKFTDMKSLVFLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAAAQSAV++K+GQ+ELQWM++C+MYGK+CNQ GEG+ASS+I  +SMI+L 
Sbjct  121  MAYLNLAAVAAAAQSAVFSKLGQTELQWMKLCDMYGKYCNQAGEGVASSVIASLSMIVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG++  K N +
Sbjct  181  GISAFSLFRLYGNSGGKGNAK  201



>ref|XP_006365844.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Solanum 
tuberosum]
Length=201

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/201 (80%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVPV+HGSNLKV+DKRVR+ ELI RC+I GLAI+GAVLIG DSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVHHGSNLKVIDKRVRIIELILRCLILGLAIIGAVLIGTDSQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+K+AKFTDMK LVFLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQL
Sbjct  61   SIKKEAKFTDMKVLVFLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYLSL AVAAAAQS V +K GQ ELQWM++CN+YGKFCNQ+GEGIASS+IV +SMI L 
Sbjct  121  MAYLSLAAVAAAAQSGVISKFGQPELQWMKVCNLYGKFCNQIGEGIASSVIVSLSMIALS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG+N  K N R
Sbjct  181  GISAFSLFRLYGNNGGKSNAR  201



>ref|XP_009627397.1| PREDICTED: CASP-like protein 2B1 [Nicotiana tomentosiformis]
Length=202

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 186/200 (93%), Gaps = 1/200 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVPVYHG+N KV+D+RVR+ EL+ RCVICGLAI+GAVLIG DSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVYHGNNSKVIDRRVRVTELVLRCVICGLAILGAVLIGTDSQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L A+AAAAQSAV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +SMI+L 
Sbjct  121  MAYLTLAALAAAAQSAVFAKLGQTELQWMKICNMYGKFCNQVGEGIASSLIVSLSMIVLS  180

Query  154  GISAFSLFRLYGDN-KSKCN  98
            GISAFSLFRLYG+N K K N
Sbjct  181  GISAFSLFRLYGNNSKGKGN  200



>ref|XP_006352330.1| PREDICTED: CASP-like protein RCOM_0864260-like [Solanum tuberosum]
Length=201

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/199 (80%), Positives = 183/199 (92%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLG+GVSPGNVPVYHG+NLKV+D+RVR+ EL+ RC+I GLAI+GA+LIG D Q + IF
Sbjct  1    MNYLGIGVSPGNVPVYHGNNLKVIDRRVRVTELVLRCIIFGLAILGAILIGTDKQAKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI K AKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAWAIFSGDQL
Sbjct  61   SIEKIAKFTDMKALVFLVIANGLAAAYSLVQVLRCILSMIRGTVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAAAQSAV+AK+GQ+ELQWM+ICNMYGKFCNQVGEGIASSLIV +SMI+L 
Sbjct  121  MAYLTLTAVAAAAQSAVFAKLGQTELQWMKICNMYGKFCNQVGEGIASSLIVSLSMIVLS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
             ISAFSLFRLYG++K K N
Sbjct  181  AISAFSLFRLYGNSKGKGN  199



>ref|XP_009789786.1| PREDICTED: CASP-like protein 2B1 [Nicotiana sylvestris]
Length=201

 Score =   300 bits (768),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/201 (78%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVP++H SNLKV+DKRVRLAELI RC+ICGLA++ AVLIG DSQVR IF
Sbjct  1    MSYLGIGVSPGNVPIHHRSNLKVIDKRVRLAELILRCLICGLAVLAAVLIGTDSQVRVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMK+LVFLVIANGLAAAYSLVQ++RC +SMIRGSVLFNKPLAWAIFSGDQL
Sbjct  61   SIQKKAKFTDMKSLVFLVIANGLAAAYSLVQVIRCILSMIRGSVLFNKPLAWAIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAAAQSAV++K+GQ+ELQWM++C+MYGK+CNQ G+G+ASS+I  +SMI+L 
Sbjct  121  MAYLTLAAVAAAAQSAVFSKLGQTELQWMKLCDMYGKYCNQAGKGVASSVIASLSMIVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG++  K N +
Sbjct  181  GISAFSLFRLYGNSAGKGNAK  201



>ref|XP_002522908.1| conserved hypothetical protein [Ricinus communis]
 sp|B9SA89.1|CSPLB_RICCO RecName: Full=CASP-like protein 2B1; Short=RcCASPL2B1 [Ricinus 
communis]
 gb|EEF39508.1| conserved hypothetical protein [Ricinus communis]
Length=202

 Score =   299 bits (765),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 182/197 (92%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHGSNLKV+DKRVRLAEL+ RC+ICGL ++ AVL+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKVIDKRVRLAELVLRCLICGLGVLAAVLVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA+FTDMKALVFLVIANG+AAAYSL+Q VRC V M+RGS LF+KPLAWAIFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVIANGIAAAYSLLQGVRCVVGMVRGSALFSKPLAWAIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AVAAAAQSAV+AK+GQ ELQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L 
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG NK K
Sbjct  181  CISAFSLFRLYGANKGK  197



>ref|XP_004239817.1| PREDICTED: CASP-like protein 2B1 [Solanum lycopersicum]
Length=201

 Score =   298 bits (764),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPGNVPV+HGSNLKV+DKRVR+ E+I RC+I GLAI+GAVLIG DSQV+ IF
Sbjct  1    MSYLGIGVSPGNVPVHHGSNLKVIDKRVRIIEVILRCLILGLAIIGAVLIGTDSQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+K+AKFTDMK LVFLVIANGLAAAYSL+Q++RC  SMIRGSVLFNKPLAW IFSGDQL
Sbjct  61   SIKKEAKFTDMKVLVFLVIANGLAAAYSLIQVLRCIFSMIRGSVLFNKPLAWVIFSGDQL  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYLSL AVAAAAQS V +K GQ ELQWM++CN+YGKFCNQ+GEGI SSLIV +SMI L 
Sbjct  121  MAYLSLAAVAAAAQSGVISKFGQPELQWMKVCNLYGKFCNQIGEGIVSSLIVSLSMIALS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG+N  K N R
Sbjct  181  GISAFSLFRLYGNNGGKSNAR  201



>ref|XP_006467305.1| PREDICTED: CASP-like protein POPTRDRAFT_818956-like [Citrus sinensis]
 gb|KDO78497.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
 gb|KDO78498.1| hypothetical protein CISIN_1g028855mg [Citrus sinensis]
Length=202

 Score =   298 bits (763),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 185/201 (92%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+ +KVVD+R+RL EL+ RCVICGL ++ AVL+G D+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTVMKVVDRRIRLVELVLRCVICGLGVLAAVLVGTDTQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMKALVFLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AVAAAAQSAV+AK+GQ ELQW++ICNMYGKFCNQVGEGIAS+L+V ISM++L 
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWLKICNMYGKFCNQVGEGIASALLVSISMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAFSLFRLYG +K+K   R
Sbjct  181  CISAFSLFRLYGGSKAKNGAR  201



>ref|XP_011095935.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   296 bits (759),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 155/200 (78%), Positives = 184/200 (92%), Gaps = 0/200 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHGSN+KV+D+RV++AEL+ RCVIC LAI+ AVLIG D+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNVKVIDRRVKVAELVLRCVICVLAILAAVLIGTDTQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +IRKKAKFTDMKALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLF+KPLAWAIFSGDQ+
Sbjct  61   TIRKKAKFTDMKALVFLVIANGLAAAYSLVQVLRCVLSMIRGTVLFSKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYLSL AVAA+AQSAV+AK+GQ ELQWM+ C +Y KFCNQVGEG+AS+++  +SM++L 
Sbjct  121  MAYLSLSAVAASAQSAVFAKLGQPELQWMKTCTLYEKFCNQVGEGVASAVLASLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNG  95
             ISAFSLFRLYGD+K K +G
Sbjct  181  AISAFSLFRLYGDSKGKSSG  200



>sp|A7R385.1|CSPLC_VITVI RecName: Full=CASP-like protein 2B1; Short=VvCASPL2B1 [Vitis 
vinifera]
Length=202

 Score =   295 bits (756),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/201 (78%), Positives = 181/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKVVD+RVRLAEL+ RCVICGL I+ AVL+G D+QV+ IF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL+L AVAAAAQS+V+ + GQ ELQWM+ICNMYGKFCNQVGEGI S++ V +SM+IL 
Sbjct  121  IAYLTLAAVAAAAQSSVFGEFGQPELQWMKICNMYGKFCNQVGEGIVSAVGVSLSMVILS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAFSLFRLYG NK    GR
Sbjct  181  GISAFSLFRLYGGNKGTSGGR  201



>ref|XP_011086255.1| PREDICTED: CASP-like protein 2B1 [Sesamum indicum]
Length=202

 Score =   294 bits (753),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/201 (79%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHGSNLK VD+RVR+AEL+ R  I GLAI+ A+LIG D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGSNLKAVDRRVRVAELVLRGFISGLAILSALLIGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMKALVFLVIANGLAAAYSLVQL+RC +SMIRGSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVIANGLAAAYSLVQLLRCILSMIRGSVLFNKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL L AVAAAAQSA  AK+GQ ELQWM+IC+MY KFCNQVGEGIAS+L V +S +++ 
Sbjct  121  MAYLMLAAVAAAAQSAALAKLGQPELQWMKICDMYAKFCNQVGEGIASALFVSLSFVVVS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAFSLFRLYG+NK K +GR
Sbjct  181  AISAFSLFRLYGENKRKNSGR  201



>ref|XP_006449900.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
 gb|ESR63140.1| hypothetical protein CICLE_v10016754mg [Citrus clementina]
Length=202

 Score =   293 bits (750),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVY G+ +KVVD+R+RL EL+ RCVICGL  + AVL+G D+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYRGTVMKVVDRRIRLVELVLRCVICGLGALAAVLVGTDTQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMKALVFLV+ANG+AAAYSLVQ VRC+V+M++GSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLVVANGIAAAYSLVQGVRCTVAMLKGSVLFNKPLAWAIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AVAAAAQSAV+AK+GQ ELQW++ICNMYGKFCNQVGEGIAS+L+V ISM++L 
Sbjct  121  MAYLTVAAVAAAAQSAVFAKLGQPELQWLKICNMYGKFCNQVGEGIASALLVSISMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAFSLFRLYG +K+K   R
Sbjct  181  CISAFSLFRLYGGSKAKNGAR  201



>ref|XP_002307903.1| integral membrane family protein [Populus trichocarpa]
 sp|B9HD38.1|CSPLE_POPTR RecName: Full=CASP-like protein 2B2; Short=PtCASPL2B2 [Populus 
trichocarpa]
 gb|EEE91426.1| integral membrane family protein [Populus trichocarpa]
Length=202

 Score =   291 bits (746),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/201 (76%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG NLKV+D+RVRLAEL+ RCVIC L ++ AVL+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGMNLKVIDRRVRLAELVLRCVICALGVLAAVLVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA+FTDMKALVFLV+ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAA QSA +AK+GQ +LQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L 
Sbjct  121  MAYLTLSAVAAAVQSASFAKLGQPDLQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             IS+FSLFRLYG NK K   R
Sbjct  181  CISSFSLFRLYGGNKGKDGAR  201



>ref|XP_008227444.1| PREDICTED: CASP-like protein RCOM_0864260 [Prunus mume]
Length=204

 Score =   290 bits (741),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVICGL ++ A L+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVIANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ AV AAAQSAV+AK+GQSELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L 
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQSELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVLS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAF+LFRLYG NKSK
Sbjct  181  CISAFNLFRLYGGNKSK  197



>ref|XP_011004511.1| PREDICTED: CASP-like protein 2B2 [Populus euphratica]
Length=202

 Score =   289 bits (740),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/201 (75%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVRLAEL+ RCVIC L ++ AVL+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI KKA+FTDMKALVFLV+ANG+AAAYSLVQ VRC V M++GSVLF+KP+AW IFSGDQ+
Sbjct  61   SIEKKARFTDMKALVFLVVANGIAAAYSLVQGVRCVVGMVKGSVLFSKPVAWVIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL+L AVAAA QSA +AK+GQ +LQWM+ICNMYGKFCNQVGEGIAS+L+V +SM++L 
Sbjct  121  MAYLTLSAVAAAVQSASFAKLGQPDLQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             IS+FSLFRLYG NK K   R
Sbjct  181  CISSFSLFRLYGGNKGKDGAR  201



>gb|EYU27670.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27671.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27672.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
 gb|EYU27673.1| hypothetical protein MIMGU_mgv1a013955mg [Erythranthe guttata]
Length=205

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 152/189 (80%), Positives = 175/189 (93%), Gaps = 0/189 (0%)
 Frame = -3

Query  661  NVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDM  482
            NVPVYHGSNLKV+D RVRLAELI RCVICGLAI+ AVLIG D+QVREIF+IRKKAKFTDM
Sbjct  15   NVPVYHGSNLKVLDMRVRLAELILRCVICGLAILSAVLIGTDTQVREIFTIRKKAKFTDM  74

Query  481  KALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaa  302
            KALVFLVIANGLAAAYSLVQ++RC +SMIRG+VLFNKPLAW IFSGDQL+AYL+L AVAA
Sbjct  75   KALVFLVIANGLAAAYSLVQILRCVLSMIRGTVLFNKPLAWVIFSGDQLIAYLTLAAVAA  134

Query  301  aaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            AAQSAV+AK+GQ ELQWM+ C++YGKFCNQ+GEG+AS++IVC+S ++L  ISAFSLFRLY
Sbjct  135  AAQSAVFAKLGQMELQWMKTCDLYGKFCNQIGEGVASAVIVCLSTVVLSAISAFSLFRLY  194

Query  121  GDNKSKCNG  95
            GDNK K +G
Sbjct  195  GDNKEKSSG  203



>ref|XP_007212067.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
 gb|EMJ13266.1| hypothetical protein PRUPE_ppa011591mg [Prunus persica]
Length=204

 Score =   288 bits (736),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 180/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVICGL ++ A L+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVIAAALVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVIA+G+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIAHGIIAAYSLVQVLRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ AV AAAQSAV+AK+GQSELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L 
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQSELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVLS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAF+LFRLYG NKSK
Sbjct  181  CISAFNLFRLYGGNKSK  197



>ref|XP_002323133.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
 sp|B9IH36.1|CSPLJ_POPTR RecName: Full=CASP-like protein 2B1; Short=PtCASPL2B1 [Populus 
trichocarpa]
 gb|EEF04894.1| hypothetical protein POPTR_0016s01010g [Populus trichocarpa]
Length=202

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+N KV+D+RVRLAEL+ RCVIC L ++ AVL+G D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNSKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA+FTDMKALVFLV ANG+AAAYS VQ VRC V M++GSVLF+KPLAW IFSGDQ+
Sbjct  61   SIQKKARFTDMKALVFLVAANGIAAAYSFVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQM  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AVAAAAQS+V+AK+GQ +LQWM+IC MYGKFCNQVGEGIAS+L+V +SM++L 
Sbjct  121  MAYLTMSAVAAAAQSSVFAKLGQPDLQWMKICTMYGKFCNQVGEGIASALLVSVSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAFSLFRLYG NK K   R
Sbjct  181  CISAFSLFRLYGGNKGKDGAR  201



>gb|EYU33843.1| hypothetical protein MIMGU_mgv1a024377mg [Erythranthe guttata]
Length=203

 Score =   285 bits (729),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/202 (75%), Positives = 179/202 (89%), Gaps = 1/202 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYH-GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI  518
            MSYLGVGVSPGNV VYH GSNLKV+DKRVRL E++ RC+ICGLA++ A+LIG D QV+EI
Sbjct  1    MSYLGVGVSPGNVAVYHHGSNLKVIDKRVRLTEVVLRCLICGLALLSALLIGTDVQVKEI  60

Query  517  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  338
            F+I+KKA+FT+MKALVFLV+ANG+ AAYSL Q++RC +SMIRG VLFNKP AWAIF+GDQ
Sbjct  61   FTIQKKAQFTNMKALVFLVVANGITAAYSLAQVLRCVLSMIRGRVLFNKPFAWAIFAGDQ  120

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
            +MAYL+L AVAAAAQSAV AK+GQ+ LQWM ICN+YGKFCNQ+GEGIAS L+V +SMI+L
Sbjct  121  VMAYLTLAAVAAAAQSAVLAKLGQTALQWMSICNIYGKFCNQIGEGIASGLLVSLSMIVL  180

Query  157  CGISAFSLFRLYGDNKSKCNGR  92
              ISAFSLFRLYGDN  K NGR
Sbjct  181  SAISAFSLFRLYGDNNRKSNGR  202



>gb|KDP29302.1| hypothetical protein JCGZ_19405 [Jatropha curcas]
Length=202

 Score =   283 bits (724),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/197 (76%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV VYHG+N+KV+D+RVRLAEL+ RCV CGL ++ AVL+  D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVAVYHGTNVKVIDRRVRLAELVLRCVTCGLGVLAAVLVATDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA++TDMKALVFLVIANG+ AAYSLVQ VRC V MIRGSVLFNKPLAWAIFSGDQ+
Sbjct  61   SIQKKARYTDMKALVFLVIANGIVAAYSLVQGVRCVVGMIRGSVLFNKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AVAAAAQSA +AK+GQ ELQWM+IC+MYGKFCNQVGEGIAS+  V +S ++L 
Sbjct  121  MAYLTVAAVAAAAQSAAFAKLGQPELQWMKICDMYGKFCNQVGEGIASAFFVGLSTVVLS  180

Query  154  GISAFSLFRLYGDNKSK  104
             +SAFSLFRLYG NK K
Sbjct  181  CLSAFSLFRLYGANKGK  197



>gb|AGE09573.1| UPF-like protein [Eucalyptus cladocalyx]
Length=203

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/200 (75%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH ++LKVVD+RVRLAEL+ R VICGL ++ AVL+G D+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHETSLKVVDRRVRLAELVLRFVICGLGVLTAVLVGTDTQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVI NG+AA+YSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIVNGIAASYSLIQALRCVVSMVRGSVLFSKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY++L AVAA+AQSAV AK+GQ ELQWM+IC MY KFCNQVGEGI S+L+V I M+ L 
Sbjct  121  MAYVTLAAVAASAQSAVIAKLGQPELQWMKICGMYEKFCNQVGEGIVSALLVSIGMVALS  180

Query  154  GISAFSLFRLY-GDNKSKCN  98
             ISAF LFRLY G NK K N
Sbjct  181  VISAFGLFRLYNGSNKGKSN  200



>ref|XP_007026314.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
 gb|EOY28936.1| CASP-like protein POPTRDRAFT_818956 isoform 1 [Theobroma cacao]
Length=202

 Score =   278 bits (712),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 178/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVIC L+++ AVL+  D+QV+EIF
Sbjct  1    MNYLGVGVSPGNVPVYHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA+FTDMKALVFLV+ANG+AAAYSL+Q VRC V+M+RGSVLF+KP AWAIFSGDQ 
Sbjct  61   SIQKKARFTDMKALVFLVVANGVAAAYSLIQGVRCVVAMVRGSVLFSKPFAWAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL++ AV AAAQSAV+ K+GQ+ELQW++IC+MYGKFCNQVG+G+A +L+V + M+ L 
Sbjct  121  LAYLTVAAVGAAAQSAVFGKLGQTELQWLKICSMYGKFCNQVGDGVAMALLVSLGMVALS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAFSLFRLYG  K++ N R
Sbjct  181  CISAFSLFRLYGSTKARNNSR  201



>gb|KJB67396.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=202

 Score =   278 bits (711),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 146/199 (73%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+G D+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKA+FTDMKALVFLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ 
Sbjct  61   TIQKKARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL++ AV AAAQSA +AK+GQ++LQWM ICNMYGKFCNQ+GEGIA SL+V I M+ L 
Sbjct  121  LAYLNVAAVGAAAQSAAFAKLGQTKLQWMVICNMYGKFCNQIGEGIAVSLLVSICMVGLS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
             ISAF LFRLYG NK+K N
Sbjct  181  CISAFGLFRLYGSNKAKNN  199



>ref|XP_010052948.1| PREDICTED: CASP-like protein 2B1 [Eucalyptus grandis]
 gb|KCW77100.1| hypothetical protein EUGRSUZ_D01440 [Eucalyptus grandis]
Length=203

 Score =   277 bits (708),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 175/200 (88%), Gaps = 1/200 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH ++LKVVD+RVRLAEL+ R VICGL ++ AVL+G D+QVREIF
Sbjct  1    MSYLGVGVSPGNVPVYHETSLKVVDRRVRLAELVLRFVICGLGVLAAVLVGTDTQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVIANG+AA+YS++Q +RC VSM+RGSVLF+KPLAW IFSGDQ+
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAASYSMIQALRCVVSMVRGSVLFSKPLAWVIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY++L AVAAAAQSAV AK+GQ ELQWM++C MY KFCNQVGEGI S+L+V I M+ L 
Sbjct  121  MAYVTLAAVAAAAQSAVIAKLGQPELQWMKVCGMYEKFCNQVGEGIVSALLVSIGMVALS  180

Query  154  GISAFSLFRLY-GDNKSKCN  98
             ISAF LFRLY G NK K N
Sbjct  181  VISAFGLFRLYNGSNKGKSN  200



>ref|XP_003534893.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Glycine max]
Length=203

 Score =   276 bits (706),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/196 (69%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  691  SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS  512
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+G DSQV+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFS  62

Query  511  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  332
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVM  122

Query  331  aylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCG  152
            AY+++  V AA QS V A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM++L  
Sbjct  123  AYVTVATVVAAGQSGVIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVLSC  182

Query  151  ISAFSLFRLYGDNKSK  104
            ISAFSLFRLYG NK+K
Sbjct  183  ISAFSLFRLYGGNKTK  198



>ref|XP_010087633.1| hypothetical protein L484_010584 [Morus notabilis]
 gb|EXB29526.1| hypothetical protein L484_010584 [Morus notabilis]
Length=202

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 176/201 (88%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH ++ +VVD+RVR+AEL+ RC+I  L IV  VL+  D+QV+EIF
Sbjct  1    MSYLGVGVSPGNVPVYHMTDSRVVDRRVRMAELVLRCLISVLGIVACVLVATDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMKALVFL  ANG+ AAYSLVQ +RC VSM+RG+V+F+KPLAW IFSGDQ+
Sbjct  61   SIQKKAKFTDMKALVFLATANGIVAAYSLVQALRCVVSMVRGNVIFSKPLAWVIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AV AAAQ+AV+AK+GQ+ELQWM+ICNMY KFCNQVGEGIAS+L+V +S +++ 
Sbjct  121  MAYVTVAAVGAAAQAAVFAKLGQAELQWMKICNMYDKFCNQVGEGIASALLVSLSTVVIS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
            GISAF+LFRLYG NK+K + R
Sbjct  181  GISAFNLFRLYGGNKAKSSAR  201



>gb|KHN40811.1| CASP-like protein [Glycine soja]
Length=203

 Score =   275 bits (703),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 169/196 (86%), Gaps = 0/196 (0%)
 Frame = -3

Query  691  SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS  512
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+G DS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  511  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  332
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQVM  122

Query  331  aylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCG  152
            AY+++  V AA QS V A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM++L  
Sbjct  123  AYVTVATVVAAGQSGVIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVLSC  182

Query  151  ISAFSLFRLYGDNKSK  104
            ISAFSLFRLYG NK+K
Sbjct  183  ISAFSLFRLYGGNKTK  198



>ref|XP_003547283.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
Length=202

 Score =   275 bits (702),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 172/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  691  SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS  512
            SYLGVGVSPGNVPVYH +N+KV+D+++++ EL+ RCVI GL ++ AVL+G DS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  511  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  332
             +K+AKFTDMK+LVFLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ+M
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVM  122

Query  331  aylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCG  152
            AY+++ A+AAA QS + A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM+++  
Sbjct  123  AYVTVVALAAAGQSGMIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVMSC  182

Query  151  ISAFSLFRLYGDNKSK  104
            ISAFSLFRLYG NK+K
Sbjct  183  ISAFSLFRLYGGNKTK  198



>gb|KHG12114.1| CASP-like protein [Gossypium arboreum]
Length=269

 Score =   277 bits (708),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 175/199 (88%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+G D+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+K+A+FTDMKALVFLV ANG+ AAYSLVQ VRC V M RGSVLF+KPLA AIFSGDQ 
Sbjct  61   TIQKRARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMGRGSVLFSKPLALAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL+L AV AAAQSA +AK+GQ++LQWM ICNMYGKFCNQVGEGIA SL+V I M+ L 
Sbjct  121  LAYLNLAAVGAAAQSAAFAKLGQTKLQWMVICNMYGKFCNQVGEGIAVSLLVSICMVGLS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
             ISAF LFRLYG NK+K N
Sbjct  181  CISAFGLFRLYGSNKAKNN  199



>gb|KJB69167.1| hypothetical protein B456_011G008900 [Gossypium raimondii]
Length=202

 Score =   271 bits (692),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 177/199 (89%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLGVG+SPGNVPVYHG+N  V+++RVR+AEL+ RC+IC L+++ A L+G DSQV+EIF
Sbjct  1    MNYLGVGISPGNVPVYHGTNPMVIERRVRIAELLLRCLICVLSVLTAFLVGTDSQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKA+FTDMKALVFLV+ANG+AAAYSLVQ+VRC VSM++GSVL NKPLAW IFSGDQ 
Sbjct  61   SIQKKARFTDMKALVFLVVANGVAAAYSLVQVVRCVVSMVKGSVLVNKPLAWTIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYL++ AV AAAQSAV+AK+GQ+ELQWM+ICN+YGKFCNQVGEGI+ +++  + M++  
Sbjct  121  MAYLNVAAVGAAAQSAVFAKLGQTELQWMKICNLYGKFCNQVGEGISMAVLASVCMVLQS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
            GISAF+LFRL G NK+K N
Sbjct  181  GISAFTLFRLCGVNKAKGN  199



>ref|XP_009346047.1| PREDICTED: CASP-like protein RCOM_0864260 [Pyrus x bretschneideri]
Length=202

 Score =   270 bits (691),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 179/201 (89%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPG VPVYH +NLKV+D+RVR+AEL+ RCVICGL +V A L+G D+Q++EIF
Sbjct  1    MSYLGVGVSPGKVPVYHSTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +++KKAKFTDMKALVFLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ AV AAAQSAV+AK+GQ ELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L 
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQPELQWMKICNMYDKFCNQVGEGIASALLVSLSTVLLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             +SAF+LFRLYG NK+K   R
Sbjct  181  CVSAFNLFRLYGGNKNKTASR  201



>ref|XP_010270196.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=204

 Score =   268 bits (686),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/198 (70%), Positives = 172/198 (87%), Gaps = 1/198 (1%)
 Frame = -3

Query  682  GVGVSPGNVPVYHGSNLK-VVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            GVGVSPGNVPVYHG NLK ++D+RVRLAE++ RC+ICGL ++ AVLIG D+QVRE F+IR
Sbjct  6    GVGVSPGNVPVYHGDNLKAMIDRRVRLAEMVLRCLICGLGVLAAVLIGSDTQVREFFTIR  65

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            KKAKFTDMKALV LV+ANG+AA YSL+Q +RC +SMI+GSVLFNKPLAWAIFSGDQ+MAY
Sbjct  66   KKAKFTDMKALVLLVVANGIAAGYSLIQGLRCGLSMIKGSVLFNKPLAWAIFSGDQVMAY  125

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGIS  146
            L + ++AAAAQS+V A++GQ E QWM++C++Y KFC Q GEG+AS+L+V + MI L  IS
Sbjct  126  LLMASLAAAAQSSVIARLGQPEFQWMKVCSLYEKFCTQTGEGMASALVVSLGMITLSCIS  185

Query  145  AFSLFRLYGDNKSKCNGR  92
            AF+LFRLYG NK+K +GR
Sbjct  186  AFNLFRLYGGNKAKSSGR  203



>ref|XP_004486332.1| PREDICTED: CASP-like protein POPTRDRAFT_575900-like [Cicer arietinum]
Length=201

 Score =   268 bits (685),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 173/197 (88%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYH SN+KV+D+R+R+ EL+ RCVI  LA++   L+  DSQVR  F
Sbjct  1    MSYLGVGVSPGNVPVYHSSNMKVLDRRIRITELVLRCVILCLALLAVFLVVTDSQVRVFF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I KKAKFTDMKALVFLV+ANGLAA YSL+Q VRC VSMI GSVLF+KPLAWAIFSGDQ+
Sbjct  61   TIEKKAKFTDMKALVFLVVANGLAAGYSLIQGVRCVVSMINGSVLFSKPLAWAIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AVAAAAQSAV+AK+GQ ELQW++IC+MYGKFCNQVGEG+AS+++V +SM++L 
Sbjct  121  MAYITVSAVAAAAQSAVFAKLGQPELQWIKICDMYGKFCNQVGEGLASAIVVSLSMVLLS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG +K K
Sbjct  181  CISAFSLFRLYGGSKIK  197



>ref|XP_008384165.1| PREDICTED: CASP-like protein RCOM_0864260 isoform X1 [Malus domestica]
Length=204

 Score =   268 bits (684),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 173/196 (88%), Gaps = 0/196 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYL VGVSPGNVPVYH +NLKV D+R+R+AEL+ RC+ICGL +V A L+G D+QV+EIF
Sbjct  1    MSYLAVGVSPGNVPVYHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +++KKAKFTDMKALVFLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+ + AV AA QSAV AK+GQ ELQWM+ICNMY KFCNQVGEGIAS+L+V +S ++L 
Sbjct  121  MAYVCVAAVGAATQSAVLAKLGQPELQWMKICNMYDKFCNQVGEGIASALLVSLSTVLLS  180

Query  154  GISAFSLFRLYGDNKS  107
             +SAF+LFRLYG NK+
Sbjct  181  CVSAFNLFRLYGGNKN  196



>ref|XP_008370988.1| PREDICTED: CASP-like protein RCOM_0864260 [Malus domestica]
Length=202

 Score =   266 bits (681),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RCVICGL +V A L+G D+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCVICGLGVVAAALVGTDTQIKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +++KKAKFTDMKALVFLV+ANG+ AAYSLVQ++RC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVAAYSLVQVMRCVVSMVRGNVLFSKPIAWIIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ AV AAAQSAV+AK+GQ ELQWM+ICNMY KFCN+VGEGIAS+L+V +S ++L 
Sbjct  121  MAYVSVAAVGAAAQSAVFAKLGQPELQWMKICNMYDKFCNRVGEGIASALLVSLSAVLLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             +SAF+LFRLYG N +K   R
Sbjct  181  CVSAFNLFRLYGGNTNKTAAR  201



>gb|KHN32948.1| CASP-like protein [Glycine soja]
Length=204

 Score =   266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 163/198 (82%), Gaps = 2/198 (1%)
 Frame = -3

Query  691  SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS  512
            SYLGVGVSPGNVPVYH +N+KV+D+++++ EL+ RCVI GL ++ AVL+G DS+V+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVKVLDRKIKITELVLRCVILGLGVLAAVLVGTDSEVKEFFS  62

Query  511  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ--  338
             +K+AKFTDMK+LVFLV+ANGLAA YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ  
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLAAGYSLIQGLRCILSMIRGRVLFSKPLAWAIFSGDQVY  122

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
             +   +   +    QS + A++GQ ELQWM+ICNMYGKFCNQVGEGIAS+ +  +SM+++
Sbjct  123  FIYIKNTAYLLFFWQSGMIARVGQPELQWMKICNMYGKFCNQVGEGIASAFVASLSMVVM  182

Query  157  CGISAFSLFRLYGDNKSK  104
              ISAFSLFRLYG NK+K
Sbjct  183  SCISAFSLFRLYGGNKTK  200



>ref|XP_003549509.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN03533.1| CASP-like protein [Glycine soja]
Length=201

 Score =   265 bits (678),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 168/200 (84%), Gaps = 0/200 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+ EL+ RCV  GL +V  VL+  DSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRITELVLRCVSLGLGVVAIVLVVTDSQVKEFF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            S +KKAKFTDMKALVFLV+ANGL   YSL+Q +RC VSM+RG+VLF+KPLAW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVVANGLTVGYSLIQGLRCVVSMVRGNVLFSKPLAWLIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AVAAA QS V  + GQ+ELQWM++CNMYGKFCNQ+GEGIAS+ +V +SM++L 
Sbjct  121  MAYVTVAAVAAALQSGVLGRTGQAELQWMKVCNMYGKFCNQMGEGIASAFVVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNG  95
             ISAFSLFRLYG NK+K  G
Sbjct  181  CISAFSLFRLYGTNKNKYAG  200



>ref|XP_003529670.1| PREDICTED: CASP-like protein RCOM_0864260-like [Glycine max]
 gb|KHN42278.1| CASP-like protein [Glycine soja]
Length=201

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 165/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+ EL+ RCV  GL  V  VL+  DSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRITELVLRCVSLGLGAVAIVLVVTDSQVKEFF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            S +KKAKFTDMKALVFLV+ANGL   YSL+Q +RC VSMIRG+VLFNKP AW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVVANGLTVGYSLIQGLRCVVSMIRGNVLFNKPFAWLIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AV AA QS V  + GQ+ELQWM++CNMYGKFCNQ+GEGIAS+ +V +SM++L 
Sbjct  121  MAYVTVAAVVAALQSGVLGRTGQAELQWMKVCNMYGKFCNQMGEGIASAFVVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNG  95
             ISAFSLFRLYG NK+K  G
Sbjct  181  CISAFSLFRLYGTNKNKYAG  200



>ref|XP_003594276.1| hypothetical protein MTR_2g026530 [Medicago truncatula]
 gb|AES64527.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
 gb|AFK47998.1| unknown [Medicago truncatula]
Length=201

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 171/197 (87%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPG VPVYH +N+KV+D+RVR+ EL+ R V  GL ++  VLI  DSQVRE F
Sbjct  1    MSYLGVGVSPGTVPVYHSTNMKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLV+AN +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+
Sbjct  61   TIQKKAKFTDMKALVFLVVANAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AV+AAAQSAV+AK+GQ +LQWM+ICNMYGKFCNQVGEG+AS+ +V +SM+++ 
Sbjct  121  MAYITVAAVSAAAQSAVFAKMGQEQLQWMKICNMYGKFCNQVGEGLASAFLVSLSMVVVS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG +K K
Sbjct  181  CISAFSLFRLYGGSKIK  197



>ref|XP_010540841.1| PREDICTED: CASP-like protein 2B1 [Tarenaya hassleriana]
Length=196

 Score =   261 bits (667),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 171/197 (87%), Gaps = 4/197 (2%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG+SP    VYHG+N+K +D+RV+L ELI RC +CGL +V A+L+G D+QV+EIF
Sbjct  1    MSYLGVGISP----VYHGANMKSIDRRVKLTELILRCSVCGLGLVAALLVGTDTQVKEIF  56

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKA+FTDMKALVFLV ANG+AAAYSLVQ++RC+V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  57   TIQKKARFTDMKALVFLVSANGVAAAYSLVQVIRCAVGMVKGSVLFSKPLAWAIFSGDQA  116

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL + A+AAAAQSA +AK+G+SELQWM+ICNMYGKFCNQVGEGI S+L   I M+++ 
Sbjct  117  IAYLCVAAIAAAAQSAAFAKLGESELQWMKICNMYGKFCNQVGEGIGSALFAAIGMVMVS  176

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG +K +
Sbjct  177  CISAFSLFRLYGGSKGR  193



>ref|XP_007154032.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
 gb|ESW26026.1| hypothetical protein PHAVU_003G085300g [Phaseolus vulgaris]
Length=201

 Score =   259 bits (662),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/200 (67%), Positives = 167/200 (84%), Gaps = 0/200 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+GVSPG VPVYHG+ LKV+D+RVR+AE++ R V  G+ ++  VL+  DSQV+E F
Sbjct  1    MSYLGLGVSPGTVPVYHGTKLKVLDRRVRIAEMVLRGVSLGIGVLAIVLVVTDSQVKEFF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            S +KKAKFTDMKALVFLVIANGL   YSL+Q +RC VSM+RG+VL +KPLAW IFSGDQ+
Sbjct  61   SFQKKAKFTDMKALVFLVIANGLTVGYSLIQGLRCVVSMVRGNVLLSKPLAWLIFSGDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAYLS+ AVAAA QS +  + GQ+ELQWM++CNMYGKFCN++GEGI S+L+V +SM++L 
Sbjct  121  MAYLSVAAVAAALQSGMIGRAGQAELQWMKVCNMYGKFCNRMGEGIGSALVVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNG  95
             ISAFSLFRLYG NK+K  G
Sbjct  181  CISAFSLFRLYGSNKNKHAG  200



>gb|EPS67628.1| hypothetical protein M569_07146 [Genlisea aurea]
Length=205

 Score =   258 bits (659),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/203 (67%), Positives = 171/203 (84%), Gaps = 5/203 (2%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYL VGVSPGNVPV HG+NL+ VD+++RL EL+ RCVI G+AIV  VLI  D+QV+EIF
Sbjct  1    MSYLSVGVSPGNVPVSHGNNLREVDRKIRLVELVLRCVIFGVAIVSTVLIATDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ-  338
            SIRK+A+FTDMK L+F+V+ N LAA YSLVQLVRC VSMI+GSVLF+KPLAWAIFSGDQ 
Sbjct  61   SIRKRARFTDMKVLIFMVVVNVLAAGYSLVQLVRCGVSMIKGSVLFSKPLAWAIFSGDQN  120

Query  337  --LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMI  164
              ++AYL L AVAA+ QSA+YA+ G+++LQWM+ CN+Y KFCN++GEGI  +++VC+SM+
Sbjct  121  VEILAYLMLSAVAASLQSAIYAQYGEADLQWMKTCNLYKKFCNRMGEGIVGAVLVCLSMV  180

Query  163  ILCGISAFSLFRLYGDNKS--KC  101
             L GISAFSLFRLY D+ S  KC
Sbjct  181  CLSGISAFSLFRLYDDDSSTGKC  203



>ref|XP_011040245.1| PREDICTED: CASP-like protein 2B1, partial [Populus euphratica]
Length=187

 Score =   256 bits (655),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 162/186 (87%), Gaps = 0/186 (0%)
 Frame = -3

Query  649  YHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALV  470
            YHG+NLKV+D+RVRLAEL+ RCVIC L ++ AVL+G D+QV+EIFSI KKA+FTDMKALV
Sbjct  1    YHGTNLKVIDRRVRLAELVLRCVICCLGVLAAVLVGTDTQVKEIFSIEKKARFTDMKALV  60

Query  469  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  290
            FLV ANG+AAAYSLVQ VRC V M++GSVLF+KPLAW IFSGDQ+MAYL++ AVAAAAQS
Sbjct  61   FLVAANGIAAAYSLVQGVRCVVGMVKGSVLFSKPLAWVIFSGDQMMAYLTMSAVAAAAQS  120

Query  289  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            A +AK+GQ +LQWM+ C MYGKFCNQVGEGIAS+L+V +SM++L  ISAFSLFRLYG NK
Sbjct  121  AAFAKLGQPDLQWMKTCTMYGKFCNQVGEGIASALLVSVSMVVLSCISAFSLFRLYGGNK  180

Query  109  SKCNGR  92
             K   R
Sbjct  181  GKDGAR  186



>ref|XP_010252724.1| PREDICTED: CASP-like protein 2B1 [Nelumbo nucifera]
Length=203

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 166/195 (85%), Gaps = 0/195 (0%)
 Frame = -3

Query  679  VGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKK  500
            V VSPGNVPVYH +NL+V+D+RV++AE++ RC+ICGL I+ AVL+G D+QVREIF+IRKK
Sbjct  7    VTVSPGNVPVYHKNNLEVIDRRVKVAEVVLRCMICGLGILAAVLVGSDTQVREIFTIRKK  66

Query  499  AKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayls  320
            AKFTDMKALVFL+IANG+AA YS +Q +RC VS+IRGS+L NKPLAWAIFSGDQ+MAY+ 
Sbjct  67   AKFTDMKALVFLLIANGIAAGYSFIQSLRCVVSVIRGSLLVNKPLAWAIFSGDQVMAYVL  126

Query  319  lgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAF  140
            + A AAAAQS+V A++GQ E QWM++CN+Y KFC Q GEG+  +L+V +SMI L  ISAF
Sbjct  127  MAAFAAAAQSSVIAEMGQPEWQWMKVCNLYEKFCTQAGEGMVIALVVSLSMITLSFISAF  186

Query  139  SLFRLYGDNKSKCNG  95
            +LFRLYG+ +++  G
Sbjct  187  NLFRLYGETEAQNRG  201



>ref|XP_006410744.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
 sp|E4MWF4.1|CSPL1_THEHA RecName: Full=CASP-like protein 2B1; Short=ThCASPL2B1 [Eutrema 
halophilum]
 dbj|BAJ33937.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52197.1| hypothetical protein EUTSA_v10017259mg [Eutrema salsugineum]
Length=199

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 169/201 (84%), Gaps = 3/201 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG+SP NV    G+ +K++D++VRL ELI RC +C LA+V A+LI  D+QV+EIF
Sbjct  1    MSYLGVGLSPVNVA---GTKMKLMDRKVRLTELILRCSVCALALVAAILIATDTQVKEIF  57

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAK+TDMKALVFLV+ NG+AAAYSL+ +VRC V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  58   TIQKKAKYTDMKALVFLVVVNGIAAAYSLLHMVRCVVGMMKGSVLFSKPLAWAIFSGDQA  117

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL++  VAAAAQSA +AK+G+ ELQWM+IC +YGKFCNQVGEGIA++L+  I M+++ 
Sbjct  118  IAYLTVAGVAAAAQSAAFAKLGEPELQWMKICTIYGKFCNQVGEGIATALLASIGMVLIS  177

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAF+LFRLYG NK++   R
Sbjct  178  SISAFALFRLYGGNKAQQGSR  198



>ref|XP_010909399.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=202

 Score =   251 bits (640),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 134/196 (68%), Positives = 165/196 (84%), Gaps = 1/196 (1%)
 Frame = -3

Query  679  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRK  503
            VGV PGNVPVY+G  +LK V++RV++AE++ R VI GL ++GA L+  D+QVREIFS+ K
Sbjct  5    VGVRPGNVPVYYGGGHLKAVERRVKVAEVVLRWVIFGLGVLGAALVSSDTQVREIFSLEK  64

Query  502  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  323
            KAKFTDMKALVFLVIANG+AA YSL+Q VRC VSMI+G+VLFNK  AW IFS DQ+MAY+
Sbjct  65   KAKFTDMKALVFLVIANGIAAGYSLIQGVRCVVSMIKGTVLFNKAWAWVIFSCDQVMAYV  124

Query  322  slgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISA  143
            +L AV AAAQSAV  + GQSELQWM+ICN+YGKFC QVGEG+ SS +V +SM+ L G+SA
Sbjct  125  TLAAVGAAAQSAVLGEFGQSELQWMKICNLYGKFCTQVGEGLVSSFVVSLSMVSLSGLSA  184

Query  142  FSLFRLYGDNKSKCNG  95
            F+LFRLYG+NK KC+G
Sbjct  185  FNLFRLYGNNKGKCSG  200



>ref|XP_009133041.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=199

 Score =   248 bits (633),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 166/197 (84%), Gaps = 3/197 (2%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV    G+ +K+ D++VRL ELI RC++C LA++ A+L+  D+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVF  57

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGDQ 
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQA  117

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL++ +V AAAQSA +AK+G+ ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++ 
Sbjct  118  VAYLTVASVGAAAQSAAFAKLGEPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMIS  177

Query  154  GISAFSLFRLYGDNKSK  104
             ISAF LFRLYG NK++
Sbjct  178  CISAFGLFRLYGGNKAR  194



>ref|XP_010686644.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686645.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010686646.1| PREDICTED: CASP-like protein 2B1 [Beta vulgaris subsp. vulgaris]
Length=203

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 166/202 (82%), Gaps = 1/202 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI  518
            MS+ G+G+SPGNV V+HGS N K V+++V++AEL+ R +I GL ++ A LIG DS+V+ I
Sbjct  1    MSFGGIGISPGNVAVHHGSYNAKAVERKVKIAELVLRVLILGLGVLAAALIGFDSEVKVI  60

Query  517  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  338
            FSI KKAKFTDMKALVFLVI +G+ AAYSLVQ+VRC + MIRGSVLF+KPLAW IFSGDQ
Sbjct  61   FSITKKAKFTDMKALVFLVIVDGIVAAYSLVQVVRCIMGMIRGSVLFSKPLAWIIFSGDQ  120

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
             MAYL+L AVAAAA+S+V  K GQ ELQWM+ C+ YGKFCNQ+GEGIASS++V +  ++L
Sbjct  121  AMAYLTLAAVAAAAESSVIGKFGQPELQWMKTCDFYGKFCNQIGEGIASSVVVSLCTLVL  180

Query  157  CGISAFSLFRLYGDNKSKCNGR  92
              ISA+SLFRLYG NK K N R
Sbjct  181  SCISAYSLFRLYGGNKGKSNTR  202



>emb|CDY69773.1| BnaAnng31470D [Brassica napus]
Length=200

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 166/198 (84%), Gaps = 4/198 (2%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV    G+ +K+ D++VRL ELI RC++C LA++ A+L+  D+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPMKLNDRKVRLTELILRCLVCALALISAILVATDTQVKEVF  57

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-Q  338
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQ  117

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
             +AYL++ +V AAAQSA +AK+G+ ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++
Sbjct  118  AVAYLTVASVGAAAQSAAFAKLGEPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMI  177

Query  157  CGISAFSLFRLYGDNKSK  104
              ISAF LFRLYG NK++
Sbjct  178  SCISAFGLFRLYGGNKAR  195



>ref|NP_565822.1| CASP-like protein [Arabidopsis thaliana]
 sp|Q8L924.2|CSPL7_ARATH RecName: Full=CASP-like protein 2B2; Short=AtCASPL2B2 [Arabidopsis 
thaliana]
 gb|AAL58928.1|AF462840_1 unknown protein [Arabidopsis thaliana]
 gb|AAD15439.2| expressed protein [Arabidopsis thaliana]
 gb|AAM70533.1| At2g35760/T20F21.5 [Arabidopsis thaliana]
 gb|AEC09157.1| CASP-like protein [Arabidopsis thaliana]
Length=201

 Score =   243 bits (620),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/201 (66%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV     + +K++D++VR+ ELI RC++C LA+V A+LI  D QVREIF
Sbjct  1    MSYLGVGVSPGNVS-GSTTKMKLIDRKVRVTELILRCLVCVLALVAAILIATDVQVREIF  59

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
             I+KKAKFTDMKALV LV+ NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ 
Sbjct  60   MIQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQA  119

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL +  VAAAAQSA +AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L  CI M+++ 
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLIS  179

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAF +FRLYG +KS+ + R
Sbjct  180  CISAFGVFRLYGGSKSRPSSR  200



>gb|AAM66995.1| unknown [Arabidopsis thaliana]
Length=201

 Score =   243 bits (620),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/201 (65%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV     + +K++D++VR+ ELI RC++C L++V A+LI  D QVREIF
Sbjct  1    MSYLGVGVSPGNV-TETSTKMKLIDRKVRVTELILRCLVCVLSLVSAILIATDVQVREIF  59

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
             I+KKAKFTDMKALV LV+ NG+AA YSLVQ VRC V +++G VLF+KPLAWAIF GDQ 
Sbjct  60   MIQKKAKFTDMKALVLLVVVNGIAAGYSLVQAVRCVVGLMKGRVLFSKPLAWAIFFGDQA  119

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL +  VAAAAQSA +AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L  CI M+++ 
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFACIGMVLIS  179

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAF +FRLYG +KS+ + R
Sbjct  180  CISAFGVFRLYGGSKSRPSSR  200



>gb|KFK36471.1| hypothetical protein AALP_AA4G129000 [Arabis alpina]
Length=199

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 165/201 (82%), Gaps = 3/201 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MS++GVGVSPGN   + G+ +K+ D++VRL EL+ RC +C LA++ A+LI  D QVREIF
Sbjct  1    MSFVGVGVSPGN---FTGTKVKLFDRKVRLTELVLRCSVCVLALISAILIATDVQVREIF  57

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAK+TDMKALV LV+ NG+AAAYSLVQ+VRC V +++G+VLF+KPLAWAIF GDQ 
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVQVVRCVVGLMKGNVLFSKPLAWAIFFGDQA  117

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL +  +AAAAQSA +AK+G+ ELQWM+ICNMYGKFCNQVGEGIAS+L   I M+++ 
Sbjct  118  VAYLCVAGIAAAAQSAAFAKLGEPELQWMKICNMYGKFCNQVGEGIASALFASIGMVMIS  177

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAF LFRLYG NK + + R
Sbjct  178  CISAFGLFRLYGGNKIRPSSR  198



>emb|CDX79621.1| BnaC03g19570D [Brassica napus]
Length=200

 Score =   238 bits (606),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 162/198 (82%), Gaps = 4/198 (2%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV    G+  K+ + +VRL ELI RC +C LA++ A+L+  D+QV+E+F
Sbjct  1    MSYLGVGVSPGNVA---GAPTKLNEGKVRLTELILRCFVCALALISAILVATDTQVKEVF  57

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-Q  338
            +I+KKAK+TDMKALV LV+ NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q
Sbjct  58   TIQKKAKYTDMKALVLLVVVNGIAAAYSLVHGVRCVVGMMKGSVLFSKPLAWAIFSGDQQ  117

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
             +AYL++ +V AAAQSA +AK+G  ELQWM+IC MYGKFCNQVGEGIA++L+  I M+++
Sbjct  118  AVAYLTVASVGAAAQSAAFAKLGNPELQWMKICTMYGKFCNQVGEGIATALLASIGMVMI  177

Query  157  CGISAFSLFRLYGDNKSK  104
              ISAF LFRLYG NK++
Sbjct  178  SCISAFGLFRLYGGNKAR  195



>ref|XP_002879572.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7LIK3.1|CSPL3_ARALL RecName: Full=CASP-like protein 2B2; Short=AlCASPL2B2 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55831.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=201

 Score =   235 bits (599),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 162/201 (81%), Gaps = 1/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNV     + +K++D++VR+ ELI R ++C  A+V A+L+  D QVREIF
Sbjct  1    MSYLGVGVSPGNV-TGSSTKMKLIDRKVRVTELILRSLVCAFALVAAILVATDVQVREIF  59

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLV+ NG+AA YSLVQ V C V +++GSVL ++PLAWAIF GDQ 
Sbjct  60   TIQKKAKFTDMKALVFLVVINGIAAGYSLVQAVCCLVGLMKGSVLLSEPLAWAIFFGDQA  119

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AYL +  VAAAAQSA +AK+GQ ELQWM+IC+MYGKFCNQVGEGIAS+L  CI M+++ 
Sbjct  120  VAYLCVAGVAAAAQSAAFAKLGQPELQWMKICDMYGKFCNQVGEGIASALFACIGMVLIS  179

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISAF +FRLYG +K + + R
Sbjct  180  CISAFGVFRLYGGSKPRQSSR  200



>ref|XP_008463603.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
 ref|XP_008463604.1| PREDICTED: CASP-like protein RCOM_0864260 [Cucumis melo]
Length=202

 Score =   234 bits (597),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R VICGL ++ AVL+G D++VR IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFVICGLGVLAAVLVGTDTEVRTIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +IRK+AKFTDMKALVFLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+
Sbjct  61   AIRKRAKFTDMKALVFLVVANAVAAAYSLVQGLRCVVCMLRGKVLFSKPLAWIIFSGDQI  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AVA+AAQSAV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L 
Sbjct  121  MAYVTVAAVASAAQSAVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISA SLFRLY   K+K N R
Sbjct  181  CISASSLFRLYNGGKNKSNSR  201



>ref|XP_004139530.1| PREDICTED: CASP-like protein GSVIVT00013502001-like [Cucumis 
sativus]
 gb|KGN65030.1| hypothetical protein Csa_1G181430 [Cucumis sativus]
Length=202

 Score =   231 bits (588),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 172/201 (86%), Gaps = 0/201 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R +ICGL ++ AVL+G D++V+ IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +IRK+A FTDMKALVFLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+
Sbjct  61   TIRKRATFTDMKALVFLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQI  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+++ AVA+AAQSAV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L 
Sbjct  121  MAYVTVAAVASAAQSAVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLS  180

Query  154  GISAFSLFRLYGDNKSKCNGR  92
             ISA SLFRLY   K+K N R
Sbjct  181  CISASSLFRLYNGGKNKSNSR  201



>ref|XP_004293384.1| PREDICTED: CASP-like protein 2B1 [Fragaria vesca subsp. vesca]
Length=205

 Score =   229 bits (585),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/204 (66%), Positives = 168/204 (82%), Gaps = 3/204 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGS---NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVR  524
            MSYLGVGVSPGNV V H S   NLKV+D+RV++AEL+ R +ICGL +  A+L+  D+QV+
Sbjct  1    MSYLGVGVSPGNVAVSHSSSTTNLKVIDRRVKVAELVLRFLICGLGLAAALLVATDTQVK  60

Query  523  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSG  344
            EIF ++KKAKFTDMKALVFLVI NG+AAAYSL+Q +RC VSMI+G VLF+KPLAW IFS 
Sbjct  61   EIFMVKKKAKFTDMKALVFLVIVNGIAAAYSLLQALRCVVSMIKGIVLFSKPLAWMIFSA  120

Query  343  DQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMI  164
            DQ++AY+++  V AAAQSA  AK+GQSELQWM+ICNMY KFC QVGEGIA S++V +S I
Sbjct  121  DQVVAYVAVAEVGAAAQSAALAKLGQSELQWMKICNMYDKFCTQVGEGIAISVLVGLSTI  180

Query  163  ILCGISAFSLFRLYGDNKSKCNGR  92
            ++  ISAF+LFRLYG  K++ + R
Sbjct  181  LISCISAFNLFRLYGGGKNQSSSR  204



>ref|XP_006295017.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 ref|XP_006295018.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27915.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
 gb|EOA27916.1| hypothetical protein CARUB_v10024089mg [Capsella rubella]
Length=200

 Score =   229 bits (585),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 120/197 (61%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY+GVG+SP NV     + +K++D++VR+AELI RC +C LA+V A+LI  D QVREIF
Sbjct  1    MSYIGVGISPRNVAGTGSTKMKLIDRKVRVAELILRCSVCALALVAAILIVTDVQVREIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
             I+KKAK+T+MKALVF+V+ NG+AA YSLVQ VRC V +++G VL +KPLAWAIFSGDQ 
Sbjct  61   MIKKKAKYTNMKALVFMVVVNGIAAGYSLVQAVRCVVGLMKGDVLLSKPLAWAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            ++YL +  VAAAAQSA +AK+G+ +LQWM+IC MY KFC QVGEGIAS+L  C+ M+++ 
Sbjct  121  VSYLCVAGVAAAAQSAAFAKLGEPDLQWMKICGMYWKFCIQVGEGIASALFACVGMVLIS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAF +FRLYG +K++
Sbjct  181  CISAFGVFRLYGGSKTR  197



>ref|XP_009407837.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/196 (60%), Positives = 156/196 (80%), Gaps = 1/196 (1%)
 Frame = -3

Query  679  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRK  503
            VG+SPGNVPVY+G   L+ V +R+ +AE++ RC ICGL ++ A LIG  +QVRE FS+ K
Sbjct  5    VGMSPGNVPVYYGGGKLRAVGRRMEVAEVVLRCAICGLGVLAAALIGSATQVREFFSVEK  64

Query  502  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  323
            KA+FTDMKALVFLV+ANG+AA YSLVQ VRC VS+I+G VL  K LAWAIFS DQ +AY+
Sbjct  65   KARFTDMKALVFLVVANGIAAGYSLVQGVRCVVSIIKGGVLLKKALAWAIFSCDQALAYV  124

Query  322  slgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISA  143
            +  A+AAAA++A   + GQ+ELQWM++CN+YGKFC QVGEGIAS+ + C+ ++I+  +SA
Sbjct  125  ASAAIAAAAEAAELGQSGQAELQWMKLCNLYGKFCTQVGEGIASAFLACLCLVIVSSMSA  184

Query  142  FSLFRLYGDNKSKCNG  95
            F+LFRLYG  K + +G
Sbjct  185  FNLFRLYGRTKEQNSG  200



>ref|XP_010907052.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=200

 Score =   227 bits (579),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 162/197 (82%), Gaps = 1/197 (1%)
 Frame = -3

Query  682  GVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            G+GVSPGNVPVY+G  +LK V++RV++AE++ R VI GL ++ A L+  D+QV  IFS+ 
Sbjct  4    GIGVSPGNVPVYYGGGHLKAVERRVKVAEVVLRWVIFGLGVLAAALVASDTQVTNIFSLE  63

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            KKAKFTDMKALVFLVIAN +AA YSL+Q +RC+VSMI+GSVLF+K LA  IFS DQ+MAY
Sbjct  64   KKAKFTDMKALVFLVIANAIAAGYSLIQGLRCAVSMIKGSVLFDKALALVIFSCDQVMAY  123

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGIS  146
            ++L AVAAAAQSAV  + GQSELQWM++CN+Y +FC++VGEGI SS +V + M+ L G+S
Sbjct  124  VTLAAVAAAAQSAVLGEFGQSELQWMKLCNLYRRFCSRVGEGILSSFVVSLGMVSLSGLS  183

Query  145  AFSLFRLYGDNKSKCNG  95
            AF+LFRL+G+NK K  G
Sbjct  184  AFNLFRLFGNNKGKTRG  200



>ref|XP_008800613.1| PREDICTED: CASP-like protein GSVIVT00013502001 [Phoenix dactylifera]
Length=201

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  682  GVGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            GVGVSPGNVPVY+G  +LK V++R+++AE++ R VI GL ++ A L+  D+QV+ IFS++
Sbjct  4    GVGVSPGNVPVYYGGGHLKAVERRMKVAEVVLRWVIFGLGVLAAALVASDTQVKNIFSVQ  63

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            KKAKFTD+KALVFLVIA+ +AA YSL+Q +RC V+MI+G+VLFNK LA  IFS DQ+MAY
Sbjct  64   KKAKFTDIKALVFLVIADAIAAGYSLIQGLRCVVNMIKGNVLFNKALALVIFSCDQVMAY  123

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGIS  146
            ++L AVAAAAQSAV  + GQSELQWM++CN+Y KFC+QVGEGI SS +V + M+ L G+S
Sbjct  124  VTLAAVAAAAQSAVLGEFGQSELQWMKLCNLYNKFCSQVGEGILSSFVVSLGMVSLSGLS  183

Query  145  AFSLFRLYGDNKSKCNG  95
            AF+LFRL+G+NK K +G
Sbjct  184  AFNLFRLFGNNKGKSSG  200



>gb|KEH36968.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=181

 Score =   224 bits (572),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +KV+D+RVR+ EL+ R V  GL ++  VLI  DSQVRE F+I+KKAKFTDMKALVFLV+A
Sbjct  1    MKVLDRRVRITELVLRFVNLGLGVLAVVLIVTDSQVREFFTIQKKAKFTDMKALVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            N +AA YSL+Q +RC VSMI+GSVLFNKPLAWAIFS DQ+MAY+++ AV+AAAQSAV+AK
Sbjct  61   NAIAAGYSLIQGLRCVVSMIKGSVLFNKPLAWAIFSCDQVMAYITVAAVSAAAQSAVFAK  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            +GQ +LQWM+ICNMYGKFCNQVGEG+AS+ +V +SM+++  ISAFSLFRLYG +K K
Sbjct  121  MGQEQLQWMKICNMYGKFCNQVGEGLASAFLVSLSMVVVSCISAFSLFRLYGGSKIK  177



>gb|KFK26539.1| hypothetical protein AALP_AA8G262200 [Arabis alpina]
Length=195

 Score =   224 bits (570),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  673  VSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAK  494
            +SPGNV VYHGS +KV+D+RVRL EL+ RC I  L+++  +L+  DSQV++IF+I KKAK
Sbjct  1    MSPGNVAVYHGSKMKVIDRRVRLTELLLRCSISCLSLLALILVVTDSQVKQIFTIEKKAK  60

Query  493  FTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslg  314
            +T+MKALVFLV ANG+AA YSL+Q VRC V  ++GSVL +KPLAWAIFS DQ +AY+S+ 
Sbjct  61   YTEMKALVFLVAANGIAAVYSLLQSVRCYVGSVKGSVLCSKPLAWAIFSADQAIAYISVA  120

Query  313  avaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSL  134
            A+AAAA+S V A  G+ ELQWM++CNM+GKFCN+V EG+AS+L+  I+M+++  ISAF L
Sbjct  121  AIAAAAESGVIAMKGEDELQWMKLCNMFGKFCNRVAEGVASALLAAIAMVLVSCISAFGL  180

Query  133  FRLYGDNKSK  104
            FRLYG NK +
Sbjct  181  FRLYGANKDR  190



>ref|XP_009414753.1| PREDICTED: CASP-like protein 2B1 [Musa acuminata subsp. malaccensis]
Length=202

 Score =   222 bits (566),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 117/196 (60%), Positives = 157/196 (80%), Gaps = 1/196 (1%)
 Frame = -3

Query  679  VGVSPGNVPVYHGS-NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRK  503
            VGVSPG VPVY+G   L  V++R+++AE++ RC+ C   ++ AVL+G D+QVRE FS+ K
Sbjct  5    VGVSPGTVPVYYGGGKLMAVERRMKVAEVVLRCLSCAFGVIAAVLVGSDTQVREFFSVEK  64

Query  502  KAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayl  323
            KAKFTDMKALVFLV+ANG+AA YSL+ +VR  VSM++GSVLFNK LAWAIFS DQ++AYL
Sbjct  65   KAKFTDMKALVFLVVANGIAAGYSLLMVVRSVVSMMKGSVLFNKALAWAIFSCDQVVAYL  124

Query  322  slgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISA  143
            +L AV+AAAQ+A  ++ GQ+ELQWM++CN+Y KFCNQ G G+ S+ +  + M+ +  +SA
Sbjct  125  TLAAVSAAAQAAELSQFGQTELQWMKVCNLYHKFCNQSGGGMVSAFLGSLCMVAVSSMSA  184

Query  142  FSLFRLYGDNKSKCNG  95
            F+LFRLYG NK K +G
Sbjct  185  FNLFRLYGKNKGKRSG  200



>ref|XP_006849031.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
 gb|ERN10612.1| hypothetical protein AMTR_s00028p00153320 [Amborella trichopoda]
Length=198

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 163/195 (84%), Gaps = 0/195 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MS +GVG+SPG+VPVYH S L+VVD+RVR+AE++ RCVI GL ++ AVL+G D+Q R+IF
Sbjct  1    MSGVGVGMSPGSVPVYHSSKLRVVDRRVRVAEVVLRCVISGLGLLAAVLVGTDTQTRQIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+KKAKFTDMKAL+FLVI NG+ A+YSLVQ +RC+VSM++GSVLFNK LAWAIFS DQ+
Sbjct  61   SIQKKAKFTDMKALMFLVIINGIVASYSLVQGLRCAVSMLKGSVLFNKSLAWAIFSCDQV  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY SL A AAA QSA  A+ GQ ++QWM+ICN YGKFC QVG+GI S+ +V +SM+ L 
Sbjct  121  MAYASLAAAAAATQSAAIAEKGQQDVQWMKICNFYGKFCTQVGDGIVSAFVVSLSMVTLS  180

Query  154  GISAFSLFRLYGDNK  110
            G+SAF+LFRLY   K
Sbjct  181  GLSAFNLFRLYNKGK  195



>ref|XP_009141516.1| PREDICTED: CASP-like protein 1 [Brassica rapa]
Length=184

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K+ +++VRL ELI RC++C LA+V A+LI  D+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVAAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGDQ +AYL++  +AAAAQSA +AK
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQAIAYLTVAGLAAAAQSAAFAK  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
            +GQ ELQWM+IC MYG+FCNQVGEGI  +L+  + M+++  ISA  LFRLYG NK+
Sbjct  121  LGQPELQWMKICTMYGRFCNQVGEGIGVALLASVGMVLISCISALGLFRLYGGNKA  176



>emb|CDY71930.1| BnaCnng75140D [Brassica napus]
Length=185

 Score =   219 bits (557),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K+ +++VRLAELI RC++C LA+V AVLI  D+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKLNERKVRLAELILRCLVCALALVAAVLIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavyA  278
            NG+AAAYSLV  VRC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGMAAAYSLVHAVRCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
            K+GQ ELQWM+IC MYGKFCNQVGEGI  +L+  + M+++  ISA  +FRLYG NK+
Sbjct  121  KLGQPELQWMKICTMYGKFCNQVGEGIGVALLASVGMVLISCISALGVFRLYGGNKA  177



>emb|CDY40441.1| BnaA04g20760D [Brassica napus]
Length=185

 Score =   216 bits (549),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K+ +++VRL ELI RC++C LA+V A+LI  D+QVREIF+I+KKAK+TDMKALVFLV+ 
Sbjct  1    MKINERKVRLTELILRCLVCALALVSAILIVTDTQVREIFTIQKKAKYTDMKALVFLVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGD-QLMaylslgavaaaaqsavyA  278
            NG+AAAYSLV + RC V M++GSVLF+KPLAWAIFSGD Q +AYL++  +AAAAQSA +A
Sbjct  61   NGIAAAYSLVHVARCVVGMMKGSVLFSKPLAWAIFSGDQQAIAYLTVAGLAAAAQSAAFA  120

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
            K+GQ ELQWM+IC MYG+FCNQVGEGI  +L+  + M+++  ISA  LFRLYG NK+
Sbjct  121  KLGQPELQWMKICTMYGRFCNQVGEGIGVALLASVGMVLISCISALGLFRLYGGNKA  177



>ref|XP_007147633.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
 gb|ESW19627.1| hypothetical protein PHAVU_006G141200g [Phaseolus vulgaris]
Length=179

 Score =   215 bits (547),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  622  DKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  443
            D+R+R+ EL+ RCVI GL ++ AVL+G DSQV+E FSI+K AKFTDMKALVFLV+ANGLA
Sbjct  3    DRRIRITELVLRCVILGLGVLAAVLVGTDSQVKEFFSIQKTAKFTDMKALVFLVVANGLA  62

Query  442  AAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  263
            A +SL+Q + C + ++RG  L +KPLAW IFSGDQ+MAY+++ AVAAA QS + AK+GQ 
Sbjct  63   AGFSLLQGLHCIICVVRGRTLLSKPLAWVIFSGDQVMAYVTVAAVAAAGQSGMLAKVGQP  122

Query  262  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            ELQWM +CNMYGKFCNQVGEGIAS+  V +SM++L  ISAFSLFRLYG N+ K
Sbjct  123  ELQWMELCNMYGKFCNQVGEGIASAFGVSLSMVVLSCISAFSLFRLYGGNRMK  175



>ref|XP_009124526.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=204

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 151/199 (76%), Gaps = 0/199 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLG+G+SPGNV  YHG  +K++D+R+RL E++ RC +   A++  +L+  D+QV+ IF
Sbjct  1    MSYLGIGISPGNVASYHGGKMKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
             + K+AK+TDMK+LVFLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ 
Sbjct  61   VVEKRAKYTDMKSLVFLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ A+AAA++S V    G+ +LQWM++CNMY KFC Q    +AS+ I  I+M+ + 
Sbjct  121  MAYMSVAAIAAASESGVIGIRGEEKLQWMKVCNMYSKFCYQGAGVVASASIASIAMVFVS  180

Query  154  GISAFSLFRLYGDNKSKCN  98
             ISAFSLFRLYG  + + N
Sbjct  181  CISAFSLFRLYGATQRRLN  199



>emb|CDX90524.1| BnaA03g42570D [Brassica napus]
Length=208

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 143/193 (74%), Gaps = 1/193 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY GVG SPGNV V HG  +K++D++++L EL+ RC    LA++  +LI  ++QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRKLKLTELLLRCSATALALLALILIVTNTQVKQIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I K+AK+TDMKALVFLV+ANG+AAAYSL+Q VRC V  ++GSVLFNKPLAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGIAAAYSLLQSVRCVVGSMKGSVLFNKPLAWAIFLSDQQ  120

Query  334  MaylslgavaaaaqsavyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
                   A  AA+  +    I G+ ELQWM++CNM+GKFCN+   G AS+L+  ++M+ +
Sbjct  121  AVAYMSVAAIAASAESGLIGIRGEDELQWMKVCNMFGKFCNRAAGGTASALLASVAMVFV  180

Query  157  CGISAFSLFRLYG  119
              ISAFSLFRLYG
Sbjct  181  SSISAFSLFRLYG  193



>ref|XP_009136766.1| PREDICTED: CASP-like protein ARALYDRAFT_915107 [Brassica rapa]
Length=207

 Score =   210 bits (535),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 151/192 (79%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY GVG SPGNV V HG  +K++D+R++L EL+ RC    LA++  +LI  ++QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRRLKLTELLLRCSATALALLALILIVTNTQVKQIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I K+AK+TDMKALVFLV+ANG+AAAYSL+Q VRC V  ++GSVLFNK LAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGIAAAYSLLQSVRCVVGSVKGSVLFNKSLAWAIFLSDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            +AY+S+ A+AA+A+S +    G+ ELQWM++CNM+GKFCN+   G AS+++  ++M+ + 
Sbjct  121  VAYMSVAAIAASAESGLIGIRGEDELQWMKVCNMFGKFCNRAAGGTASAVLASVAMVFVS  180

Query  154  GISAFSLFRLYG  119
             ISAFSLFRLYG
Sbjct  181  SISAFSLFRLYG  192



>emb|CDY34471.1| BnaC01g21620D [Brassica napus]
Length=206

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 150/198 (76%), Gaps = 1/198 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG+SPGNV VYHG  +KVVD+R+RL EL+ RC +  LA +G +LI  D+QV++IF
Sbjct  1    MSYLGVGISPGNVAVYHGGKMKVVDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKKIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++GSVLF+K LAWAIFSGDQ 
Sbjct  61   TIEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGSVLFSKSLAWAIFSGDQQ  120

Query  334  MaylslgavaaaaqsavyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
                   A  AAA  +    I G+ ELQWM++CNM+GKFCN+   G+AS+++  ++M+++
Sbjct  121  AMAYMSVAAIAAASESGVIGIRGEEELQWMKVCNMFGKFCNRGAGGVASAMLASLAMVLV  180

Query  157  CGISAFSLFRLYGDNKSK  104
              ISAFSLFRLYG    +
Sbjct  181  SCISAFSLFRLYGATTQR  198



>ref|XP_009145991.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein ARALYDRAFT_915107 
[Brassica rapa]
Length=203

 Score =   208 bits (530),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 156/192 (81%), Gaps = 0/192 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG+SPGNV VYHG  +K++D+R+RL EL+ RC +  LA +G +LI  D+QV++IF
Sbjct  1    MSYLGVGISPGNVAVYHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            ++ K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ 
Sbjct  61   TVEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ A+AAA++S V    G+ ELQWM++CNM+GKFCN+   G+AS+++  ++M+++ 
Sbjct  121  MAYMSVAAIAAASESGVIGIRGEEELQWMKVCNMFGKFCNRGAGGVASAMLASVAMVLVS  180

Query  154  GISAFSLFRLYG  119
             ISAFSLFRLYG
Sbjct  181  CISAFSLFRLYG  192



>ref|XP_010647129.1| PREDICTED: CASP-like protein 2B1 [Vitis vinifera]
Length=189

 Score =   205 bits (522),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLGVGVSPGNVPVYHG+NLKVVD+RVRLAEL+ RCVICGL I+ AVL+G D+QV+ IF
Sbjct  1    MNYLGVGVSPGNVPVYHGTNLKVVDRRVRLAELVLRCVICGLGILAAVLVGTDTQVKVIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I+KKAKFTDMKALVFLVIANG+AAAYSL+Q +RC VSM+RGSVLF+KPLAWAIFSGDQL
Sbjct  61   TIQKKAKFTDMKALVFLVIANGIAAAYSLIQGLRCVVSMVRGSVLFSKPLAWAIFSGDQL  120



>emb|CDY32244.1| BnaA01g17400D [Brassica napus]
Length=205

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 155/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG+SP NV VYHG  +K++D+R+RL EL+ RC +  LA +G +LI  D+QV++IF
Sbjct  1    MSYLGVGISPRNVAVYHGGKMKLIDRRLRLTELLLRCSVTALAFLGLILIVTDTQVKQIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I K+AK+T+MK+LVFLV+ANG+AA YSL+Q VRC +  ++G VL NK LAWAIFSGDQ 
Sbjct  61   TIEKRAKYTNMKSLVFLVVANGIAAVYSLLQSVRCVMGSMKGDVLLNKSLAWAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+S+ A+AAA++S V    G  ELQWM++CNM+GKFCN+   G+AS+++  ++M+++ 
Sbjct  121  MAYMSVAAIAAASESGVIGIRGDEELQWMKVCNMFGKFCNRGAGGVASAMLASVAMVLVS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG    +
Sbjct  181  CISAFSLFRLYGATTQR  197



>ref|XP_006414349.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
 gb|ESQ55802.1| hypothetical protein EUTSA_v10026264mg [Eutrema salsugineum]
Length=205

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVG++PGNV VYHG  +K++D+R+RL EL+ RC +    ++  +L+  D+QV+ IF
Sbjct  1    MSYLGVGITPGNVAVYHGGKMKLIDRRLRLTELLLRCSVTVFTLLALILVVTDTQVKHIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I ++AK+TDMKALVFLV+ANG+AA YSL+  VRC V  ++GSVLF+KPLAWAIFSGDQ 
Sbjct  61   TIERRAKYTDMKALVFLVVANGIAAVYSLLHSVRCLVGSMKGSVLFSKPLAWAIFSGDQA  120

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY+ + A+AAAA+S +  + G+ +LQWM++CNMYGKFC+ +  G+A +L+  I+M+ + 
Sbjct  121  MAYMCVAAIAAAAESGLIGREGEEKLQWMKLCNMYGKFCDWMSVGVAIALLASIAMVFVS  180

Query  154  GISAFSLFRLYGDNKSK  104
             ISAFSLFRLYG    +
Sbjct  181  CISAFSLFRLYGGATQR  197



>emb|CDY09694.1| BnaC07g33670D [Brassica napus]
Length=206

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/193 (54%), Positives = 140/193 (73%), Gaps = 1/193 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY GVG SPGNV V HG  +K++D++++L E++ RC    LA++  +LI  D+QV++IF
Sbjct  1    MSYSGVGSSPGNVAVSHGGKMKLIDRKLKLTEVLLRCSATALALLALILIVTDTQVKKIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +I K+AK+TDMKALVFLV+ANG+ AAYSL+Q VRC V  ++GSVL NK LAWAIF  DQ 
Sbjct  61   TIEKRAKYTDMKALVFLVVANGITAAYSLLQSVRCVVGSMKGSVLLNKSLAWAIFLSDQQ  120

Query  334  MaylslgavaaaaqsavyAKI-GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
                   A  AA+  +    I G+ +LQWM++CNM+GKFCN+   G AS+L+  I+M+ +
Sbjct  121  AMAYMSVAAIAASAESGLIGIRGEEKLQWMKVCNMFGKFCNRAAGGTASALLASIAMVFV  180

Query  157  CGISAFSLFRLYG  119
              ISAFSLFRLYG
Sbjct  181  SSISAFSLFRLYG  193



>gb|KJB67397.1| hypothetical protein B456_010G188700 [Gossypium raimondii]
Length=132

 Score =   199 bits (507),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYLGVGVSPGNVPVYHG+NLKV+D+RVR+AEL+ RC+ICGL+++ AVL+G D+Q++EIF
Sbjct  1    MSYLGVGVSPGNVPVYHGTNLKVIDRRVRVAELVLRCLICGLSVLAAVLVGTDTQIKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  338
            +I+KKA+FTDMKALVFLV ANG+ AAYSLVQ VRC V M+RGSVLF+KPLA+AIFSGDQ
Sbjct  61   TIQKKARFTDMKALVFLVAANGITAAYSLVQGVRCVVGMVRGSVLFSKPLAFAIFSGDQ  119



>ref|XP_010509564.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D++VR+AELI RC +  LA++ A+LI  D QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V +++G+VL +KPLAWAIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
            +G+ ELQWM++C+MYGKFCNQVGEGIAS+L  CI M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGEPELQWMKVCDMYGKFCNQVGEGIASALFACIGMVLVSCISAFGVFRLYGGSKTRLSS  180

Query  94   R  92
            R
Sbjct  181  R  181



>ref|XP_002868133.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7M9V1.1|CSPL7_ARALL RecName: Full=CASP-like protein 2B1; Short=AlCASPL2B1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH44392.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=182

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D+R+RL EL+ RC I   A++  +L+  D++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGRVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             G+ +LQWMR+CNMYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  + +
Sbjct  121  EGEEDLQWMRVCNMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATRDR  177



>ref|NP_567497.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L9B5.1|CSPLP_ARATH RecName: Full=CASP-like protein 2B1; Short=AtCASPL2B1 [Arabidopsis 
thaliana]
 gb|AAM66067.1| unknown [Arabidopsis thaliana]
 gb|AAO41974.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04067.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83749.1| uncharacterized protein AT4G16442 [Arabidopsis thaliana]
Length=182

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D+R+RL EL+ RC I   A++  +L+  D++V+ IF+I+K AK+TDMKA+VFLV+A
Sbjct  1    MKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIKKTAKYTDMKAVVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAYL++ A+AA A+S V A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAYLNVAAIAATAESGVIAR  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             G+ +LQWMR+C MYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  K +
Sbjct  121  EGEEDLQWMRVCTMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATKDR  177



>ref|XP_010505095.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   196 bits (497),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D++VR+AELI RC +  LA++ A+LI  D QV+EIF I+K+AKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRVAELILRCSVFALALLAAILIVTDVQVKEIFMIKKEAKFTNMKALVFMVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V +++G+VL +KPLAW IFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVGLMKGNVLLSKPLAWTIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
            +G  ELQWM++C+MYGKFCNQVGEGIASSL  C+ M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGVPELQWMKVCDMYGKFCNQVGEGIASSLFACVGMVLVSCISAFGVFRLYGGSKTRQSS  180

Query  94   R  92
            R
Sbjct  181  R  181



>ref|XP_008384166.1| PREDICTED: CASP-like protein GSVIVT00013502001 isoform X2 [Malus 
domestica]
Length=161

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYL VGVSPGNVPVYH +NLKV D+R+R+AEL+ RC+ICGL +V A L+G D+QV+EIF
Sbjct  1    MSYLAVGVSPGNVPVYHSTNLKVNDRRLRVAELVLRCLICGLGVVAAALVGTDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +++KKAKFTDMKALVFLV+ANG+ +AYSLVQ+VRC VSM+RG+VLF+KP+AW IFSGDQ+
Sbjct  61   TVQKKAKFTDMKALVFLVVANGIVSAYSLVQVVRCVVSMVRGNVLFSKPIAWIIFSGDQI  120



>ref|XP_009374906.1| PREDICTED: LOW QUALITY PROTEIN: CASP-like protein RCOM_0864260 
[Pyrus x bretschneideri]
Length=168

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSYL VG SPGNVPVYH +NLKV D++VR+AEL+ RC+ICGL +V A L+G D++V+EIF
Sbjct  1    MSYLAVGASPGNVPVYHSTNLKVNDRKVRVAELVLRCLICGLGVVAAALVGTDTEVKEIF  60

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            +++KK KF DMKALVFLV+ANG+ AA SLVQ++RC VSM+RG+VL +   +  I   + +
Sbjct  61   TVQKKXKFIDMKALVFLVVANGMVAACSLVQVIRCVVSMVRGNVLGS--FSLGIRQSESV  118

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIAS  191
            M  + + AV AAAQSAV AK+GQ ELQWM+ICNMY +FCNQVGE + +
Sbjct  119  MVCVCVAAVGAAAQSAVLAKLGQPELQWMKICNMYDEFCNQVGEELPA  166



>ref|XP_010516779.1| PREDICTED: CASP-like protein 2B2 [Camelina sativa]
Length=182

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D++VR AELI RC +  LA++ A+LI  D QV+EIF I+KKAKFT+MKALVF+V+ 
Sbjct  1    MKLIDRKVRAAELILRCSVFALALLAAILIVTDVQVKEIFMIKKKAKFTNMKALVFMVVV  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V +++G+VL +KPLA AIFSGDQ++AYL +   AAAAQSA +AK
Sbjct  61   NGIAAGYSLLQAVRCVVCLMKGNVLLSKPLAGAIFSGDQVVAYLCVAGTAAAAQSAAFAK  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
            +G+ ELQWM++C+MYGKFCNQVGEGIAS+L  C+ M+++  ISAF +FRLYG +K++ + 
Sbjct  121  LGEPELQWMKVCDMYGKFCNQVGEGIASALFACVGMVLVSCISAFGVFRLYGGSKTRQSS  180

Query  94   R  92
            R
Sbjct  181  R  181



>ref|XP_010917254.1| PREDICTED: CASP-like protein 2B1 [Elaeis guineensis]
Length=196

 Score =   189 bits (481),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 143/190 (75%), Gaps = 1/190 (1%)
 Frame = -3

Query  676  GVSPGNVPVYH-GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKK  500
            GV P NVPV+H       ++ R+R+ E+  RCV+CGLA++ A L+G D+QV++I  + +K
Sbjct  6    GVCPWNVPVHHRNGRWNALEGRLRVGEVALRCVVCGLAVLVAALVGTDTQVKKIVFVERK  65

Query  499  AKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMayls  320
            AKFTDMKA VFLVI NG+AA YSL+Q +RC V++IRG+VL NKP+AW IFS DQ+MAY+S
Sbjct  66   AKFTDMKASVFLVIFNGIAACYSLIQGLRCVVTLIRGNVLLNKPVAWLIFSCDQVMAYVS  125

Query  319  lgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAF  140
            + AVAA  QS + A+ GQ ELQWM++C+MY  FC + G G+  + +V   ++IL  ISAF
Sbjct  126  VAAVAATTQSGLLAEFGQPELQWMKLCDMYRGFCIKAGCGLMIAFVVTCCILILSCISAF  185

Query  139  SLFRLYGDNK  110
            +LFRLYG+NK
Sbjct  186  NLFRLYGNNK  195



>gb|ACU18779.1| unknown [Glycine max]
Length=131

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -3

Query  691  SYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS  512
            SYLGVGVSPGNVPVYH +N+ V+D+R+++ EL+ RCVI GL ++ AVL+G DSQV+E FS
Sbjct  3    SYLGVGVSPGNVPVYHSTNVNVLDRRIKITELVLRCVILGLGVLAAVLVGTDSQVKEFFS  62

Query  511  IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  338
             +K+AKFTDMK+LVFLV+ANGLA+ YSL+Q +RC +SMIRG VLF+KPLAWAIFSGDQ
Sbjct  63   FQKEAKFTDMKSLVFLVVANGLASGYSLIQGLRCIISMIRGRVLFSKPLAWAIFSGDQ  120



>emb|CDY70521.1| BnaCnng68730D, partial [Brassica napus]
Length=189

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/184 (55%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = -3

Query  649  YHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALV  470
            YHG  +K++D+R+RL E++ RC +   A++  +L+  D+QV+ IF + K+AK+TDMK+LV
Sbjct  1    YHGGKIKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLV  60

Query  469  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  290
            FLV+ANG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFSGDQ MAY+S+ A+AAAA+S
Sbjct  61   FLVVANGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSGDQAMAYMSVAAIAAAAES  120

Query  289  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             V    G+ +LQWM++CNMY KFCNQ    +AS+ I  I+M+I+  ISAFSLFRLYG  +
Sbjct  121  GVIGIRGEEKLQWMKVCNMYSKFCNQGAAVVASASIASIAMVIVSCISAFSLFRLYGATQ  180

Query  109  SKCN  98
             + N
Sbjct  181  RRLN  184



>ref|XP_008791870.1| PREDICTED: CASP-like protein RCOM_0864260 [Phoenix dactylifera]
Length=188

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 2/187 (1%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKF  491
            +P NVPV  G   K V++++R+ E+  RCVICGLA++ A L+G D+Q R I  + +KAKF
Sbjct  3    NPWNVPV--GGRWKAVERKLRVGEVALRCVICGLAVLVAALVGTDTQTRRIVYLERKAKF  60

Query  490  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  311
            TDMKA VFLVI NG+AA YSL+Q +RC V++ +GSVL NKP AW IF  DQ+MAY+S+ A
Sbjct  61   TDMKASVFLVIFNGIAACYSLIQGLRCIVNVTKGSVLLNKPFAWLIFLCDQVMAYVSVAA  120

Query  310  vaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            VAA+AQS + A+ GQ ELQWM++C++Y  FC + G G+A + +V   ++IL  ISAF+LF
Sbjct  121  VAASAQSGLLAQFGQPELQWMKLCDLYRGFCIKAGCGLAIAFVVTSCILILSCISAFNLF  180

Query  130  RLYGDNK  110
            RLYG+NK
Sbjct  181  RLYGNNK  187



>emb|CDY71889.1| BnaAnng39180D [Brassica napus]
Length=184

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D+R+RL E++ RC +   A++  +L+  D+QV+ IF + K+AK+TDMK+LVFLV+A
Sbjct  1    MKLIDQRLRLTEVLLRCSVSVFALLALILMVTDTQVKRIFVVEKRAKYTDMKSLVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AAAYS +Q VRC    ++GSVLF+KPLAWAIFS DQ MAY+S+ A+AAA++S V   
Sbjct  61   NGIAAAYSSLQSVRCVAGSMKGSVLFSKPLAWAIFSVDQAMAYMSVAAIAAASESGVIGI  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  98
             G+ +LQWM++CNMY KFC Q    +AS+ I  I+M+ +  ISAFSLFRLYG  + + N
Sbjct  121  RGEEKLQWMKVCNMYSKFCYQGAGVVASASIASIAMVFVSCISAFSLFRLYGATQRRLN  179



>ref|XP_010440155.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   174 bits (442),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D+R+RL EL+ R  I  LA++G +LI  DS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFSGDQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSGDQVMAYLSVAAIAATAESGMIAR  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             G+ +LQW+++CNMYGKFCN++  G++S+L   I+M+ +  +SAFSLFRLYG  K +
Sbjct  121  EGEEDLQWIKVCNMYGKFCNRMAIGVSSALFASIAMVFVSCMSAFSLFRLYGATKDR  177



>ref|XP_010434824.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   174 bits (440),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 142/177 (80%), Gaps = 0/177 (0%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K++D+R+RL EL+ R  I  LA++G +LI  DS+V+ IF+I+K AK++DMK++VFLV+A
Sbjct  1    MKLIDRRLRLTELLLRISISVLALLGLILIVTDSEVKLIFTIKKTAKYSDMKSVVFLVVA  60

Query  454  NGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            NG+AA YSL+Q VRC V  ++G+VLF+KPLAW IFS DQ+MAYLS+ A+AA A+S + A+
Sbjct  61   NGIAAVYSLLQSVRCVVGTMKGTVLFSKPLAWTIFSADQVMAYLSVAAIAATAESGMIAR  120

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             G+ +LQW+++CNMYGKFCN++  G++S+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  121  EGEEDLQWIKVCNMYGKFCNRMAIGVSSALFASIAMVFVSCISAFSLFRLYGATKDR  177



>ref|XP_010449792.1| PREDICTED: CASP-like protein 2B1 [Camelina sativa]
Length=182

 Score =   173 bits (439),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -3

Query  571  LAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  392
            L+++  +LI  DS+V+ IF+I+KKAK++DMK++VFLV+ANG+AA YSL+Q VRC V  ++
Sbjct  22   LSLLALILIVTDSEVKLIFTIKKKAKYSDMKSVVFLVVANGIAAVYSLLQSVRCVVGTMK  81

Query  391  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQ  212
            G+VLF+KPLAW IFSGDQ MAYLS+ A+AA A+S + A+ G+ +LQW+++CNMYGKFCN+
Sbjct  82   GTVLFSKPLAWTIFSGDQAMAYLSVAAIAATAESGMIAREGEEDLQWIKVCNMYGKFCNR  141

Query  211  VGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            +  G++S+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  142  MAIGVSSALFASIAMVFVSCISAFSLFRLYGATKDR  177



>sp|B8LQF9.1|CSPL9_PICSI RecName: Full=CASP-like protein 2BC2; Short=PsCASPL2BC2 [Picea 
sitchensis]
 gb|ABR17889.1| unknown [Picea sitchensis]
Length=238

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 128/171 (75%), Gaps = 0/171 (0%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V+KR+++ E+I R  +  LA+V AV +G D+Q R IF+I KKAK++DMKALVFLV+ NG+
Sbjct  63   VEKRLKIGEVILRFAMIALALVAAVRVGTDTQTRTIFTIEKKAKYSDMKALVFLVVMNGI  122

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A+YSL+Q +RC +S+   S L +KPLAW IF+ DQ MAY SL A AAAA+SA  A+ GQ
Sbjct  123  VASYSLLQGLRCVLSIYTQSPLTSKPLAWLIFALDQTMAYFSLAAAAAAAESAYLAERGQ  182

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
            +E QWM++C  Y KFC+Q+GEG+ S+ +V +SM  + G+SA+ LFRLYG  
Sbjct  183  TEFQWMKVCIFYEKFCHQIGEGLVSTFLVSLSMATVSGMSAYHLFRLYGSK  233



>ref|XP_006284611.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
 gb|EOA17509.1| hypothetical protein CARUB_v10005842mg [Capsella rubella]
Length=182

 Score =   171 bits (432),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = -3

Query  571  LAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  392
            L+++  +LI  DS+V+ IF+I+K AK+TDMK++VFLV+ANG+A  YSL+Q VRC V  ++
Sbjct  22   LSLLALILIVTDSEVKLIFTIKKAAKYTDMKSVVFLVVANGIATVYSLLQSVRCVVGKMK  81

Query  391  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQ  212
            G+VLF+KPLAW IFSGDQ +AYLS+ A+A  A+S + A+ G+ +LQW+++CNMYGKFCN+
Sbjct  82   GTVLFSKPLAWTIFSGDQALAYLSVAAIATTAESGMIAREGEEDLQWIKVCNMYGKFCNR  141

Query  211  VGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            +  G+AS+L   I+M+ +  ISAFSLFRLYG  K +
Sbjct  142  MTVGVASALFASIAMVFISCISAFSLFRLYGATKDR  177



>ref|XP_003558594.1| PREDICTED: CASP-like protein 2U2 [Brachypodium distachyon]
Length=209

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/194 (52%), Positives = 142/194 (73%), Gaps = 4/194 (2%)
 Frame = -3

Query  673  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            VSPGNVPV Y+G   +V   +++RVR AE+  RC  CGLA++ A L+G D Q R  FSI+
Sbjct  15   VSPGNVPVCYYGPGGRVSASLERRVRAAEVFLRCAACGLAVLAAALLGADRQSRTFFSIQ  74

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            K A++TDM++LV LVIA+G+ A YSL+Q  RC +S++RG +L ++PLAWAIFS DQ+MAY
Sbjct  75   KVARYTDMQSLVILVIASGMVACYSLIQGARCLLSIVRGGILLSRPLAWAIFSCDQVMAY  134

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGIS  146
            + +GAVA A ++A+  K GQ E QWM+ C++Y +FC Q G G+A ++    SM+ +  +S
Sbjct  135  IIIGAVAVAMEAALIGKYGQVEFQWMKTCHLYQRFCTQAGGGVACAIAASASMVGISLLS  194

Query  145  AFSLFRLYGDNKSK  104
            AF+LFRLYG+ K +
Sbjct  195  AFNLFRLYGEGKGR  208



>gb|EMT22476.1| hypothetical protein F775_11012 [Aegilops tauschii]
Length=306

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
             ++++++ EL+ RC++ G   V A L+  DSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  67   AERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  126

Query  445  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            A  YSL+Q  RC+V+M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  127  AVGYSLLQAARCAVAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  186

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
            +GQ ELQWM IC +YG FC QVG GIA +++  ++ ++L   SAF+LFRLYG NK   + 
Sbjct  187  LGQPELQWMGICGLYGAFCRQVGAGIACAVVAGLAAVLLASFSAFNLFRLYGGNKGSSST  246

Query  94   R  92
            R
Sbjct  247  R  247



>dbj|BAK05801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 141/195 (72%), Gaps = 4/195 (2%)
 Frame = -3

Query  682  GVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            G GVSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  F
Sbjct  8    GDGVSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFF  67

Query  514  SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQL  335
            SI+K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+
Sbjct  68   SIQKVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQV  127

Query  334  MaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILC  155
            MAY  +GAVA A ++A+  K G+ E QWM+ C +Y +FC Q G G+A ++    SM+ + 
Sbjct  128  MAYEIIGAVAVAMEAALLGKTGEVEFQWMKTCELYQRFCTQAGGGVACAVAASASMVGIA  187

Query  154  GISAFSLFRLYGDNK  110
             +SAF+LFRLYG  K
Sbjct  188  LVSAFNLFRLYGHGK  202



>ref|XP_004985347.1| PREDICTED: CASP-like protein Sb01g044070-like [Setaria italica]
Length=208

 Score =   164 bits (416),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/195 (51%), Positives = 142/195 (73%), Gaps = 4/195 (2%)
 Frame = -3

Query  676  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI  509
            GVSPGNVPV Y+G   +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+
Sbjct  13   GVSPGNVPVCYYGPAGRVPAALERRVRAAELFLRCATCGLAVLAAALLGADRQTRIFFSM  72

Query  508  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMa  329
             K+A+++DM++LVFLVIANG+AA YSL+Q  RC VS++ G VL +KP+AWAIFS DQ+MA
Sbjct  73   EKEARYSDMQSLVFLVIANGMAACYSLLQGARCMVSILTGGVLISKPMAWAIFSCDQVMA  132

Query  328  ylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGI  149
            Y ++ AVA A ++A+  K G ++ QWM+ C++Y +FC Q G  +A ++   ++M+ +  +
Sbjct  133  YFTISAVAVAMEAAMIGKYGNTQFQWMKTCHLYKRFCAQAGGAVACAVAASLNMVGISLV  192

Query  148  SAFSLFRLYGDNKSK  104
            SAF+LFRLYG  K +
Sbjct  193  SAFNLFRLYGSGKGR  207



>emb|CAB10420.1| LET1 like protein [Arabidopsis thaliana]
 emb|CAB78686.1| LET1 like protein [Arabidopsis thaliana]
Length=578

 Score =   172 bits (435),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 127/167 (76%), Gaps = 4/167 (2%)
 Frame = -3

Query  685  LGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            LG  + PG     + S +K++D+R+RL EL+ RC I   A++  +L+  D++V+ IF+I+
Sbjct  111  LGAEICPGG----YRSKMKLIDRRMRLTELLLRCSISVFALLALILVVTDTEVKLIFTIK  166

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            K AK+TDMKA+VFLV+ANG+AA YSL+Q VRC V  ++G VLF+KPLAWA FSGDQ MAY
Sbjct  167  KTAKYTDMKAVVFLVVANGIAAVYSLLQSVRCVVGTMKGKVLFSKPLAWAFFSGDQAMAY  226

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSL  185
            L++ A+AA A+S V A+ G+ +LQWMR+C MYGKFCNQ+  G++S+ 
Sbjct  227  LNVAAIAATAESGVIAREGEEDLQWMRVCTMYGKFCNQMAIGVSSAF  273



>ref|XP_002468338.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
 sp|C5WUP3.1|CSPL4_SORBI RecName: Full=CASP-like protein 2U2; Short=SbCASPL2U2 [Sorghum 
bicolor]
 gb|EER95336.1| hypothetical protein SORBIDRAFT_01g044070 [Sorghum bicolor]
Length=208

 Score =   163 bits (412),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 140/195 (72%), Gaps = 4/195 (2%)
 Frame = -3

Query  676  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI  509
            GVSPGNVPV Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R IFS+
Sbjct  13   GVSPGNVPVCYYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTIFSV  72

Query  508  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMa  329
             K A+FTDM++LVFLVIANG+AA YSL+Q  RC VS++ G VL N+P+AWAIFS DQ+MA
Sbjct  73   EKTARFTDMQSLVFLVIANGMAACYSLLQGARCLVSILTGGVLINRPMAWAIFSCDQVMA  132

Query  328  ylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGI  149
            Y ++ AVA A ++A+  K G  + QWM  C+ Y +FC Q G  +A ++   ++M+ +  +
Sbjct  133  YFTITAVAVAMEAAMIGKYGSLQFQWMNTCHFYKRFCAQAGGAVACAVAASLNMVGISLV  192

Query  148  SAFSLFRLYGDNKSK  104
            SAF+LFRLYG  K +
Sbjct  193  SAFNLFRLYGSGKGR  207



>dbj|BAJ91438.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=206

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 140/192 (73%), Gaps = 4/192 (2%)
 Frame = -3

Query  673  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            VSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+
Sbjct  11   VSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQ  70

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMay  326
            K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+MAY
Sbjct  71   KVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVMAY  130

Query  325  lslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGIS  146
            + +GAVA A ++A+  K G+ E QWM+ C +Y +FC Q G G+A ++    SM+ +  +S
Sbjct  131  VIIGAVAVAMEAALLGKTGEVEFQWMKTCELYQRFCTQAGGGVACAVAASASMVGIALVS  190

Query  145  AFSLFRLYGDNK  110
            AF+LFRLYG  K
Sbjct  191  AFNLFRLYGHGK  202



>tpg|DAA43987.1| TPA: hypothetical protein ZEAMMB73_493857 [Zea mays]
Length=206

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 141/196 (72%), Gaps = 5/196 (3%)
 Frame = -3

Query  676  GVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI  509
            GVSPGNVPV Y+G+  +V   +++RVR AEL  RC  CGLA++ A L+G D Q R  FS+
Sbjct  10   GVSPGNVPVCYYGAAGRVPAALERRVRAAELFMRCAACGLAVLAAALLGADRQTRTFFSV  69

Query  508  RKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR-GSVLFNKPLAWAIFSGDQLM  332
             K A+FTDM++LVFLVIANG+AA YSL+Q  RC VS++  G VL N+P+AWAIFS DQ+M
Sbjct  70   EKAARFTDMQSLVFLVIANGMAACYSLLQGGRCLVSILTGGGVLINRPMAWAIFSCDQVM  129

Query  331  aylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCG  152
            AY ++ AVA A ++A+  K G  + QWM+ C++Y +FC Q G  +A ++   ++M+ +  
Sbjct  130  AYFTISAVAVAMEAAMIGKYGSQQFQWMKTCHLYKRFCAQAGGAVACAVAASLNMVGVSL  189

Query  151  ISAFSLFRLYGDNKSK  104
            +SAF+LFRLYG  K +
Sbjct  190  VSAFNLFRLYGSGKGR  205



>dbj|BAK05387.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=191

 Score =   157 bits (396),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 130/187 (70%), Gaps = 3/187 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            +++++++ EL+ RC++ G   V A L+  DSQ R  FS+ ++AK+TDMKALV LV ANG 
Sbjct  5    LERKMKVWELVLRCLVGGFGAVAAALVVTDSQTRTFFSLERRAKYTDMKALVLLVAANGA  64

Query  445  AAAYSLVQLVRCSVSMIRGS---VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            A  YSL+Q  RC+++M RG    V+ ++ LAW++FSGDQL+AY  L A AAA QS++  K
Sbjct  65   AVVYSLLQAARCAMAMARGGGALVMSSRALAWSVFSGDQLLAYAMLAATAAALQSSLLGK  124

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
            +GQ ELQWM IC++YG FC QVG GIA +++  ++ ++L   SAF+LFRLYG NK     
Sbjct  125  LGQPELQWMGICSLYGAFCKQVGAGIACAVVAGLAAVLLASFSAFNLFRLYGGNKGSSTT  184

Query  94   R*RKTIY  74
            R   T Y
Sbjct  185  RNGATWY  191



>sp|Q10QH3.2|CSPLL_ORYSJ RecName: Full=CASP-like protein Os03g0196400 [Oryza sativa Japonica 
Group]
 gb|EEC74684.1| hypothetical protein OsI_10377 [Oryza sativa Indica Group]
 gb|EEE58500.1| hypothetical protein OsJ_09768 [Oryza sativa Japonica Group]
Length=195

 Score =   130 bits (326),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 126/196 (64%), Gaps = 27/196 (14%)
 Frame = -3

Query  685  LGVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI  518
            +G GVSPGNVPV Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  
Sbjct  9    VGDGVSPGNVPVCYYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVF  68

Query  517  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQ  338
            FSI+K A++TDM++LV LVIANG+AA YSL+Q  RC V            +A+ + S   
Sbjct  69   FSIQKVARYTDMQSLVLLVIANGMAACYSLIQCARCLV------------MAYIVIS---  113

Query  337  LMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIIL  158
                    AVAAA ++A+  K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +
Sbjct  114  --------AVAAAMEAALIGKYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGV  165

Query  157  CGISAFSLFRLYGDNK  110
              ISAF+LFRLYG++ 
Sbjct  166  ALISAFNLFRLYGNSN  181



>ref|XP_007026315.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
 gb|EOY28937.1| CASP-like protein POPTRDRAFT_818956 isoform 2, partial [Theobroma 
cacao]
Length=209

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            M+YLGVGVSPGNVPVYH +NLKV+D+RVR+AEL+ RCVIC L+++ AVL+  D+QV+EIF
Sbjct  1    MNYLGVGVSPGNVPVYHATNLKVIDRRVRVAELVLRCVICVLSVLAAVLVATDTQVKEIF  60

Query  514  SIRKKAKFTDMKALVF  467
            SI+KKA+FTDMKALVF
Sbjct  61   SIQKKARFTDMKALVF  76



>ref|XP_003575478.2| PREDICTED: CASP-like protein 2B1 [Brachypodium distachyon]
Length=197

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = -3

Query  622  DKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  443
            +++ +L EL  RC+IC L  + A L+  DSQ R  FS+ KKA++TDMKALV LV ANG A
Sbjct  10   ERKAKLWELALRCLICLLGTLAAALVATDSQTRTFFSLEKKARYTDMKALVLLVAANGAA  69

Query  442  AAYSLVQLVRCSVSMIR--GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIG  269
            AAYSL+Q  RC+VS+ R       +K +AW++FSGDQL+AY +L A AAAAQ++   K G
Sbjct  70   AAYSLLQAFRCAVSIARGGSGSSSSKVVAWSVFSGDQLLAYATLAATAAAAQASAIGKKG  129

Query  268  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  125
            Q ELQWM IC++YG FC QVG GIA ++   ++ ++L  +SAF+LFRL
Sbjct  130  QPELQWMGICDLYGAFCRQVGGGIACAVGAGVAAVVLAPVSAFNLFRL  177



>ref|XP_002443261.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
 sp|C5YP66.1|CSPLJ_SORBI RecName: Full=CASP-like protein 2U1; Short=SbCASPL2U1 [Sorghum 
bicolor]
 gb|EES17099.1| hypothetical protein SORBIDRAFT_08g016550 [Sorghum bicolor]
Length=193

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
             +++V++AE+  R ++CGL  + A L+  D+Q R  FS++KKA +TDMKA+VFLV A  +
Sbjct  13   AERKVKVAEVALRALLCGLGALAAALVATDTQTRTFFSLQKKASYTDMKAMVFLVDAAAV  72

Query  445  AAAYSLVQL-VRCS-----VSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  284
            AA YSL+QL  RC       S         + L+W +FS DQ +AY+ L AVAAA Q++V
Sbjct  73   AAGYSLLQLAARCCGGGAMSSGRGDGGGRGRALSWCVFSCDQALAYVLLAAVAAALQASV  132

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             AK GQ ELQWM IC +YG FC Q G G+A++++  ++ ++L  +SAF+LFRLYG   +K
Sbjct  133  VAKRGQPELQWMGICALYGAFCRQAGAGLATAVVAGLAAVLLAFLSAFNLFRLYGSGGTK  192



>sp|D5A8E6.1|CSPL4_PICSI RecName: Full=CASP-like protein 2BC1; Short=PsCASPL2BC1 [Picea 
sitchensis]
 gb|ADE75815.1| unknown [Picea sitchensis]
Length=226

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 110/174 (63%), Gaps = 1/174 (1%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFS-IRKKAKFTDMKALVFLVIANG  449
             D+++R+ E+I R  +   A+V A+++G  S  R++   IR  A FT +K L FLVI +G
Sbjct  29   TDRKLRITEVILRFAVVIFALVSAIMVGTASGTRDLGGGIRIHAHFTLLKTLPFLVIVDG  88

Query  448  LAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIG  269
            + A YSL+Q +RC +S+    +L NK LAW IF  DQ +AY+   A A+ A++A  ++ G
Sbjct  89   ILAVYSLLQGLRCFLSLYMRHILLNKALAWTIFCCDQALAYVIFAAAASTAETAYISEQG  148

Query  268  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
              ELQW+++C  +  +C + G G+ ++ +  + M+ + G+S F LFRLYG+ ++
Sbjct  149  LDELQWIKVCMFFRAYCFKSGAGMINAFLAALCMVFVSGMSVFHLFRLYGEKRA  202



>ref|XP_004162507.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 2 
[Cucumis sativus]
Length=128

 Score =   115 bits (289),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = -3

Query  472  VFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaq  293
            +FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQ
Sbjct  1    MFLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQ  60

Query  292  savyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
            SAV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   
Sbjct  61   SAVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGG  120

Query  112  KSKCNGR  92
            K+K N R
Sbjct  121  KNKSNSR  127



>ref|XP_004162506.1| PREDICTED: CASP-like protein GSVIVT00013502001-like isoform 1 
[Cucumis sativus]
Length=132

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -3

Query  469  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  290
            FLV+AN +AAAYSLVQ +RC V M+RG VLF+KPLAW IFSGDQ+MAY+++ AVA+AAQS
Sbjct  6    FLVVANAVAAAYSLVQGLRCVVCMVRGKVLFSKPLAWIIFSGDQIMAYVTVAAVASAAQS  65

Query  289  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            AV+ K+GQ ELQWM+IC++Y KFCNQVGEG+AS+++V +SM++L  ISA SLFRLY   K
Sbjct  66   AVFGKLGQPELQWMKICDLYKKFCNQVGEGLASAVVVSLSMVVLSCISASSLFRLYNGGK  125

Query  109  SKCNGR  92
            +K N R
Sbjct  126  NKSNSR  131



>dbj|BAJ98184.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=155

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 90/118 (76%), Gaps = 4/118 (3%)
 Frame = -3

Query  673  VSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIR  506
            VSPGNVPV Y+G+  +V   +++RVR AE++ RC  C LA++ A L+G D Q R  FSI+
Sbjct  11   VSPGNVPVCYYGAGGRVSASLERRVRAAEVLLRCAACALAVLAAALLGADRQSRTFFSIQ  70

Query  505  KKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLM  332
            K A++TDM++LV LVIA+G+ A YSL+Q  RC VS++RG +L ++PLAWAIFS DQ+M
Sbjct  71   KVARYTDMQSLVILVIASGMVACYSLLQGARCLVSIVRGGILLSRPLAWAIFSCDQVM  128



>gb|EPS70050.1| hypothetical protein M569_04716, partial [Genlisea aurea]
Length=118

 Score =   113 bits (283),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -3

Query  469  FLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqs  290
            F+V  N L AAYS +QL R S    +GS + NKPLAW IFS DQ++AYL   AVAA+  S
Sbjct  1    FVVAVNVLGAAYSALQLARLS----KGSPVLNKPLAWTIFSSDQVLAYLMFSAVAASIPS  56

Query  289  avyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            AVYA+ G+ +LQWM+ CN+Y  FCN++GEG+  S++VC+SMI L G+S+F+LFRLY    
Sbjct  57   AVYAQYGEPQLQWMKTCNLYRNFCNRMGEGMVGSVVVCMSMIGLSGLSSFTLFRLYNGGA  116

Query  109  SK  104
             K
Sbjct  117  GK  118



>sp|Q0IN16.2|CSPLE_ORYSJ RecName: Full=CASP-like protein 2B1; Short=OsCASPL2B1 [Oryza 
sativa Japonica Group]
 gb|ABA99118.2| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=198

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++++ ++AE+  RC +C LA + A L+G  SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  445  AAAYSLVQLVRCSVSMIR--GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  272
            AA YSL+QL RC+ +     GS      +AW++FS DQ +AY  + A AAA QS+V  K 
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQAVAYALMAATAAALQSSVVGKR  126

Query  271  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            GQ ELQWM +C +YG FC +VGEG+A+++   ++ ++L  +SAF+LFRLY
Sbjct  127  GQPELQWMPVCGLYGAFCRRVGEGLAAAVAAGLAAVLLAAVSAFNLFRLY  176



>ref|XP_004163465.1| PREDICTED: CASP-like protein RCOM_0864260-like isoform 3 [Cucumis 
sativus]
Length=75

 Score =   111 bits (277),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIF  515
            MSY G+G+SPGNVPVYHGSNLKV DKRVR+ EL+ R +ICGL ++ AVL+G D++V+ IF
Sbjct  1    MSYAGIGISPGNVPVYHGSNLKVFDKRVRVVELVLRFLICGLGVLAAVLVGTDTEVKTIF  60

Query  514  SIRKKAKFTDMKALV  470
            +IRK+A FTDMKALV
Sbjct  61   TIRKRATFTDMKALV  75



>gb|ABF94455.1| plant integral membrane protein TIGR01569 containing protein, 
expressed [Oryza sativa Japonica Group]
Length=238

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 126/239 (53%), Gaps = 70/239 (29%)
 Frame = -3

Query  685  LGVGVSPGNVPV-YHGSNLKV---VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI  518
            +G GVSPGNVPV Y+G   +V   +++R R AE++ RC  CGLA++ A L+G D Q R  
Sbjct  9    VGDGVSPGNVPVCYYGPGGRVPSSLERRARAAEVLLRCAACGLAVLAAALLGADRQTRVF  68

Query  517  FSIRKKAKFTDMKALV-------------------------------------------F  467
            FSI+K A++TDM++LV                                            
Sbjct  69   FSIQKVARYTDMQSLVVNNGPSMQKYRGVFDGPKTSFYRKFLLRYFAYCDKIILLDIRRL  128

Query  466  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  287
            LVIANG+AA YSL+Q  RC V            +A+ + S           AVAAA ++A
Sbjct  129  LVIANGMAACYSLIQCARCLV------------MAYIVIS-----------AVAAAMEAA  165

Query  286  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +  K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +  ISAF+LFRLYG++ 
Sbjct  166  LIGKYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGVALISAFNLFRLYGNSN  224



>ref|XP_008777752.1| PREDICTED: CASP-like protein GSVIVT00013502001, partial [Phoenix 
dactylifera]
Length=71

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 58/69 (84%), Gaps = 0/69 (0%)
 Frame = -3

Query  556  AVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLF  377
            A L+G D+QVR+ FS+ KKAKFTDMKALVFLVI+NG+AA YSL+  VR  VSMI+ SVLF
Sbjct  3    AALVGSDTQVRKFFSLEKKAKFTDMKALVFLVISNGIAAGYSLIPGVRSVVSMIKESVLF  62

Query  376  NKPLAWAIF  350
            NK LAWAIF
Sbjct  63   NKALAWAIF  71



>gb|KDP36414.1| hypothetical protein JCGZ_08683 [Jatropha curcas]
Length=178

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = -3

Query  571  LAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  392
            L ++ ++LIG+DS+ + +  + KK    D+KAL+ LV  + +AAAY+L+QL RC  +  +
Sbjct  19   LLLMTSLLIGLDSETKSVVYMEKKVTCKDLKALLVLVYVDAVAAAYNLLQLSRCFKASYK  78

Query  391  GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQ  212
                + + +AW+ F  DQ++ Y++  A AAA + +V   +G +  QWM+ CN + +FC Q
Sbjct  79   SEASY-RSVAWSCFLLDQIVVYITFAATAAAIEHSVLVVVGANAFQWMKWCNRFTRFCFQ  137

Query  211  VGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +G  +  S+  C  M+ +  ISAF+LFRLY  N+
Sbjct  138  IGGSLFCSVTACALMVFISSISAFNLFRLYSPNQ  171



>ref|XP_006651131.1| PREDICTED: CASP-like protein Os03g0196400-like [Oryza brachyantha]
Length=209

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 109/185 (59%), Gaps = 26/185 (14%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKF  491
            +P N   +HG    V      +  ++ RC  CGLA++ A L+  D Q R  FSI+K A++
Sbjct  39   TPLNHTPFHG---PVRHFLAAVLVVLLRCAACGLAVLAAALLAADRQTRVFFSIQKVARY  95

Query  490  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  311
            TDM++LV LVIANG+AA YSL+Q  RC V            +A+ + S           A
Sbjct  96   TDMQSLVLLVIANGMAACYSLIQGARCLV------------MAYIVIS-----------A  132

Query  310  vaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            VAAA ++A+  K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +  +SAF+LF
Sbjct  133  VAAAMEAALIGKYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGVALLSAFNLF  192

Query  130  RLYGD  116
            RLYG+
Sbjct  193  RLYGN  197



>gb|KJB53802.1| hypothetical protein B456_009G006000 [Gossypium raimondii]
Length=177

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 95/173 (55%), Gaps = 3/173 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++  ++  E + R     + ++ A LIG+DSQ + IF ++KKA F D++ALV L+    L
Sbjct  1    MELSIQKTEALIRLSTIVMLVLTACLIGLDSQTKVIFYVQKKASFNDLRALVGLLYITSL  60

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsavyAKIG  269
            AAAY+L+QL  C  S  +G+ L +   LAW  +  DQ + Y       AA + +     G
Sbjct  61   AAAYNLLQL--CCSSFYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAAMEHSFLVLTG  118

Query  268  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +   QW++ CN Y +FC Q+G  +    +  + M  +  ISAF+LFRLY   K
Sbjct  119  EENFQWLKWCNKYTRFCTQIGGSLLCGFVAILLMFSIASISAFNLFRLYSPTK  171



>sp|B9IM09.2|CSPLG_POPTR RecName: Full=CASP-like protein 2C1; Short=PtCASPL2C1 [Populus 
trichocarpa]
Length=181

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 96/169 (57%), Gaps = 8/169 (5%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  422
            E I R +   L +  A L+G+DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVYVDAVAAAYNLLQ  68

Query  421  LVRCSVSMI-----RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            L RCSVS +     +GS    + L+WA F  DQL AY +  A +AA Q +V    G    
Sbjct  69   LCRCSVSALSKGNFKGSY---RYLSWACFVLDQLAAYTTFAAHSAALQHSVLGITGAKVF  125

Query  256  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            QWM+ CN + +FC Q+G  +    I  + M+++  ISAF+LFRLY    
Sbjct  126  QWMKWCNRFTRFCFQIGGALTCGYIASVLMVMISFISAFNLFRLYSPKH  174



>ref|NP_001159013.1| membrane protein [Zea mays]
 sp|B6TGJ8.1|CSPL8_MAIZE RecName: Full=CASP-like protein 2U1; Short=ZmCASPL2U1 [Zea mays]
 gb|ACG36231.1| membrane protein [Zea mays]
Length=190

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 115/179 (64%), Gaps = 10/179 (6%)
 Frame = -3

Query  622  DKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  443
            +++V +AE+  R V+CGL  + A L+  D+Q R  FS++KKA +TDMKA+V LV A   A
Sbjct  12   ERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAAA  71

Query  442  AAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsav  284
            A YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AV AA Q++V
Sbjct  72   AGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVVAALQASV  128

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
             AK G  +LQWM IC +YG FC Q G G+A ++   +   +L  +SAF+LFRLYG   +
Sbjct  129  VAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFRLYGAKAT  187



>ref|XP_007014187.1| CASP-like protein XL3 [Theobroma cacao]
 gb|EOY31806.1| CASP-like protein XL3 [Theobroma cacao]
Length=181

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 86/156 (55%), Gaps = 2/156 (1%)
 Frame = -3

Query  571  LAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR  392
            L ++ A L+G DSQ + IF + KKA F D++AL+ LV    LAAAY+LVQL   S S  R
Sbjct  19   LLVLTACLVGFDSQTKVIFYVEKKASFKDLRALIGLVYITSLAAAYNLVQLSCYSFSARR  78

Query  391  --GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
               S    K LAW  +  DQ   Y+      AA + A+    G+   QWM+ CN Y +FC
Sbjct  79   KGSSPQSYKYLAWLRYVLDQAAVYVVFAGNFAAFEHALLVVTGEQNFQWMKWCNKYTRFC  138

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             Q+G  +    +  + M+ +  ISAF+LFRLY   K
Sbjct  139  FQIGGSLLCGCVASLVMVFIASISAFNLFRLYSPKK  174



>ref|XP_008800283.1| PREDICTED: CASP-like protein Os06g0656300 [Phoenix dactylifera]
Length=170

 Score = 99.4 bits (246),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 95/162 (59%), Gaps = 2/162 (1%)
 Frame = -3

Query  604  AELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
            AE + R +   LA + AVLIG+D+Q + +F +R+KA   D++AL    I   +AA Y L+
Sbjct  9    AESLLRVLCLVLASMAAVLIGLDTQTKTVFFVRRKATVKDLEALWISTIITSIAAGYHLL  68

Query  424  QLVRC--SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
            Q  RC     + +     NK +AWA F  DQ + Y++ G + A  Q+++ A  G   LQW
Sbjct  69   QFCRCLAFAWLTKNPCWSNKFMAWASFLLDQGVTYVTFGGILAGMQASMIAVTGMRALQW  128

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  125
             ++CN+Y +FC+QV  G+   +   +SM ++  +SA+ LFRL
Sbjct  129  EKLCNIYARFCDQVAAGLVCGIAASLSMAVVSSVSAYHLFRL  170



>ref|XP_004962893.1| PREDICTED: CASP-like protein Sb08g016550-like [Setaria italica]
Length=200

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 121/178 (68%), Gaps = 4/178 (2%)
 Frame = -3

Query  628  VVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANG  449
            V +++V++AE+  R ++C L+ + A L+  DSQ R  FS +K+A F DMKA+V LV    
Sbjct  5    VAERKVKVAEVSLRALLCLLSALAAALVATDSQTRTFFSFQKRATFRDMKAMVLLVAVAA  64

Query  448  LAAAYSLVQLVRCSVSMIR----GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  281
             AA YSL+Q+ RC V+  +    G  L ++ LAW +FS DQ +AY  L AVAAA Q++V 
Sbjct  65   AAAGYSLLQVARCCVTAAQRAGGGGTLTSRALAWCVFSCDQALAYAVLAAVAAALQASVI  124

Query  280  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
            AK GQ ELQWM IC+MYG FC Q G GIAS++   ++ ++L  +SAF+LFRLYG NK+
Sbjct  125  AKRGQPELQWMGICSMYGAFCRQAGGGIASAVAAAVAAVLLAFLSAFNLFRLYGHNKT  182



>ref|XP_010913647.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Elaeis guineensis]
Length=168

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 96/161 (60%), Gaps = 2/161 (1%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  422
            E + R     LA + A+LIG+D+Q + +F +R+KA   D++AL    I   +AA Y L+Q
Sbjct  8    ESLLRVFCLVLASMAAILIGMDTQTKTVFFVRRKATVKDLEALWISTIITSVAAGYHLLQ  67

Query  421  LVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWM  248
              RC V   +++     NK +AWA F  DQ + Y++ G + AA Q++  A  G   LQW 
Sbjct  68   FCRCLVFAWLMKNPCWSNKFMAWASFLLDQGVTYVTFGGILAALQASTIAVTGIRALQWE  127

Query  247  RICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  125
            ++CN+Y +FC+Q+G G+   +   ++M ++  +SA+ LFRL
Sbjct  128  KLCNIYTRFCDQIGAGLICGIAASLAMAVVSSVSAYHLFRL  168



>emb|CDY68034.1| BnaCnng57380D [Brassica napus]
Length=139

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 66/99 (67%), Gaps = 1/99 (1%)
 Frame = -3

Query  397  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI-GQSELQWMRICNMYGKF  221
            ++GSV  NK LAWAIFSGDQ        A  AA+  +    I G+ ELQWM++CNM+GKF
Sbjct  4    MKGSVFLNKSLAWAIFSGDQQAMAYMSVAAIAASSESGVIGIRGEEELQWMKVCNMFGKF  63

Query  220  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            CN+   G+AS+++   +M+++  ISAFSLFRLYG    +
Sbjct  64   CNRGAGGVASAMLASFAMVLVSRISAFSLFRLYGATNQR  102



>gb|KHF98180.1| CASP-like protein XL3 [Gossypium arboreum]
Length=180

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 99/178 (56%), Gaps = 9/178 (5%)
 Frame = -3

Query  637  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVI  458
            +++ ++  +RL+ ++       + ++ A LIG+DSQ + IF ++KKA F D++ALV L+ 
Sbjct  4    SIQKIEALIRLSTIV-------MLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLY  56

Query  457  ANGLAAAYSLVQLVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsav  284
               LAAAY+L+QL   S S   +G+ L +   LAW  +  DQ + Y       AA + + 
Sbjct  57   ITSLAAAYNLLQLCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSF  116

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
                G+   QW++ CN Y +FC Q+G  +    +  + M  +  ISAF+LFRLY   K
Sbjct  117  LVLTGEENFQWLKWCNKYTRFCTQIGGSLLCGFVASLLMFSIASISAFNLFRLYSPTK  174



>sp|Q5K4H9.1|CSPL2_GOSHI RecName: Full=CASP-like protein XL3; AltName: Full=CASP-like 
protein 2C1; Short=GhCASPL2C1 [Gossypium hirsutum]
 emb|CAE75666.1| putative membrane protein [Gossypium hirsutum]
Length=180

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 98/178 (55%), Gaps = 9/178 (5%)
 Frame = -3

Query  637  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVI  458
            +++ ++  +RL+ ++       + ++ A LIG+DSQ + IF ++KKA F D++ALV L+ 
Sbjct  4    SIQKIEALIRLSTIV-------MLVLTACLIGLDSQTKVIFYVQKKASFKDLRALVGLLY  56

Query  457  ANGLAAAYSLVQLVRCSVSM-IRGSVLFNKP-LAWAIFSGDQLMaylslgavaaaaqsav  284
               LAAAY+L+QL   S S   +G+ L +   LAW  +  DQ + Y       AA + + 
Sbjct  57   ITSLAAAYNLLQLCCSSFSASYKGTSLQSYAYLAWLRYILDQAVVYAVFAGNLAALEHSF  116

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
                G+   QW++ CN Y +FC Q+G  +    +  + M  +  ISAF+LFR Y   K
Sbjct  117  LVLTGEENFQWLKWCNKYTRFCTQIGGSLLCGFVASLLMFSIASISAFNLFRQYSPTK  174



>ref|XP_011043990.1| PREDICTED: CASP-like protein 2C1 [Populus euphratica]
Length=181

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 92/169 (54%), Gaps = 8/169 (5%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  422
            E I R +   L +  A L+G+DSQ + +    K+  + D+ ALV LV  + +AAAY+L+Q
Sbjct  9    EAILRGIAILLLVSTACLVGLDSQTKFVIVYEKEVTYKDLHALVVLVHVDAVAAAYNLLQ  68

Query  421  LVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            L RCSVS      ++GS    + L+WA    DQL  Y +  A  AA + +V    G    
Sbjct  69   LCRCSVSAWGLGNLKGSY---RYLSWACCVLDQLAVYTTFAAHLAALEHSVLVLTGAKVF  125

Query  256  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            QW++ CN + +FC Q+G  +    I  + M ++  ISAF+LFRLY    
Sbjct  126  QWVKWCNKFTRFCFQIGGALTCCFIASVLMAMISFISAFNLFRLYSPKH  174



>ref|XP_010260176.1| PREDICTED: CASP-like protein XL3 [Nelumbo nucifera]
Length=181

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 91/167 (54%), Gaps = 3/167 (2%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
            E + R    GL ++ A L+G D Q + +F S+ +KA   D+ ALV L+I   + A Y L+
Sbjct  9    EALLRLFTVGLLVLTACLVGTDKQTKTVFFSVERKATVKDLDALVILMIVETVVAFYHLL  68

Query  424  QLVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
            QL +C           L     AW  F  DQ + Y+  GA  AAAQ++  +  G S+ QW
Sbjct  69   QLGKCFFFPRFKENKALPYSTQAWVFFFLDQTVTYIYFGATIAAAQASALSVTGASDFQW  128

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            M++CN+Y +FC Q+G  +   L+  + M I+  ISAF+LFR Y   +
Sbjct  129  MKVCNIYTRFCIQIGGSLFCGLVAALLMSIVSSISAFNLFRHYSPKQ  175



>gb|EYU42435.1| hypothetical protein MIMGU_mgv1a014854mg [Erythranthe guttata]
Length=176

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 92/162 (57%), Gaps = 5/162 (3%)
 Frame = -3

Query  589  RCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR  413
            R +   L ++ A L+G+D+Q + IF +  +KA F D+ AL  LV  +  AA Y+L+QL R
Sbjct  11   RIISTVLLVLSACLVGLDTQTKVIFYTFTRKATFRDLDALYLLVWIDSGAAVYNLLQLFR  70

Query  412  C-SVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICN  236
                ++I       K LAW ++  DQ  AY+   A  AA Q++  A  G+   QWM++CN
Sbjct  71   SFRKNLITAPY---KNLAWGVYFLDQAAAYVVFAANTAAIQASALAVTGEESFQWMKLCN  127

Query  235  MYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             Y +FC Q+G  +  S I  I M I+  +SA++LFRLY   +
Sbjct  128  RYTRFCFQIGGALVCSYIAAILMAIISTMSAYALFRLYSPKQ  169



>ref|XP_011069901.1| PREDICTED: CASP-like protein 2C1 isoform X2 [Sesamum indicum]
Length=176

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/170 (37%), Positives = 90/170 (53%), Gaps = 19/170 (11%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  424  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyAKIG  269
            QL R           F K LA        W  +  DQ  +Y+   A  AA Q++V A  G
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQAASYVVFAANTAAVQASVLALTG  116

Query  268  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
            +   QWM++CN Y +FC Q+G  +A  +I  I  +I+  ISA++LFRLY 
Sbjct  117  EKSFQWMKLCNRYTRFCIQIGGALACGVIAAILTVIISSISAYALFRLYS  166



>ref|NP_001142330.1| CASP-like protein 2U1 [Zea mays]
 gb|ACF88205.1| unknown [Zea mays]
 gb|AFW56601.1| membrane protein 9 [Zea mays]
Length=186

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 82/176 (47%), Positives = 115/176 (65%), Gaps = 10/176 (6%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
             +++V +AE+  R V+CGL  + A L+  D+Q R  FS++KKA +TDMKA+V LV A   
Sbjct  11   AERKVAVAEVALRAVLCGLGALAAALVATDTQTRTFFSLQKKATYTDMKAMVLLVAAAAT  70

Query  445  AAAYSLVQLVR--CSVSMIRGSVLFNKP-----LAWAIFSGDQLMaylslgavaaaaqsa  287
            AA YSL+Q  R  C V+++R S+   +P     LAW +F+ DQ +AY  L AVAAA Q++
Sbjct  71   AAGYSLLQAARCCCCVALLRTSI---RPRARLLLAWCVFACDQALAYALLAAVAAALQAS  127

Query  286  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
            V AK G  +LQWM IC +YG FC Q G G+A ++   +   +L  +SAF+LFRLYG
Sbjct  128  VVAKQGLPQLQWMAICALYGAFCRQAGAGVACAVAAAVDAALLAFLSAFNLFRLYG  183



>ref|XP_007223970.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
 gb|EMJ25169.1| hypothetical protein PRUPE_ppa014614mg, partial [Prunus persica]
Length=180

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  398
            ++ A L+G DSQ + +  I +KA F D+K+L  LV    +AA Y+L+QL +CS S     
Sbjct  19   VLTACLVGFDSQTKYLIFIYRKATFRDLKSLSVLVYVVSVAAGYNLLQLGKCSKSAWCKE  78

Query  397  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKF  221
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QWM++CN Y +F
Sbjct  79   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWMKLCNKYTRF  135

Query  220  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            C Q+G  +A   + CI M  +  ISAF+LFRLY   +
Sbjct  136  CFQIGGALACGYVACILMAWISLISAFNLFRLYSPKQ  172



>emb|CDX94411.1| BnaC01g17730D [Brassica napus]
Length=175

 Score = 89.0 bits (219),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 92/176 (52%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            R+R +E+I R  I  L I+ +VLIG+DSQ ++I  I K+  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVALLILSSVLIGLDSQTKDIAYIHKRVTFRYLFALEIELYINVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y++ QL      V    S  +  S L ++   + +F+G    A  SL  V          
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAGASAAAQHSLLVVT---------  113

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C+ + +FC Q+G  I  + I  + MIIL  ISAFSLFRLY   +
Sbjct  114  --GSRELQWMKWCSKFTRFCFQIGSAIILNYIAAVLMIILSFISAFSLFRLYSPKR  167



>ref|XP_010265455.1| PREDICTED: CASP-like protein 2C1 [Nelumbo nucifera]
Length=181

 Score = 88.2 bits (217),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/168 (35%), Positives = 94/168 (56%), Gaps = 3/168 (2%)
 Frame = -3

Query  604  AELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSL  428
             E + R    G+ ++ A L+G ++Q + +F S+ +KA   D+ ALV LVI   + A Y L
Sbjct  8    TEALLRLSAIGVLVLTACLVGTNTQTKHVFFSVERKATVKDLDALVILVIVESVTAFYHL  67

Query  427  VQLVRCSV--SMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            +QL +            +  +  AW  F  DQ++ Y++ GA  AAAQ+++ A  G  + Q
Sbjct  68   LQLGKYFAFPRFKEKKAISYETQAWICFMLDQIVTYVNFGATVAAAQASMLAVTGSRDFQ  127

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            WM++C +Y +FC Q+G  +   L+  I MI++   SAF+LFRLY   +
Sbjct  128  WMKVCRIYKRFCFQIGGSLTCGLVASILMIMISTFSAFNLFRLYSPKR  175



>ref|XP_011069900.1| PREDICTED: CASP-like protein 2C1 isoform X1 [Sesamum indicum]
Length=179

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 86/173 (50%), Gaps = 22/173 (13%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
            E   R +   L ++ A L+G DSQ +  F +  +KA F D+ AL  LV  +  AAAY+L+
Sbjct  7    ETFLRVLSTVLLVLTACLVGFDSQTKVFFYTYARKATFRDLNALYVLVWVDAAAAAYNLI  66

Query  424  QLVRCSVSMIRGSVLFNKPLA--------WAIFSGDQLMaylslgavaaaaqsavyAKI-  272
            QL R           F K LA        W  +  DQ +   S    AA   +   + + 
Sbjct  67   QLFRS----------FRKDLADNSYTYLRWGTYLLDQELQAASYVVFAANTAAVQASVLA  116

Query  271  --GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
              G+   QWM++CN Y +FC Q+G  +A  +I  I  +I+  ISA++LFRLY 
Sbjct  117  LTGEKSFQWMKLCNRYTRFCIQIGGALACGVIAAILTVIISSISAYALFRLYS  169



>ref|XP_009139582.1| PREDICTED: CASP-like protein ARALYDRAFT_657503 [Brassica rapa]
 emb|CDX89392.1| BnaA01g15010D [Brassica napus]
Length=175

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 95/176 (54%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            R+R +E+I R  I  L I+ +VLIG DSQ ++I  I KK  F  + AL   +  N + AA
Sbjct  3    RLRESEVILRLCIVFLLILTSVLIGFDSQTKDIAYIHKKVTFRYLFALEIELYINVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y++ QL      V    S  +  S L ++   + +F+G           V+AAAQ ++  
Sbjct  63   YNIAQLGFGWYGVAQKTSNSKWLSYLLDQTAVYVVFAG-----------VSAAAQHSLLV  111

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C+ + +FC Q+G  I  + I  + MIIL  ISAFSLFRLY   +
Sbjct  112  VTGSRELQWMKWCSKFTRFCFQIGSAIILNYIAAMLMIILSFISAFSLFRLYSPKR  167



>ref|XP_009396107.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=190

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 93/182 (51%), Gaps = 7/182 (4%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            +V  AE + R +    A + A+L+G+D+Q + +F + + A   DM AL  + +   + A 
Sbjct  4    KVLRAESVLRILSLVFAAMAALLVGLDTQTKTVFFVTRTATVKDMDALWVMTVVFSVVAG  63

Query  436  YSLVQLVRCSVSMIRGS--VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  263
            Y L+ L RC      G      NK +AW  F  DQ   Y + GA  AA Q+A+    G  
Sbjct  64   YHLLHLFRCMAFTWLGKNPCHCNKFVAWLYFVLDQGSTYATFGATMAALQAALVGLFGIG  123

Query  262  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY-----GDNKSKCN  98
             LQW ++CN+Y +FC+Q+  GI   L+  + M ++  ISA  LF+LY        KS   
Sbjct  124  SLQWSKLCNIYTRFCDQIAGGIICGLVATLVMAVISAISAHRLFQLYPRTRRSSPKSAGG  183

Query  97   GR  92
            GR
Sbjct  184  GR  185



>ref|XP_009396704.1| PREDICTED: CASP-like protein 2C1 [Musa acuminata subsp. malaccensis]
Length=187

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 99/170 (58%), Gaps = 2/170 (1%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++ R+  AE + R +   LA   A+L+G+D++ + +  +RKKA   D+  L  + +   +
Sbjct  1    MESRLLKAEGVLRMLSLALAATAALLVGLDTETKTVLFVRKKATAKDLDGLWTMTLVTSI  60

Query  445  AAAYSLVQLVRC-SVSMI-RGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  272
             A Y L+QL RC +++++ R     +K +AW +F  DQ + Y + GA  A  Q+A+ A  
Sbjct  61   TAGYHLLQLFRCMALALLGRNPCRGSKSVAWFLFLLDQGVTYATFGATMAGLQAALVAVF  120

Query  271  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            G  +LQW ++CN+Y +FC QV  G+   L   ++M ++  +SA  LFRLY
Sbjct  121  GVDDLQWSKLCNIYTRFCEQVAGGMLCGLTASLAMAVVSAVSAHHLFRLY  170



>ref|XP_008223711.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Prunus mume]
Length=182

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 8/157 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSM----  398
            ++ A L+G DSQ + +  I +KA F D+KAL+ LV    +AA Y+L+QL +CS S     
Sbjct  21   VLTACLVGFDSQTKYVIFIYRKATFRDLKALLVLVYVVSVAAGYNLLQLGKCSKSAWYKE  80

Query  397  -IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKF  221
             ++GS   N  +AW  F  DQ+  Y++ GA +AA +++V A  G  + QW+++CN Y +F
Sbjct  81   NLKGS---NIYVAWLCFLLDQVAVYVTFGANSAALEASVLAIKGAQDFQWIKLCNKYTRF  137

Query  220  CNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            C Q+G  +A   + CI M  +  ISAF+LFRLY   K
Sbjct  138  CFQIGGALACGYVACILMAWISLISAFNLFRLYSPKK  174



>ref|XP_002869651.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7MFW5.1|CSPL4_ARALL RecName: Full=CASP-like protein 2C1; Short=AlCASPL2C1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH45910.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=175

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 89/176 (51%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            R+R  E+I R  I    ++ + LIG+DSQ +EI  I KK  F  + AL   +  N + AA
Sbjct  3    RLRETEVILRLCIVFFILLSSCLIGLDSQTKEIAYIHKKVSFRYLLALEAELYINVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+LVQ+      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLVQIGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYSPKR  167



>ref|XP_010046989.1| PREDICTED: CASP-like protein 2C1 [Eucalyptus grandis]
 gb|KCW78728.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
 gb|KCW78729.1| hypothetical protein EUGRSUZ_C00172 [Eucalyptus grandis]
Length=184

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 92/170 (54%), Gaps = 8/170 (5%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREI-FSIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
            E+  R     L ++ A L+ + +Q + I ++  +KA F D+ AL  LV  +G+ A Y+L+
Sbjct  9    EVFLRVCAILLLVLTACLVAMATQTKLIMYTYARKATFRDLNALPVLVYIDGVVAGYNLL  68

Query  424  QLVRCSVSM-----IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSE  260
            QL RCSVS      I+  +L  K L+W  F  DQ+  Y       AA Q+++ A  G   
Sbjct  69   QLSRCSVSAYCKREIQCPLL--KNLSWVHFLLDQVAVYTVFATTVAATQASLLAVTGSKA  126

Query  259  LQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +QWM++CN Y +FC QVG  +       I ++++  +S ++LFR Y   K
Sbjct  127  MQWMKLCNRYTRFCIQVGGALLCGYAASIVLVLMSFLSVYNLFRRYSPTK  176



>ref|XP_010433586.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 89/176 (51%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I  L ++ A LIG+DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVFIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSKELQWMKWCYKFTRFCFQVGSAIILNYIAAGLMVLLSFISAFNLFRLYSPKR  167



>ref|XP_010448363.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 89/176 (51%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I  L ++ A LIG+DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGMDSQTKEIAYIHKKVSFKYLVALEAELYIDVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEQKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSKELQWMKWCYKFTRFCFQVGSAIILNYIAAGLMVLLSFISAFNLFRLYSPKR  167



>emb|CDP02964.1| unnamed protein product [Coffea canephora]
Length=169

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 91/165 (55%), Gaps = 6/165 (4%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLV  425
             L+ R       ++ A L+  DSQ + +F S+ +KA F D+KAL  LV     AAAY+++
Sbjct  3    TLVLRLFATSSLVLTACLVAFDSQTKLLFYSMVRKASFRDLKALSILVWVASAAAAYNVL  62

Query  424  QLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMR  245
            Q++R  +    G     K LAW  +  DQ +AYL   A +AA Q  V+A  GQS   WM+
Sbjct  63   QILRSRLFPQMG-----KNLAWFGYLLDQAVAYLVFAANSAALQGCVFAVSGQSNFGWMK  117

Query  244  ICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +C+ Y +FC Q+G  +      C++M ++  +SA+ LFRLY    
Sbjct  118  VCDKYTRFCIQIGGALICGYAACLAMAVISALSAYGLFRLYSPKH  162



>sp|P0DH82.1|CSPL1_MARPO RecName: Full=CASP-like protein 2U1; Short=MpCASPL2U1 [Marchantia 
polymorpha]
Length=216

 Score = 83.2 bits (204),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 100/193 (52%), Gaps = 10/193 (5%)
 Frame = -3

Query  697  TMSYLGVGVSPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI  518
            T  Y+G   +PG VPV H  N   + +R+R A ++ R     L +   V +  D Q    
Sbjct  11   TNGYIG---TPGTVPVSHAGNDSGM-RRMRTASILMRLTAMALCVTALVTMVTDKQTHYF  66

Query  517  ----FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIF  350
                 +I K A++T++ AL   V  NG+ A YSL+Q +   V+  + S   +K   W  F
Sbjct  67   NFASTTIVKTAEYTNVLALKVFVYTNGVIAGYSLLQALWTIVA--KSSYSTSKARLWTTF  124

Query  349  SGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCIS  170
              DQ + Y+ +G   AA + A  A+ G+S++ W + CN +G+FC+QVG  +    +  ++
Sbjct  125  FLDQFIVYVLIGVTGAATEVAYIAEKGESDVAWPKQCNNFGRFCSQVGASVIVCFVAILT  184

Query  169  MIILCGISAFSLF  131
            ++ L  +SA  LF
Sbjct  185  LVFLAVLSAKQLF  197



>ref|XP_009341031.1| PREDICTED: CASP-like protein POPTRDRAFT_578614 [Pyrus x bretschneideri]
Length=192

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 89/155 (57%), Gaps = 3/155 (2%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRG-  389
            ++ A L+G DSQ + +    +KA F D+ AL+ LV    +AA Y+L+Q+ + S+S     
Sbjct  30   VLTACLVGFDSQTKYVVFFYRKATFRDLNALLLLVYVVSVAAGYNLLQVGKSSLSACFKP  89

Query  388  --SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCN  215
               V  N  LAW  F  DQ+  Y++ GA +A  Q+++ A  GQ + QW+++C+ Y +FC 
Sbjct  90   NLKVRTNIYLAWICFLLDQMAVYVTFGANSATFQASLLAVTGQEDFQWIKLCSKYTRFCF  149

Query  214  QVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            Q+G  +      CI M  +  ISAF+LFRLY   +
Sbjct  150  QIGGALTCGYAACIVMAFVSSISAFNLFRLYTPKQ  184



>ref|XP_006453396.1| hypothetical protein CICLE_v10009662mg [Citrus clementina]
 ref|XP_006465092.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 ref|XP_006474164.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 ref|XP_006483174.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X1 
[Citrus sinensis]
 gb|ESR66636.1| hypothetical protein CICLE_v10009662mg [Citrus clementina]
Length=179

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 10/152 (7%)
 Frame = -3

Query  547  IGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR------GS  386
            +G+D+Q + IF + +K  + ++ AL  LV     AA Y+L+QL R SV + R      GS
Sbjct  25   VGLDTQSKYIFYVDRKITYKELHALGALVYVASAAAGYNLLQLGR-SVFVSRYLGNSKGS  83

Query  385  VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVG  206
                + LAW  +  DQ++ Y++ G  +AA + +V A  G  E QWM+ CN + +FC Q+G
Sbjct  84   Y---RYLAWVSYLLDQMVVYIAFGTNSAAVEHSVLALSGMKEFQWMKWCNKFTRFCFQIG  140

Query  205  EGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              + S    C  M++   ISAF+LFRLY   K
Sbjct  141  GALVSGYAACALMVLATSISAFNLFRLYSSEK  172



>ref|XP_004149074.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 ref|XP_004163171.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like [Cucumis 
sativus]
 gb|KGN61092.1| hypothetical protein Csa_2G048830 [Cucumis sativus]
Length=188

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 84/150 (56%), Gaps = 5/150 (3%)
 Frame = -3

Query  544  GIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV-SMIRG----SVL  380
            G D +  +IF + KKA F  ++ALV ++  + +AA Y+++QL +C + +  +G       
Sbjct  28   GFDKETVQIFHVDKKASFKSLRALVIIIYVDSMAAGYNILQLCKCWIFAQPKGISKLGTH  87

Query  379  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEG  200
            F+  L W  F  DQ+ AYL+  +  A  ++A+ A  G  + QWM++CN + +FC QVG  
Sbjct  88   FHIYLFWLSFFLDQVAAYLTFASNTAGMEAALLAVTGAHDFQWMKLCNRFHRFCYQVGGA  147

Query  199  IASSLIVCISMIILCGISAFSLFRLYGDNK  110
                     +++++  ISAF+LFR Y  N 
Sbjct  148  FLCGYAAFFALLLISFISAFNLFRHYSPNH  177



>ref|XP_010438829.1| PREDICTED: CASP-like protein 2C1 [Camelina sativa]
Length=175

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 89/176 (51%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I  L ++ A LIG+DSQ +EI  I KK  F  + AL   +  + + AA
Sbjct  3    KLRETEVILRVCIVFLLLLTACLIGLDSQTKEIAYIHKKVSFKYLIALEAELYIDVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+L QL      V    S  +  S L ++  A+ +F+G    A  SL  V          
Sbjct  63   YNLAQLGLHWHSVEKKTSNTKWFSYLLDQTAAYVVFAGTSAAAQHSLLVVT---------  113

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC QVG  I  + I    M++L  ISAF+LFRLY   +
Sbjct  114  --GSKELQWMKWCYKFTRFCFQVGSAIILNYIGAGLMVLLSFISAFNLFRLYSPKR  167



>gb|KDO46523.1| hypothetical protein CISIN_1g030313mg [Citrus sinensis]
Length=179

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 86/152 (57%), Gaps = 10/152 (7%)
 Frame = -3

Query  547  IGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIR------GS  386
            +G+D+Q + IF + +K  + ++ AL  LV     AA Y+L+QL R SV + R      GS
Sbjct  25   VGLDTQSKYIFYVDRKITYKELHALGALVYVASAAAGYNLLQLGR-SVFVSRYLGNSKGS  83

Query  385  VLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVG  206
                + LAW  +  DQ++ Y++ G  +AA + +V A  G  E QWM+ CN + +FC Q+G
Sbjct  84   Y---RYLAWVSYLLDQMVVYIAFGTNSAAVEHSVLALSGMKEFQWMKWCNKFTRFCFQIG  140

Query  205  EGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              + S    C  M++   ISAF+LFRLY   K
Sbjct  141  GALVSGYAACALMVLATSISAFNLFRLYSSEK  172



>ref|XP_006282730.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
 gb|EOA15628.1| hypothetical protein CARUB_v10005865mg [Capsella rubella]
Length=176

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 91/176 (52%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I  L ++ A L+G+DSQ +EI  I KK  F  + AL   +  +   AA
Sbjct  4    KLRETEVILRLCIVFLLLLTACLVGLDSQTKEIAYIHKKVSFRYLIALEAELYIDVGVAA  63

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+LVQL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  64   YNLVQLGLHWHNVEQKTSNPKWFSYLLDQTAAYVVFAGT-----------TAAAQHSMLV  112

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  113  VTGSQELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSFISAFNLFRLYSPKR  168



>dbj|BAF00509.1| hypothetical protein [Arabidopsis thaliana]
Length=82

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            + G+ +LQWMR+C MYGKFCNQ+  G++S+L+  I+M+ +  ISAFSLFRLYG  K +
Sbjct  20   REGEEDLQWMRVCTMYGKFCNQMAIGVSSALLASIAMVFVSCISAFSLFRLYGATKDR  77



>ref|NP_567729.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8L8U9.1|CSPLS_ARATH RecName: Full=CASP-like protein 2C1; Short=AtCASPL2C1 [Arabidopsis 
thaliana]
 gb|AAM67108.1| unknown [Arabidopsis thaliana]
 dbj|BAD43134.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43495.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43765.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43774.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43852.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01471.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE85119.1| uncharacterized protein AT4G25830 [Arabidopsis thaliana]
Length=175

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 90/176 (51%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I    ++ + LIG+DSQ +EI  I K   F  + AL   +  + + AA
Sbjct  3    KLRETEVILRLCIVFFLLLTSCLIGLDSQTKEIAYIHKNVSFRYLLALEAELYIDVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+LVQL      V    S  +  S L ++  A+ +F+G             AAAQ ++  
Sbjct  63   YNLVQLGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAGTS-----------AAAQHSLLV  111

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY   +
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYSPKR  167



>emb|CDY49469.1| BnaCnng17350D [Brassica napus]
Length=174

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 93/176 (53%), Gaps = 18/176 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            R+R  E++ R  I  L ++ +VLIG+DSQ +EI  + KK  F  + AL   +  + + A 
Sbjct  3    RLRETEVVPRLCIVFLLLLTSVLIGLDSQTKEIAYMHKKVTFRYLFALEVELYIDVVVAV  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y++VQL      V    S  +  S + ++   + +FSG            +AAAQ ++  
Sbjct  63   YNMVQLGLGWYGVAQKTSNSKWLSYILDQTAVYVVFSG-----------ASAAAQHSLLV  111

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
              G  ELQWM+ C  + +FC Q+G  I  + I  + M+IL  +SAF+LFRLY   +
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQIGSAIILNYIAVVLMVILSFLSAFNLFRLYSPKR  167



>ref|XP_006413266.1| hypothetical protein EUTSA_v10026381mg [Eutrema salsugineum]
 gb|ESQ54719.1| hypothetical protein EUTSA_v10026381mg [Eutrema salsugineum]
Length=175

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 86/159 (54%), Gaps = 5/159 (3%)
 Frame = -3

Query  586  CVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCS  407
            C++  L ++ + L+G+DSQ +E+  I KK  F D+ AL   +  + + AAY++VQL    
Sbjct  14   CIVFFL-LLTSFLVGLDSQTKEVAYIHKKVTFRDLFALEVELYIDVVVAAYNIVQLGFGW  72

Query  406  VSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYG  227
                 G    N    W  +  DQ   Y+     +AAAQ ++    G  ELQWM+ C+ + 
Sbjct  73   FG--AGQKTTNSK--WLSYLLDQTAVYVMFAGTSAAAQHSLLVVTGSRELQWMKWCSKFT  128

Query  226  KFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            +FC Q+G  I  + I  I MIIL  +SAF+LFRLY   +
Sbjct  129  RFCFQIGSAIVLNYIAAILMIILSFLSAFNLFRLYSPKR  167



>ref|XP_004242688.1| PREDICTED: CASP-like protein 2C1 [Solanum lycopersicum]
Length=200

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = -3

Query  556  AVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRG  389
            A L+G DSQ + +F +++ KA F  + AL  LV  +  AA Y+++QL+RC   + S +  
Sbjct  22   ACLVGFDSQTKVVFLTVQIKANFKYLGALSVLVWIDAAAAIYNVLQLLRCFFIATSKVDI  81

Query  388  SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQV  209
              + +K   W  F  DQ++ Y+   A +AA +++  A IG   LQWM+ICN + +FC Q+
Sbjct  82   KQISHKNY-WFFFLLDQVVVYIVFAANSAAIEASAIALIGIKSLQWMKICNRFTRFCIQI  140

Query  208  GEGIASSLIVCISMIILCGISAFSLFRLYG  119
            G  +    I  + + ++  ISAF LFRLY 
Sbjct  141  GAALILGYIAVLILFLVSSISAFQLFRLYS  170



>ref|XP_010545424.1| PREDICTED: CASP-like protein 2C1 [Tarenaya hassleriana]
Length=188

 Score = 77.4 bits (189),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 89/177 (50%), Gaps = 4/177 (2%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIA  455
            +K+  + +  AE   R  +  + ++ A LIG DSQ R I    KK  F  +K+L   +  
Sbjct  3    MKMRMRHLTTAEAAVRLSVALILLLTACLIGFDSQTRIIAYYHKKVTFRVLKSLEIGMYI  62

Query  454  NGLAAAYSLVQL--VRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  281
            +  AAAY+L+QL  +   V   + S     P  W  +  DQ  AY       AAA++++ 
Sbjct  63   DAAAAAYNLLQLGYLWFRVKQQKDSKSVYVP--WLCYILDQTAAYAVYAGTCAAAENSLL  120

Query  280  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
               G  ELQWM  C+ Y +FC QVG  +  S +    M +L  +SAF LFRLY  ++
Sbjct  121  VVRGSKELQWMEWCSKYTRFCFQVGGAVVCSFLAAALMTLLSALSAFRLFRLYSPSR  177



>emb|CBI17818.3| unnamed protein product [Vitis vinifera]
Length=224

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 83/152 (55%), Gaps = 8/152 (5%)
 Frame = -3

Query  604  AELIFRCVICGLAIVGAVLIGIDSQVREIFS-IRKKAKFTDMKALVFLVIANGLAAAYSL  428
            AE   R     + ++ A L+G D+Q + +FS I+K A F D+ AL  +V  + +AA Y+L
Sbjct  53   AEAFLRLFAILVLVLTACLLGFDTQTKLLFSTIKKTATFRDLGALQVVVYVDSVAAGYNL  112

Query  427  VQLVRCSVSMIRGSVLFNK---PLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            +QL R  +S      L N     L W  F  DQ   Y    A  AA Q+++ A  G+S L
Sbjct  113  LQLGRGFISAKLKGKLINVSYVTLPWVCFLLDQAAVYTVFSANTAALQASIIAVTGESSL  172

Query  256  QWMRICNMYGKFCNQVG----EGIASSLIVCI  173
            QWM++CN Y +FC QVG     G  +SL++CI
Sbjct  173  QWMKVCNRYTRFCIQVGGALLSGYLASLLMCI  204



>ref|XP_006366193.1| PREDICTED: CASP-like protein VIT_11s0052g01140-like [Solanum 
tuberosum]
Length=200

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 86/147 (59%), Gaps = 3/147 (2%)
 Frame = -3

Query  550  LIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCS-VSMIRGSV-L  380
            L+G DSQ + +F ++  KA +  + AL  LV  +  AA+Y+++QL+R   ++  +G +  
Sbjct  24   LVGFDSQTKVVFLTVHIKANYKYLDALSVLVWIDAAAASYNVLQLLRSFFITTSKGDIKQ  83

Query  379  FNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEG  200
            F+    W  F  DQ + Y+   A +AA +++V A IG   LQWM+ICN + +FC Q+G  
Sbjct  84   FSHKNYWFFFLLDQAVVYIVFAANSAAIEASVIALIGIKSLQWMKICNRFTRFCIQMGAA  143

Query  199  IASSLIVCISMIILCGISAFSLFRLYG  119
            +    +  + + ++  ISAF LFRLY 
Sbjct  144  LILGYLAVVILFLISSISAFQLFRLYS  170



>gb|EAY84708.1| hypothetical protein OsI_06078 [Oryza sativa Indica Group]
Length=195

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 5/169 (3%)
 Frame = -3

Query  604  AELIFR--CVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  431
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYH  73

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             ++CN+Y +FC Q   G+  S +    M +L   SA  LFRLY     +
Sbjct  133  SKLCNIYTRFCEQAAAGMLCSFLAAAGMAVLSAFSARRLFRLYSPAGHR  181



>ref|NP_001046070.1| Os02g0177700 [Oryza sativa Japonica Group]
 sp|Q6ETN2.1|CSPLM_ORYSJ RecName: Full=CASP-like protein 2C2; Short=OsCASPL2C2 [Oryza 
sativa Japonica Group]
 dbj|BAD27988.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF07984.1| Os02g0177700 [Oryza sativa Japonica Group]
 dbj|BAG99819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 85/169 (50%), Gaps = 5/169 (3%)
 Frame = -3

Query  604  AELIFR--CVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  431
            AE + R  CV+  +A   A+L+G  ++ + +  +RK A   D++AL  L +A   AA Y 
Sbjct  16   AERLLRGGCVV--MAATAALLLGFSAETKTVLFVRKTAVAKDVQALWVLTVAAAAAAGYQ  73

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
              QLVRC      G       +AW  F  D+  AY+   + AAA Q+ +   IG   LQW
Sbjct  74   FAQLVRCMYCSSSGDA-GAMAVAWTSFLLDKGCAYVVFASTAAALQACMVGLIGVEALQW  132

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             ++CN+Y +FC Q   G+  S +    M +L   SA  LFRLY     +
Sbjct  133  SKLCNIYTRFCEQAAAGMLCSFLAAAGMAVLSAFSARRLFRLYSPAGHR  181



>ref|XP_002273403.2| PREDICTED: CASP-like protein 2C1 [Vitis vinifera]
 sp|A7Q6G6.1|CSPL9_VITVI RecName: Full=CASP-like protein 2C1; Short=VvCASPL2C1 [Vitis 
vinifera]
Length=206

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 89/174 (51%), Gaps = 8/174 (5%)
 Frame = -3

Query  694  MSYLGVGVSPGNVPVYHGSNLKVVDKRVRLA--ELIFRCVICGLAIVGAVLIGIDSQVRE  521
            MS LGVG  P  V  +    +      + LA  E   R     + ++ A L+G D+Q + 
Sbjct  1    MSVLGVG--PRTVTPHLRKGMMESSSGISLARAEAFLRLFAILVLVLTACLLGFDTQTKL  58

Query  520  IFS-IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNK---PLAWAI  353
            +FS I+K A F D+ AL  +V  + +AA Y+L+QL R  +S      L N     L W  
Sbjct  59   LFSTIKKTATFRDLGALQVVVYVDSVAAGYNLLQLGRGFISAKLKGKLINVSYVTLPWVC  118

Query  352  FSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIAS  191
            F  DQ   Y    A  AA Q+++ A  G+S LQWM++CN Y +FC QVG  + S
Sbjct  119  FLLDQAAVYTVFSANTAALQASIIAVTGESSLQWMKVCNRYTRFCIQVGGALLS  172



>emb|CAB39604.1| putative mitochondrial protein [Arabidopsis thaliana]
 emb|CAB79438.1| putative mitochondrial protein [Arabidopsis thaliana]
Length=618

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 90/173 (52%), Gaps = 18/173 (10%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            ++R  E+I R  I    ++ + LIG+DSQ +EI  I K   F  + AL   +  + + AA
Sbjct  3    KLRETEVILRLCIVFFLLLTSCLIGLDSQTKEIAYIHKNVSFRYLLALEAELYIDVVVAA  62

Query  436  YSLVQL------VRCSVSMIRG-SVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            Y+LVQL      V    S  +  S L ++  A+ +F+G            +AAAQ ++  
Sbjct  63   YNLVQLGLGWYNVEQKTSNPKWFSYLLDQTAAYVVFAG-----------TSAAAQHSLLV  111

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
              G  ELQWM+ C  + +FC Q+G  I  + I    M++L  ISAF+LFRLY 
Sbjct  112  VTGSRELQWMKWCYKFTRFCFQMGSAIILNYIAAALMVLLSSISAFNLFRLYS  164



>gb|EEC69375.1| hypothetical protein OsI_38510 [Oryza sativa Indica Group]
Length=132

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++++ ++AE+  RC +C LA + A L+G  SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  445  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  338
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|XP_003610149.1| hypothetical protein MTR_4g128520 [Medicago truncatula]
 gb|KEH15650.1| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=184

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 88/174 (51%), Gaps = 5/174 (3%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVRE-IFSIRKKAKFTDMKALVFLVIANGLAA  440
            R+   E++ R       +  A ++  D++ +  I  I+KKA + D+ AL  L+     AA
Sbjct  4    RMAKGEVLLRVSAILFLVSTACIVAFDTETKVVILMIKKKATYKDLDALKILLYVTSAAA  63

Query  439  AYSLVQLVRCSVSMIRGSVLFNKP----LAWAIFSGDQLMaylslgavaaaaqsavyAKI  272
             Y+++QL + S S       FN      +AW  F  DQ++ YL+     +A ++ ++A  
Sbjct  64   GYNMLQLCKHSFSACSTIRNFNDSYYMHMAWISFLLDQIVVYLTFATNTSAFEACLFALT  123

Query  271  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
            G    QWM++CN + +FC Q+G  I    I  I M ++  ISA+ + R+Y   +
Sbjct  124  GSEAFQWMKVCNKFTRFCYQIGGAILCCYIASILMAMISTISAYKVLRMYSPKR  177



>ref|XP_007154779.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
 gb|ESW26773.1| hypothetical protein PHAVU_003G147200g [Phaseolus vulgaris]
Length=180

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 7/152 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVR---CSVSM  398
            ++ A L+  D+Q + +   I+KKA + D+ AL   V     AA Y+L+QL +   CS   
Sbjct  21   VLSACLVAFDTQTKVVLLGIQKKATYNDLHALKISVYVTSAAAGYNLLQLCKHSTCSRGN  80

Query  397  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
             +GS +    +AW     DQ+  Y++LG   A+  +++ A  G   LQWM++C+ + +FC
Sbjct  81   FKGSYM---CMAWISLFLDQIAVYITLGTNTASVAASMMAVTGSEALQWMKVCDKFSRFC  137

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
             Q+G  +    +  I M ++  ISA+ +FR+Y
Sbjct  138  IQIGGALLCGYVASILMALVSTISAYKVFRMY  169



>ref|NP_001066880.1| Os12g0514300 [Oryza sativa Japonica Group]
 dbj|BAF29899.1| Os12g0514300 [Oryza sativa Japonica Group]
Length=157

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++++ ++AE+  RC +C LA + A L+G  SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCAVCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  445  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  338
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|XP_003553094.1| PREDICTED: CASP-like protein 10-like [Glycine max]
Length=203

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 88/180 (49%), Gaps = 9/180 (5%)
 Frame = -3

Query  643  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFL  464
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  463  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  284
            V ANG+ A YSL   V    +M R S +   P AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVI--AAMPRPSTM---PRAWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             A+ G +   W   C  +G+FC++V   +A + +     ++L  IS++ LF  Y    S+
Sbjct  132  LAEKGDAATTWSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLISSYKLFTNYDAPASR  191



>ref|XP_006845610.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
 gb|ERN07285.1| hypothetical protein AMTR_s00019p00209400 [Amborella trichopoda]
Length=178

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 96/172 (56%), Gaps = 3/172 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            +D R++ +E + R ++  +  V   ++   ++  E   I+K+A   D+  L  LV+   +
Sbjct  1    MDARLKRSEALLR-LLAAMFAVATAVVVATNRETEYMIIQKRATMKDLNCLEVLVMVESI  59

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
            AA Y +VQL++C +S    S      LAW   S DQ++ Y  LGAVAAA Q + +AK G 
Sbjct  60   AAGYQMVQLLKCILSWNSTSCC--TRLAWLTLSFDQVVVYGCLGAVAAAIQGSYFAKFGA  117

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             ELQW ++CN+Y +FC  +   + + L   ++M ++  +SAF+LF  +   +
Sbjct  118  RELQWSKLCNIYQRFCLHITYSLITGLCSALAMAVVSAMSAFNLFSHFSPTR  169



>gb|KHN22710.1| CASP-like protein 3 [Glycine soja]
Length=180

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 84/155 (54%), Gaps = 7/155 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  398
            ++ A L+ +D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFISIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  397  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKFTRFC  137

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
             ++G  +       + M ++  ISA+ +FR+Y   
Sbjct  138  VEIGGALLCGYAASMLMALISTISAYKVFRMYSPK  172



>ref|NP_001237350.1| CASP-like protein 2C1 [Glycine max]
 sp|C6SZ04.1|CSPL3_SOYBN RecName: Full=CASP-like protein 2C1; Short=GmCASPL2C1 [Glycine 
max]
 gb|ACU14477.1| unknown [Glycine max]
Length=180

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 84/155 (54%), Gaps = 7/155 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  398
            ++ A L+ +D+Q + +F SI KKA + D+ AL  LV     AA Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFVSIEKKATYKDLNALKILVYVTCAAAGYNLLLLCKHSIWSRKN  80

Query  397  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
             +GS L    +AW  FS DQ+  Y++  A  A   +AV A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFSLDQIAVYMTFAANTATMGAAVLAISGSEAFQWLKVCDKFTRFC  137

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
             ++G  +       + M ++  ISA+ +FR+Y   
Sbjct  138  VEIGGALLCGYAASMLMALISTISAYKVFRMYSPK  172



>gb|EEC69376.1| hypothetical protein OsI_38511 [Oryza sativa Indica Group]
Length=143

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++++ ++AE+  RC +C LA + A L+G  SQ R  FS+ KKA+FTDMKALV LV A+G 
Sbjct  7    LERKAKVAEVALRCALCALAALAAALVGTGSQTRTFFSLEKKARFTDMKALVLLVAAHGA  66

Query  445  AAAYSLVQLVRCSVSMI--RGSVLFNKPLAWAIFSGDQ  338
            AA YSL+QL RC+ +     GS      +AW++FS DQ
Sbjct  67   AAVYSLLQLARCAAAAAWKGGSNGGAAVVAWSVFSCDQ  104



>ref|XP_009798279.1| PREDICTED: CASP-like protein 2C1 [Nicotiana sylvestris]
Length=190

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 87/156 (56%), Gaps = 4/156 (3%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMI  395
            ++ A L+G DSQ + +F ++ +KA F DM AL FLV  +   A+Y+++ ++RC +  +  
Sbjct  19   VLTACLMGFDSQTKLLFDTVERKASFNDMDALFFLVWIDAAVASYNVLHVLRCFLIPTTA  78

Query  394  RGSV-LFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
            +G V   +    W  F  DQ   Y    A +AA +++  A  G   LQWM++CN + +FC
Sbjct  79   KGDVKQRSYKNYWLFFFLDQAAVYTVFAAQSAAVEASAIALAGVRSLQWMKLCNRFTRFC  138

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             Q+G  +       + ++++  +SAF LFRLY   K
Sbjct  139  IQIGGALLCGYAAVLVLVVVSSLSAFQLFRLYSPKK  174



>ref|XP_002989705.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
 sp|D8T2C0.1|CSPL1_SELML RecName: Full=CASP-like protein 2U6; Short=SmCASPL2U6 [Selaginella 
moellendorffii]
 gb|EFJ09182.1| hypothetical protein SELMODRAFT_272089 [Selaginella moellendorffii]
Length=203

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 89/175 (51%), Gaps = 19/175 (11%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI-------FSIRKKAKFTDMKA  476
            LK  D  +R A      V C + +V  VLI  D Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCTVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  475  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  296
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  295  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            + A        E  W+++C+++G+FC+Q+G  + +SLI  +       ISA+ LF
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFGRFCHQLGASLVTSLISTVLFAFSAAISAYYLF  191



>ref|XP_004507839.1| PREDICTED: CASP-like protein 3-like isoform X1 [Cicer arietinum]
Length=182

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 92/176 (52%), Gaps = 7/176 (4%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            ++ R+   E++ R +     ++ A L+  D++ + +  + KK  + D+  L  LV     
Sbjct  1    MEFRMARGEILLRVLAILFLLLTACLVAFDTETKLLLFVEKKVTYKDLDVLKILVYITST  60

Query  445  AAAYSLVQLVR-----CSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavy  281
             A Y+++QL +     C     +GS      +AW     DQ+  YL+LG+ +AA ++A++
Sbjct  61   VAGYNMLQLCKYSFSACPTWSFKGSDY--NYMAWISLLVDQIGVYLTLGSNSAAFEAAMF  118

Query  280  AKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
            A  G    QWM++C+ Y +FCN +G  +    +  I M ++  ISA+ +FR+Y  N
Sbjct  119  AYNGSEAFQWMKVCDKYSRFCNLIGVALLCGYVASILMALISTISAYKVFRIYSPN  174



>ref|XP_002991776.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
 sp|D8T829.1|CSPL2_SELML RecName: Full=CASP-like protein 2U5; Short=SmCASPL2U5 [Selaginella 
moellendorffii]
 gb|EFJ07180.1| hypothetical protein SELMODRAFT_272229 [Selaginella moellendorffii]
Length=203

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 88/175 (50%), Gaps = 19/175 (11%)
 Frame = -3

Query  634  LKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI-------FSIRKKAKFTDMKA  476
            LK  D  +R A      V C + +V  VLI  D Q   I        +I K   F   KA
Sbjct  29   LKRTDLMLRFAAF----VCCAVTMV--VLI-TDKQTSAIQVPGFNNLTITKTVSFDLAKA  81

Query  475  LVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaa  296
             V+LV A G+ A Y+L+ LV   +S  R     +K +AW IF  DQL+ Y+ L A AA+ 
Sbjct  82   FVYLVSAAGIGAGYTLLVLVLSIISAER-----SKAIAWFIFVFDQLITYVLLAAAAAST  136

Query  295  qsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            + A        E  W+++C+++G+FC+Q+G  + +S I  +       ISA+ LF
Sbjct  137  EVAYMGAHAPPEASWLKVCSLFGRFCHQLGASLVTSFISTVLFAFSAAISAYYLF  191



>ref|XP_006657208.1| PREDICTED: CASP-like protein Os06g0656300-like [Oryza brachyantha]
Length=191

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 77/142 (54%), Gaps = 6/142 (4%)
 Frame = -3

Query  538  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKP---  368
            ++Q   +  IRKKA   D++AL  L +A   +A Y L+QL++C      G     KP   
Sbjct  39   NTQTETVLLIRKKATVRDVQALWVLAMATAASAGYHLLQLLKC---FYLGRFAGGKPCRG  95

Query  367  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  188
            +AW  F  D+  AY++     AAAQ+ + A  G   LQW ++C++Y +FC QV   +   
Sbjct  96   VAWLCFLLDKGCAYVTFATTVAAAQACMVALDGAHALQWNKLCHIYTRFCEQVAGSLVCG  155

Query  187  LIVCISMIILCGISAFSLFRLY  122
            ++  +   +L  +SA +LFRLY
Sbjct  156  MLAAVGAALLSAVSARNLFRLY  177



>gb|KHN08760.1| CASP-like protein 10 [Glycine soja]
Length=203

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/180 (31%), Positives = 87/180 (48%), Gaps = 9/180 (5%)
 Frame = -3

Query  643  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFL  464
            G  L+     +R AE   R V  GL +   VL+  +SQ  E  S+     ++D+ A  +L
Sbjct  21   GDELEGNTSALRTAETFLRLVPVGLCVSALVLMLKNSQQNEYGSV----DYSDLGAFRYL  76

Query  463  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  284
            V ANG+ A YSL   V    +M R S +     AW  F  DQ++ Y+ L A A + +   
Sbjct  77   VHANGICAGYSLFSAVI--AAMPRPSTMTR---AWTFFLLDQVLTYIILAAGAVSTEVLY  131

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             A+ G +   W   C  +G+FC++V   +A + +     ++L  IS++ LF  Y    S+
Sbjct  132  LAEKGDAATTWSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLISSYKLFTNYDAPASR  191



>gb|AFK47158.1| unknown [Lotus japonicus]
Length=207

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 80/164 (49%), Gaps = 9/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R+ E   R    GL +   V++  +SQ  E  ++     +TD+ A  +LV ANG+ A Y
Sbjct  29   LRIVETFLRLFPIGLCVTALVIMLKNSQENEYGTL----DYTDLSAFRYLVHANGICAGY  84

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL   V   +++ R S +   P AW  F  DQL+ Y+ L A A + +     + G     
Sbjct  85   SLFSAV--IIALPRPSTM---PRAWTFFVLDQLLTYIILAAGALSMEVLYLTEKGDPPAA  139

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C  +G FC++    IA + +  I  ++L  IS++ LF  Y
Sbjct  140  WSSACGYFGPFCHKATASIAITFVAVICYVVLSLISSYKLFSKY  183



>ref|XP_006855416.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
 gb|ERN16883.1| hypothetical protein AMTR_s00057p00159510 [Amborella trichopoda]
Length=184

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 70/132 (53%), Gaps = 8/132 (6%)
 Frame = -3

Query  517  FSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGS--VLFNKPLAWAIFSG  344
            F I ++AKF    A ++ V+AN +A AYS+   V   VS    S  +LF+ P   A+F+G
Sbjct  54   FPITQEAKFNQSPAFIYFVVANAVACAYSIFTAVVSGVSKKSPSDKLLFHLPFFDAVFAG  113

Query  343  DQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMI  164
                  +   A  A+A  A     G S   W  IC ++GKFC  VG   A SL+  I+ +
Sbjct  114  ------IVGSATGASAAIAYVGLKGNSHAMWPAICPVFGKFCRYVGGSTAVSLVASIAFV  167

Query  163  ILCGISAFSLFR  128
            +L G+S+ SL+R
Sbjct  168  LLVGLSSHSLYR  179



>ref|XP_002276206.1| PREDICTED: CASP-like protein 1E2 [Vitis vinifera]
 sp|A7NW78.1|CSPL5_VITVI RecName: Full=CASP-like protein 1E2; Short=VvCASPL1E2 [Vitis 
vinifera]
Length=195

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 89/175 (51%), Gaps = 15/175 (9%)
 Frame = -3

Query  628  VVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREI----------FSIRKKAKFTDMK  479
            V   ++R  +L+ R V   L +V AVL+G+D Q + +            +   AK+  + 
Sbjct  22   VTGGKLRPFDLVLRVVALALTLVAAVLLGVDKQTKVVSLQLLPTLPPMDVPVTAKWRYLS  81

Query  478  ALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaa  299
            A V+ V++N +A +Y+ + L+  SV   +G    NK L  AI   D +M  L   +  AA
Sbjct  82   AFVYFVVSNAIACSYAALSLL-LSVGNSKG----NKGLGLAITVMDLVMVALLFSSNGAA  136

Query  298  aqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSL  134
                +    G S ++W ++CN++GKFCNQV   +  S    ++  +L  ++AF+L
Sbjct  137  GAIGLMGYEGNSRVRWGKVCNVFGKFCNQVAVALGLSFFGGLAFFLLVVMAAFAL  191



>dbj|BAJ84836.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = -3

Query  637  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVI  458
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  26   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  81

Query  457  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  82   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  136

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  137  YNGDKEVTWSEACGVFGGFCRQARTSVAITFGTVVCYILLSLISSYRLFSAY  188



>ref|XP_009611405.1| PREDICTED: CASP-like protein 2C1 [Nicotiana tomentosiformis]
Length=242

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 100/187 (53%), Gaps = 19/187 (10%)
 Frame = -3

Query  643  GSNLKVVDKR--VRLAELIFRCVICGLAIVGAVLIGIDSQVREIF-SIRKKAKFTDMKAL  473
              N+ +V K   +RL  ++F        ++ A L+G DSQ + +F ++ +KA F D+ AL
Sbjct  50   DHNMDIVRKEGFLRLFAILF-------LVLTACLMGFDSQTKLLFDTVERKASFKDLNAL  102

Query  472  VFLVIANGLAAAYSLVQLVRCSV--SMIRGSVLFNKPLA----WAIFSGDQLMaylslga  311
              LV  +   A+Y+++Q++RC +  +  +G +   K ++    W  F  DQ   Y    A
Sbjct  103  FVLVWIDAAVASYNVLQVLRCFLIPTTSKGDI---KQMSYKNYWLFFFLDQAAVYTVFAA  159

Query  310  vaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
             +AA +++  A  G   LQWM++CN + +FC Q+G  +       + ++++  +SAF LF
Sbjct  160  QSAAVEASAIALAGVRSLQWMKLCNRFTRFCIQIGGALLCGYAAILLLVVVSSLSAFQLF  219

Query  130  RLYGDNK  110
            RLY   K
Sbjct  220  RLYSPKK  226



>ref|XP_009783950.1| PREDICTED: CASP-like protein 2A1 [Nicotiana sylvestris]
Length=189

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 98/193 (51%), Gaps = 18/193 (9%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKF  491
            SP  +   +GS+       +R AE + R +   L +V  V++  +SQ  +  S+     +
Sbjct  3    SPQGLEDENGSS-----SSMRTAETMLRLLPMALCVVALVIMLKNSQTNDFGSL----SY  53

Query  490  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  311
            +D+    +LV ANG+ AAYSL+  +  +V   R + +   P AW  F  DQ++ Y+ L A
Sbjct  54   SDLGTFRYLVHANGICAAYSLLSAIVSAVP--RPTTM---PKAWTFFLLDQILTYVILAA  108

Query  310  vaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
             AA+ +    A  G + + W   C ++G FC +  E +A + IV +  + +  +S++ LF
Sbjct  109  GAASTEVVYLAYKGDTAVTWSETCGLFGGFCRKATESVAITFIVGLCYVGISLLSSYRLF  168

Query  130  RLY----GDNKSK  104
              Y    GD K+K
Sbjct  169  SKYDAPIGDYKNK  181



>ref|XP_003549486.1| PREDICTED: CASP-like protein 3-like [Glycine max]
 gb|KHN17582.1| CASP-like protein 3 [Glycine soja]
Length=180

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 83/153 (54%), Gaps = 7/153 (5%)
 Frame = -3

Query  565  IVGAVLIGIDSQVREIF-SIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV---SM  398
            ++ A L+ +D+Q + +F SI KKA   D+ AL  LV     +A Y+L+ L + S+     
Sbjct  21   VLTACLVALDTQTKVVFLSIEKKATCRDLNALKILVYVTSASAGYNLLLLCKHSIWSRKN  80

Query  397  IRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFC  218
             +GS L    +AW  F  DQ+  Y++  A  AA  +A+ A  G    QW+++C+ + +FC
Sbjct  81   FKGSYL---CMAWICFLLDQIAVYMTFAANTAAMGAAMLAITGSDAFQWLKVCDKFTRFC  137

Query  217  NQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
             Q+G  +       I M ++  ISA+ +FR+Y 
Sbjct  138  VQIGGALLCGYAASIIMALISTISAYQVFRMYS  170



>dbj|BAJ85571.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=207

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = -3

Query  637  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVI  458
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  26   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  81

Query  457  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  82   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  136

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  137  YNGDKEVTWSEACGVFGGFCRQARTSVAITFGSVVCYILLSLISSYRLFSAY  188



>gb|EMT22680.1| hypothetical protein F775_30108 [Aegilops tauschii]
Length=204

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 84/172 (49%), Gaps = 9/172 (5%)
 Frame = -3

Query  637  NLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVI  458
            +L   + RVR  E + R    GL +    ++  D+Q  E  ++     ++D+    +LV 
Sbjct  23   DLSAAEARVRPLETLLRAAPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFKYLVY  78

Query  457  ANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyA  278
            ANGL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A
Sbjct  79   ANGLCAAYSLVSAFYTAVP--RPATLSR---SWIVFLLDQVFTYLILAAGAASAELLYLA  133

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              G  E+ W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y
Sbjct  134  YNGDKEVTWSEACGVFGGFCRQARTSVAITFGSVVCYILLSLISSYRLFSAY  185



>ref|XP_010531897.1| PREDICTED: CASP-like protein 2A1 [Tarenaya hassleriana]
Length=199

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 93/191 (49%), Gaps = 8/191 (4%)
 Frame = -3

Query  643  GSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFL  464
            G+  + +   +R AE + R     L +   V++  DS+  +  S+     ++++ A  +L
Sbjct  12   GAAEEEMSAGIRTAETMLRLAPVALCVAALVVMLKDSESSDFGSV----SYSNLIAFRYL  67

Query  463  VIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  284
            V ANG+ A YSL  L     +M R S  F  P AW  F  DQ++ Y+ LGA A +++   
Sbjct  68   VHANGICAGYSL--LSAAITAMSRSSSTF--PRAWTFFCLDQVLTYMVLGAGAVSSEVIY  123

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
             A  G S + W   C+ +G FC++    +  + +V    + L  +S++ LF LYG   S 
Sbjct  124  IAYRGDSAITWSEACSSFGSFCHKATASVVITFVVVSLYVFLSLLSSYKLFSLYGPPPSS  183

Query  103  CNGR*RKTIYV  71
                 + T+ V
Sbjct  184  SVHSHKDTVQV  194



>ref|XP_010691480.1| PREDICTED: CASP-like protein 2C1 [Beta vulgaris subsp. vulgaris]
Length=197

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 5/174 (3%)
 Frame = -3

Query  622  DKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI-RKKAKFTDMKALVFLVIANGL  446
            ++ VR+  L+    +  L++   VL+  D Q R  FS+ RKK  +     L   +    +
Sbjct  7    NRLVRIEALLRFFALLTLSLASIVLVT-DQQSRIYFSVYRKKVNYKLATILEVSLYVYSI  65

Query  445  AAAYSLVQLVRC-SVSMIRGSVLF--NKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
             A Y+L+QLVRC + +      L   N  L W  F  DQ+  Y+      A+ + ++ A 
Sbjct  66   GAGYNLLQLVRCMAFTNYEEDKLSWSNHILIWIYFLLDQMAVYVVFAICCASIELSLLAL  125

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDN  113
             G  +LQWM++C  Y +FC Q+G  I+ + +  I+MI++  IS F+L R Y  N
Sbjct  126  TGVEDLQWMKLCANYVRFCVQIGGYISCAGLASIAMIVISAISTFNLLRWYSPN  179



>sp|D2KQI6.1|CSPL1_BETVM RecName: Full=CASP-like protein Ni6; AltName: Full=CASP-like 
protein 1D1; Short=BvCASPL1D1 [Beta vulgaris subsp. maritima]
 gb|ADA71986.1| Ni6 protein [Beta vulgaris subsp. maritima]
Length=194

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 85/183 (46%), Gaps = 6/183 (3%)
 Frame = -3

Query  664  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI----RKKA  497
            G VP      +   D + R+ ++I R ++   +I   VL+    Q   I S        A
Sbjct  9    GAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIVSPFGSRPNAA  68

Query  496  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  317
            KF +  A ++LV A  +A  YS++  +  S+S +R  ++  K L W +   D L+  +  
Sbjct  69   KFQNSPAFIYLVAALSVAGLYSIITAL-VSLSYMRKPIVPPK-LFWILLIHDVLLLGIVA  126

Query  316  gavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFS  137
             A   A         G + ++W +I N+Y KFC  VG  I  SL     +++L  ++A S
Sbjct  127  AATGTAGGVGYIGLKGNTHVRWGKIRNVYDKFCRHVGASIIVSLFAAAVLVLLVFVNANS  186

Query  136  LFR  128
            L+R
Sbjct  187  LYR  189



>ref|XP_007141978.1| hypothetical protein PHAVU_008G242000g [Phaseolus vulgaris]
 gb|ESW13972.1| hypothetical protein PHAVU_008G242000g [Phaseolus vulgaris]
Length=208

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/183 (29%), Positives = 92/183 (50%), Gaps = 13/183 (7%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKF  491
            + G    + G+N  V+    RL E + R     L++   +++  +S+  E  S+     +
Sbjct  24   AEGTHEEFEGNNNTVL----RLVETLLRLFPILLSVTALIIMLKNSEENEYGSV----SY  75

Query  490  TDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslga  311
            TD+ A  +LV  NG+ A YSL  ++  ++  +      + P+ W +F  DQ++ YL LGA
Sbjct  76   TDLSAFRYLVHMNGICAGYSLFSVIFAALPSLS-----SMPINWTLFLLDQVLTYLILGA  130

Query  310  vaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
             A + +    A+ G S   W   C  +G FC++V   IA + +V I  ++L  IS++ LF
Sbjct  131  GAVSMEVLYLAEKGNSATTWSSACRAFGSFCDKVTASIAITFVVVICYVLLSLISSYKLF  190

Query  130  RLY  122
              Y
Sbjct  191  TNY  193



>ref|XP_002979076.1| hypothetical protein SELMODRAFT_444075 [Selaginella moellendorffii]
 gb|EFJ20033.1| hypothetical protein SELMODRAFT_444075 [Selaginella moellendorffii]
Length=1020

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 54/196 (28%), Positives = 91/196 (46%), Gaps = 13/196 (7%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQV-----------R  524
            S G  PV     +   +   R++ ++ R  +  L I+   L+  D +            R
Sbjct  11   SAGGSPVGDERKMGDHEHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPR  70

Query  523  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFS  347
             +F + K AK+  +  L F V A G+   Y+++ L+    +   +G+V+  K +AW  F 
Sbjct  71   PVF-VTKTAKYELVTGLKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFI  129

Query  346  GDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISM  167
             D +M YL L + A A +    A+ G   + W ++CN +G FC      +    I  +  
Sbjct  130  ADSMMGYLLLSSAAVATEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVS  189

Query  166  IILCGISAFSLFRLYG  119
             ++ GISA+ LFRLYG
Sbjct  190  FVVVGISAYHLFRLYG  205



>ref|XP_003579514.1| PREDICTED: CASP-like protein 2A1 [Brachypodium distachyon]
Length=204

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 83/170 (49%), Gaps = 9/170 (5%)
 Frame = -3

Query  631  KVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIAN  452
             V + RVR  E + R V  GL +    ++  D+Q  E  ++     ++D+    +LV AN
Sbjct  26   TVAEARVRPVETLLRAVPLGLCVAAMAVMLRDTQTNEYGTV----SYSDLGGFRYLVYAN  81

Query  451  GLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKI  272
            GL AAYSLV     +V   R + L     +W +F  DQ+  YL L A AA+A+    A  
Sbjct  82   GLCAAYSLVSAFYTAVP--RPATLCR---SWIVFLLDQVFTYLILAAGAASAELLYLAYN  136

Query  271  GQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            G  E+ W   C ++G FC Q    +  +    +  I+L  IS++ LF  Y
Sbjct  137  GDKEVTWSEACGVFGGFCRQARTSVGITFGSVLCYILLSLISSYRLFSAY  186



>ref|XP_011098144.1| PREDICTED: CASP-like protein 2A1 [Sesamum indicum]
Length=194

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 88/189 (47%), Gaps = 9/189 (5%)
 Frame = -3

Query  664  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTD  485
            G VP       +     +R AE + R +   L +   V++  DSQ  +  S+     ++D
Sbjct  5    GAVPAAEMGGDESGSSTMRTAETLLRVLPMALCVAALVIMLKDSQTNDYGSL----SYSD  60

Query  484  MKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgava  305
            + A  +LV A+G+ A YSL+  V  +V   R S +     AWA F  DQL+ Y+ L A A
Sbjct  61   LGAFRYLVHASGVCAGYSLLSAVVAAVP--RPSTMSR---AWAFFLLDQLLTYIILAAGA  115

Query  304  aaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  125
             +A+    A  G + + W R C  +G FC +    IA + +  +    L  IS++ LF  
Sbjct  116  ISAEVVYLAYKGDTSITWSRTCGSFGGFCRKATASIAITFVATLCYAALSLISSYRLFSK  175

Query  124  YGDNKSKCN  98
            Y    +  N
Sbjct  176  YDAPAAYSN  184



>ref|NP_001049263.2| Os03g0196400 [Oryza sativa Japonica Group]
 dbj|BAF11177.2| Os03g0196400, partial [Oryza sativa Japonica Group]
Length=103

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 46/71 (65%), Gaps = 4/71 (6%)
 Frame = -3

Query  277  KIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  98
            K GQ E QWM+ C++Y +FC Q G G+A ++   ++M+ +  ISAF+LFRLYG++    N
Sbjct  34   KYGQPEFQWMKTCHLYKRFCAQAGGGVACAIAASVNMVGVALISAFNLFRLYGNS----N  89

Query  97   GR*RKTIYVVA  65
            G  + T   +A
Sbjct  90   GGGKATTTTMA  100



>ref|XP_010062716.1| PREDICTED: CASP-like protein 2A1 [Eucalyptus grandis]
Length=200

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 10/185 (5%)
 Frame = -3

Query  646  HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVF  467
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  17   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  72

Query  466  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  287
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  73   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  127

Query  286  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
              A  G   + W   C  +G FC++    +A +L      ++L  +S++ LF  + D   
Sbjct  128  YLAYKGDVAITWSSACGSFGGFCHKATASVAITLAAAACYMVLSLVSSYRLFSRF-DAPV  186

Query  106  KCNGR  92
             C  +
Sbjct  187  ACTSK  191



>sp|P0DI24.1|CSPL3_PTEAA RecName: Full=CASP-like protein 2U1; Short=PaCASPL2U1 [Pteridium 
aquilinum subsp. aquilinum]
Length=196

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 58/171 (34%), Positives = 94/171 (55%), Gaps = 7/171 (4%)
 Frame = -3

Query  619  KRVRLAELIFRCVICGLAIVGAVLIGIDSQ--VREI--FSIRKKAKFTDMKALVFLVIAN  452
            +R  + EL+ RC    + ++  +L+  D Q  V+E+   S+  + +++    LV+LV AN
Sbjct  8    RRRNVGELVLRCAATLVCMLSLMLLVRDQQIAVQEVGVTSVTTQLRYSSSTGLVYLVYAN  67

Query  451  GLAAAYSLVQLVRCSVSMIRGSVLF-NKPLAWAIFSGDQLMaylslgavaaaaqsavyAK  275
            GL A Y  V ++  S +   GSV+  NK  AWA+F  DQ++A + L A +AA++ A   +
Sbjct  68   GLVALYCFVVVLTSSFN--GGSVMRRNKSGAWALFVLDQVLACILLSAASAASEIAFLVE  125

Query  274  IGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
             G  +  W   C +YG FC  +   IA+S I  I +  +C +SA  LF+ Y
Sbjct  126  KGAKKTIWDSKCIVYGHFCRMLEVSIATSFIAVIMLGSICVLSAKQLFQQY  176



>ref|XP_004503085.1| PREDICTED: CASP-like protein 10-like [Cicer arietinum]
Length=216

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 85/160 (53%), Gaps = 10/160 (6%)
 Frame = -3

Query  601  ELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQ  422
            E + R +  GL +   +++  +SQ  +  S+     +TD+ A  +LV ANG+ A YSL+ 
Sbjct  43   ETLLRLLSVGLCVSALLIMVKNSQQNDYTSL----SYTDLGAFRYLVHANGICAGYSLLS  98

Query  421  LVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRI  242
             V   V++ R ++    P AW  F  DQ++ Y+ L A A++A+    A+ G     WM  
Sbjct  99   AVI--VAVPRSTL----PPAWTFFFLDQVLTYIMLSAGASSAEVVYLAENGDDATLWMSA  152

Query  241  CNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            C  +G+FC++V   I  + +  I  ++L  IS++ LF  Y
Sbjct  153  CEPFGRFCHKVTASITITFVALICYVLLSLISSYKLFTKY  192



>sp|P0DH65.1|CSPL8_SELML RecName: Full=CASP-like protein 2U2; Short=SmCASPL2U2 [Selaginella 
moellendorffii]
Length=204

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 101/194 (52%), Gaps = 15/194 (8%)
 Frame = -3

Query  685  LGVGVSPGNVPVY------HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVR  524
            +G  VSPG+V V       H   LK VD  VR+    F    C LA++  VL+  + Q  
Sbjct  12   IGSQVSPGSVVVTNNESFGHRKLLKGVDFLVRIKAFAF----C-LAVI--VLLKNNVQTT  64

Query  523  EIFS-IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGS-VLFNKPLAWAIF  350
             I   I  +AK+ + KA V L++   +   Y+ +Q V   +S IR   VL N  LAW  F
Sbjct  65   VIAPGIVLQAKYNNTKAPVSLLVLASICCGYAFLQAVVSLLSFIRDKRVLNNTVLAWLTF  124

Query  349  SGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCIS  170
              DQ++ YL LG+ AA A++A  AK G+ ++QW  +C  + +FC+     +  S I  I+
Sbjct  125  LLDQVLTYLLLGSAAATAEAAYIAKRGEDKVQWKAVCGPFKRFCDHFAATVFLSFIAVIA  184

Query  169  MIILCGISAFSLFR  128
              +   ISA+ LFR
Sbjct  185  FAVSAAISAYYLFR  198



>sp|P0DH67.1|CSPL9_SELML RecName: Full=CASP-like protein 2U1; Short=SmCASPL2U1 [Selaginella 
moellendorffii]
Length=204

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 101/194 (52%), Gaps = 15/194 (8%)
 Frame = -3

Query  685  LGVGVSPGNVPVY------HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVR  524
            +G  VSPG+V V       H   LK VD  VR+    F    C LA++  VL+  + Q  
Sbjct  12   IGSQVSPGSVVVTNNESFGHRKLLKGVDFLVRIKAFAF----C-LAVI--VLLKNNVQTT  64

Query  523  EIFS-IRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGS-VLFNKPLAWAIF  350
             I   I  +AK+ + KA V L++   +   Y+ +Q V   +S IR   VL N  LAW  F
Sbjct  65   VIAPGIVLQAKYNNTKAPVSLLVLASICCGYAFLQAVVSLLSFIRDKRVLNNTVLAWLTF  124

Query  349  SGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCIS  170
              DQ++ YL LG+ AA A++A  AK G+ ++QW  +C  + +FC+     +  S I  I+
Sbjct  125  LLDQVLTYLLLGSAAATAEAAYIAKRGEDKVQWKAVCGPFKRFCDHFAATVFLSFIAVIA  184

Query  169  MIILCGISAFSLFR  128
              +   ISA+ LFR
Sbjct  185  FAVSAAISAYYLFR  198



>gb|KCW69848.1| hypothetical protein EUGRSUZ_F03189 [Eucalyptus grandis]
Length=217

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 89/185 (48%), Gaps = 10/185 (5%)
 Frame = -3

Query  646  HGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVF  467
            HG      ++RVR AE++ R V  GL +   V++  +S+  +  S+     ++D+ A  +
Sbjct  34   HGGENGGENERVRTAEMLMRVVPMGLCVAALVMMLRNSESNDYGSL----SYSDLGAFRY  89

Query  466  LVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsa  287
            LV ANG+ A YSL+  +   V+M R   +     AW  F  DQ++ Y  L A A + +  
Sbjct  90   LVHANGICAGYSLLSAI--IVAMPRPPTISR---AWTFFLLDQVLTYTILAAGAVSTEVL  144

Query  286  vyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKS  107
              A  G   + W   C  +G FC++    +A +L      ++L  +S++ LF  + D   
Sbjct  145  YLAYKGDVAITWSSACGSFGGFCHKATASVAITLAAAACYMVLSLVSSYRLFSRF-DAPV  203

Query  106  KCNGR  92
             C  +
Sbjct  204  ACTSK  208



>ref|NP_564017.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q8VZQ3.2|CSPL3_ARATH RecName: Full=CASP-like protein 2A1; Short=AtCASPL2A1 [Arabidopsis 
thaliana]
 gb|AAD50013.1|AC007651_8 Unknown protein [Arabidopsis thaliana]
 gb|AAM63874.1| unknown [Arabidopsis thaliana]
 gb|AAN12953.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29557.1| uncharacterized protein AT1G17200 [Arabidopsis thaliana]
Length=204

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            W   C+ YG FC++    +  +  V    I+L  IS++ LF
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYIVLSLISSYKLF  182



>dbj|BAJ89574.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=198

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 77/144 (53%), Gaps = 2/144 (1%)
 Frame = -3

Query  547  IGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRCSV--SMIRGSVLFN  374
            +G+D++   +  IRKKA   D+ AL  L  A G AA Y L+ L+RC             +
Sbjct  40   MGLDTETETVLLIRKKATVKDVHALWVLTAAAGAAAGYHLLHLLRCVYLGRFAHNPCRNS  99

Query  373  KPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIA  194
            + LAWA    D+  AYL+  A  AAAQ+ + A  G   LQW ++CN++ +FC QV   + 
Sbjct  100  RALAWAFLLLDKGCAYLTFAATVAAAQACLIALDGAQALQWNKLCNIFTRFCQQVAGSLV  159

Query  193  SSLIVCISMIILCGISAFSLFRLY  122
               +  +   +L  +SA +LFRLY
Sbjct  160  CGGLAAVGTAVLSALSARNLFRLY  183



>ref|XP_003600618.1| hypothetical protein MTR_3g064310 [Medicago truncatula]
Length=216

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 87/171 (51%), Gaps = 11/171 (6%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE   R +  GL +   VL+  +S+  +  S+     + D+ A  +LV ANG+ A Y
Sbjct  41   LRTAETFLRLLPIGLCVAALVLMLKNSEENDYGSV----SYNDLGAFRYLVHANGICAGY  96

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL+  V   V+  R ++L     AW  F  DQ++ Y+ L A A++ +    A+ G S   
Sbjct  97   SLLSAVV--VAAPRPTLL----RAWTFFFLDQVLTYIILSAGASSMEVVYLAENGDSATV  150

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  101
            W   C  +G+FC++V   +A + +     +IL  IS+F LF  Y D  + C
Sbjct  151  WNSACGSFGQFCHKVTASVAITFVALFCYVILSLISSFKLFSNY-DVPASC  200



>ref|XP_008451819.1| PREDICTED: CASP-like protein F16 [Cucumis melo]
Length=199

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 89/191 (47%), Gaps = 9/191 (5%)
 Frame = -3

Query  664  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTD  485
             N P    S+  +    +R A+ + R V  GL I   +++  +S+  +  S+     ++D
Sbjct  8    NNPPGLSSSDDSLAATGMRAADTLLRLVPMGLCIAALIVMLKNSEANDYGSV----AYSD  63

Query  484  MKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgava  305
            + A  FLV ANG+ A YS +     +V+ +      +K  AW +F  DQL+ YL+L A  
Sbjct  64   LGAFKFLVHANGICAGYSFLS---AAVAAMSPPSTISK--AWTLFFLDQLLTYLTLAAGT  118

Query  304  aaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRL  125
             + +    A  G +E+ W   C  +GKFC++    +  + IV      +  +S++ LF  
Sbjct  119  VSTEVLYLAYNGDTEITWSAACGTFGKFCSKATASVVITFIVVAFYAFISILSSYKLFSR  178

Query  124  YGDNKSKCNGR  92
            Y       N +
Sbjct  179  YNAPLPHPNSK  189



>gb|AES70869.2| CASP POPTRDRAFT-like protein [Medicago truncatula]
Length=217

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/171 (32%), Positives = 87/171 (51%), Gaps = 11/171 (6%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE   R +  GL +   VL+  +S+  +  S+     + D+ A  +LV ANG+ A Y
Sbjct  42   LRTAETFLRLLPIGLCVAALVLMLKNSEENDYGSV----SYNDLGAFRYLVHANGICAGY  97

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL+  V   V+  R ++L     AW  F  DQ++ Y+ L A A++ +    A+ G S   
Sbjct  98   SLLSAVV--VAAPRPTLL----RAWTFFFLDQVLTYIILSAGASSMEVVYLAENGDSATV  151

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKC  101
            W   C  +G+FC++V   +A + +     +IL  IS+F LF  Y D  + C
Sbjct  152  WNSACGSFGQFCHKVTASVAITFVALFCYVILSLISSFKLFSNY-DVPASC  201



>gb|AAL36294.1| unknown protein [Arabidopsis thaliana]
Length=204

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 80/164 (49%), Gaps = 8/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C+ YG FC++    +  +  V    I+L  IS++ LF  +
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYIVLSLISSYKLFTRF  185



>sp|D8ST12.2|CSPL3_SELML RecName: Full=CASP-like protein 2U11; Short=SmCASPL2U11 [Selaginella 
moellendorffii]
Length=221

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 90/196 (46%), Gaps = 13/196 (7%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQV-----------R  524
            S G  PV     +   +   R++ ++ R  +  L I+   L+  D +            R
Sbjct  11   SAGGSPVGDDRKMGDHEHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPR  70

Query  523  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFS  347
             +F + K AK+  +  L F V A G+   Y+++ L+    +   +G+V+  K +AW  F 
Sbjct  71   PVF-VTKTAKYELVTGLKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFI  129

Query  346  GDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISM  167
             D +M YL L   A A +    A+ G   + W ++CN +G FC      +    I  +  
Sbjct  130  ADSMMGYLLLSGAAVATEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVS  189

Query  166  IILCGISAFSLFRLYG  119
             ++ GISA+ LFRLYG
Sbjct  190  FVVVGISAYHLFRLYG  205



>ref|XP_002890211.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
 sp|D7KFC7.1|CSPLB_ARALL RecName: Full=CASP-like protein 2A1; Short=AlCASPL2A1 [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66470.1| integral membrane family protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 79/161 (49%), Gaps = 8/161 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G S + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDSAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLF  131
            W   C+ YG FC++    +  +  V    I+L  IS++ LF
Sbjct  142  WSDACSSYGGFCHRATASVIITFFVVCFYILLSLISSYKLF  182



>sp|P0DH61.1|CSPL6_SELML RecName: Full=CASP-like protein 2U10; Short=SmCASPL2U10 [Selaginella 
moellendorffii]
Length=221

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 91/196 (46%), Gaps = 13/196 (7%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQV-----------R  524
            S G  PV     +   +   R++ ++ R  +  L I+   L+  D +            R
Sbjct  11   SAGGSPVGDERKMGDHEHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPR  70

Query  523  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFS  347
             +F + K AK+  +  L F V A G+   Y+++ L+    +   +G+V+  K +AW  F 
Sbjct  71   PVF-VTKTAKYELVTGLKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFI  129

Query  346  GDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISM  167
             D +M YL L + A A +    A+ G   + W ++CN +G FC      +    I  +  
Sbjct  130  ADSMMGYLLLSSAAVATEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVS  189

Query  166  IILCGISAFSLFRLYG  119
             ++ GISA+ LFRLYG
Sbjct  190  FVVVGISAYHLFRLYG  205



>gb|EEC81102.1| hypothetical protein OsI_23961 [Oryza sativa Indica Group]
Length=189

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 3/142 (2%)
 Frame = -3

Query  538  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRGSVLFNKP  368
            ++Q   +  IRKKA   D++AL  L +A   AA Y L+QL+RC   S           + 
Sbjct  35   NTQTETVLFIRKKATVKDVQALWVLAMAAAAAAGYHLLQLLRCFYLSRFADGKPCRHRRA  94

Query  367  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  188
            +AW  F  D+  AY++     AAAQ+ V A  G   LQW ++CN+Y +FC QV   +  +
Sbjct  95   IAWLCFLLDKGCAYITFATTVAAAQACVVALYGTHALQWTKLCNIYTRFCEQVAGSLVCA  154

Query  187  LIVCISMIILCGISAFSLFRLY  122
            ++  +   +L  +SA +LFRLY
Sbjct  155  MLAAVGTALLSVVSARNLFRLY  176



>ref|XP_010327104.1| PREDICTED: CASP-like protein 2A1 [Solanum lycopersicum]
Length=189

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 85/163 (52%), Gaps = 12/163 (7%)
 Frame = -3

Query  610  RLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  431
             + E+I R +  GL +V  V++  +SQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIILRLLPMGLCVVALVIMLKNSQTNDYGSL----SYSDLGTFRYLVHANGICAAYS  73

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G + + W
Sbjct  74   LISAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTNVTW  128

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
               C  +G FC +    ++ + IV +  +   GIS  S +RL+
Sbjct  129  SETCGSFGGFCKKATASVSITFIVSLCYV---GISLLSSYRLF  168



>ref|XP_002447595.1| hypothetical protein SORBIDRAFT_06g005640 [Sorghum bicolor]
 sp|C5YDQ9.1|CSPLG_SORBI RecName: Full=CASP-like protein 2A1; Short=SbCASPL2A1 [Sorghum 
bicolor]
 gb|EES11923.1| hypothetical protein SORBIDRAFT_06g005640 [Sorghum bicolor]
Length=208

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 82/174 (47%), Gaps = 9/174 (5%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            RVR  E + R    GL +    ++  D Q  E  ++     ++D+    +LV ANGL AA
Sbjct  33   RVRPVETLLRAAPLGLCVAAMTVMLRDQQSNEYGTV----AYSDLGGFKYLVYANGLCAA  88

Query  436  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  89   YSLVSAFYTAVP--RPATVSR---SWVVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  143

Query  256  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
             W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y    S   G
Sbjct  144  TWSEACGVFGSFCRQARTSVAITFGTVLCFILLSLISSYRLFSAYEAPPSSALG  197



>ref|NP_001058251.1| Os06g0656300 [Oryza sativa Japonica Group]
 sp|Q67W83.1|CSPLD_ORYSJ RecName: Full=CASP-like protein 2C1; Short=OsCASPL2C1 [Oryza 
sativa Japonica Group]
 dbj|BAD37569.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAD37586.1| integral membrane protein-like [Oryza sativa Japonica Group]
 dbj|BAF20165.1| Os06g0656300 [Oryza sativa Japonica Group]
 dbj|BAG87329.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87332.1| unnamed protein product [Oryza sativa Japonica Group]
Length=194

 Score = 65.5 bits (158),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 77/142 (54%), Gaps = 3/142 (2%)
 Frame = -3

Query  538  DSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLVRC---SVSMIRGSVLFNKP  368
            ++Q   +  IRKKA   D++AL  L +A   AA Y L+QL+RC   S           + 
Sbjct  40   NTQTETVLFIRKKATVKDVQALWVLAMAAAAAAGYHLLQLLRCFYLSRFADGKPCRHRRA  99

Query  367  LAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASS  188
            +AW  F  D+  AY++     AAAQ+ V A  G   LQW ++CN+Y +FC QV   +  +
Sbjct  100  IAWLCFLLDKGCAYITFATTVAAAQACVVALYGTHALQWTKLCNIYTRFCEQVAGSLVCA  159

Query  187  LIVCISMIILCGISAFSLFRLY  122
            ++  +   +L  +SA +LFRLY
Sbjct  160  MLAAVGTALLSVVSARNLFRLY  181



>sp|P0DI21.1|CSPL2_OSMLA RecName: Full=CASP-like protein 2U1; Short=OlCASPL2U1 [Osmunda 
lancea]
Length=177

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 89/169 (53%), Gaps = 5/169 (3%)
 Frame = -3

Query  598  LIFRCVICGLAIVGAVLIGIDSQVREI----FSIRKKAKFTDMKALVFLVIANGLAAAYS  431
            ++ R V   L+I   VL+  D QV  +      +  +AK + ++A V+LV +NGL A Y 
Sbjct  1    MVLRIVASLLSIAALVLMAKDKQVVYLNLAGEELTLEAKHSYVEAFVYLVYSNGLVAIYC  60

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
             + LV   V  +       K  AW IF  DQ +AY+ L A AA+ + A  AK G +++ W
Sbjct  61   FL-LVFALVFRLIDKAGCGKSAAWIIFLLDQGLAYVLLAAAAASTEVAYVAKRGNNKVGW  119

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
              +C+ +G FCN VG  I  + I  ++M  L  +SA  LF+ YG  + +
Sbjct  120  SEVCSTFGHFCNLVGVSIVITFISVLAMATLSVMSARRLFKTYGPERKQ  168



>gb|KHN14990.1| CASP-like protein 10 [Glycine soja]
Length=205

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 82/172 (48%), Gaps = 9/172 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE   R    GL +   VL+   SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  33   LRTAETFLRLFPVGLCVSALVLMLKSSQQNEYGSV----DYSDLGAFRYLVHANGICAGY  88

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL   V    +M   S +   P AW  F  DQ++ Y+ L A A + +    A+ G +   
Sbjct  89   SLFSAVI--AAMPCPSTI---PRAWTFFLLDQVLTYIILAAGAVSTEVLYLAENGDAATT  143

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCN  98
            W   C  +G+FC++V   +A + +     ++L  +S++ LF  Y    S+  
Sbjct  144  WSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLVSSYKLFTKYDAPASRAT  195



>ref|NP_001239767.1| CASP-like protein 2A2 [Glycine max]
 sp|C6TCJ2.1|CSPLA_SOYBN RecName: Full=CASP-like protein 2A2; Short=GmCASPL2A2 [Glycine 
max]
 gb|ACU19544.1| unknown [Glycine max]
Length=206

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 82/170 (48%), Gaps = 9/170 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE   R    GL +   VL+   SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  34   LRTAETFLRLFPVGLCVSALVLMLKSSQQNEYGSV----DYSDLGAFRYLVHANGICAGY  89

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL   V    +M   S +   P AW  F  DQ++ Y+ L A A + +    A+ G +   
Sbjct  90   SLFSAVI--AAMPCPSTI---PRAWTFFLLDQVLTYIILAAGAVSTEVLYLAENGDAATT  144

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSK  104
            W   C  +G+FC++V   +A + +     ++L  +S++ LF  Y    S+
Sbjct  145  WSSACGSFGRFCHKVTASVAITFVAVFCYVLLSLVSSYKLFTKYDAPASR  194



>ref|XP_006304211.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
 gb|EOA37109.1| hypothetical protein CARUB_v10010315mg [Capsella rubella]
Length=204

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 79/163 (48%), Gaps = 8/163 (5%)
 Frame = -3

Query  610  RLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  431
            R AE + R    GL +   V++  DSQ  E  SI     ++++ A  +LV ANG+ A YS
Sbjct  31   RTAETMLRLAPVGLCVAALVVMLKDSQDNEFGSI----SYSNLTAFRYLVHANGICAGYS  86

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
            L  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + W
Sbjct  87   L--LSAAMAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAITW  142

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
               C+ YG FC++    +  +  V    ++L  IS++ LF  +
Sbjct  143  SDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLFTRF  185



>emb|CDO98909.1| unnamed protein product [Coffea canephora]
Length=196

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/165 (29%), Positives = 85/165 (52%), Gaps = 16/165 (10%)
 Frame = -3

Query  643  GSNLKVVDKR-VRLAELIFRCVICGLAIVGAVLIGIDSQVREI----------FSIRKKA  497
            G  ++V +K  +R +++I R +     +V A+++G+D Q + +           ++   A
Sbjct  16   GKEVEVANKSSLRGSDVILRFLAFASTLVAAIVLGVDKQTKLVSMTVVSTLPPITVPVTA  75

Query  496  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  317
            K+  M A V+ V+AN +A AY+ + L+     ++ G+    K LA  I + D +M  L  
Sbjct  76   KWHYMSAFVYFVVANVVACAYAALSLL-----LVLGNRGAKKGLALMIITLDLVMVALLS  130

Query  316  gavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLI  182
                AA    +    G S +QW ++CN++G+FCNQV   I  SL+
Sbjct  131  SGGGAALAVGLIGYRGNSHVQWNKVCNVFGRFCNQVAGAIVVSLL  175



>emb|CDX96785.1| BnaA08g23280D [Brassica napus]
Length=204

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 81/164 (49%), Gaps = 8/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL I   V++  DSQ  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   IRTAETMLRLAPVGLCIAALVIMLQDSQDNEFGSI----SYSNLSAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL+     ++S + GS     P  W  F  DQ++ Y+ L A A + +    A  G   + 
Sbjct  86   SLLS---AAISAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGDDAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  142  WSDACSSFGSFCHRATASVIITFVVVCFYVVLSLISSYKLFTRF  185



>gb|EPS73896.1| hypothetical protein M569_00863, partial [Genlisea aurea]
Length=163

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 73/145 (50%), Gaps = 9/145 (6%)
 Frame = -3

Query  538  DSQVREIFSI-RKKAKFTDMKALVFLVIANGLAAAYSLVQLVR-CSVSMIRGSVLFNKPL  365
            D Q + +  I  + A +  + AL  +V  +   AAY L+QLVR C +         N   
Sbjct  19   DRQTKTLLHIFTRTADYKSLDALYDVVWIDTAGAAYCLLQLVRICKLPS-------NLNA  71

Query  364  AWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSL  185
            AW I+  D + AY+      AA Q+++ A  G+S  QWM+ C+ Y +FC ++G  +   +
Sbjct  72   AWGIYFFDLIAAYVIFAGNVAALQASILALTGESSFQWMKQCDTYKRFCVEIGVALFFGI  131

Query  184  IVCISMIILCGISAFSLFRLYGDNK  110
               ISM +   IS + LFRLY   K
Sbjct  132  SAGISMAVTSSISGYHLFRLYSPTK  156



>emb|CDX81811.1| BnaC08g37900D [Brassica napus]
Length=204

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 82/168 (49%), Gaps = 8/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V    R AE + R    GL +   V+   DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  26   VSTAFRTAETMLRLAPVGLCLAALVITLKDSQNNEFGSV----SYSNLSAFGYLVHANGI  81

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+     +++ +RGS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMRGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            + + W   C+ +G FC++    +  + +V    +IL  IS++ LF  +
Sbjct  138  NAITWSDACSSFGSFCHRATASVIITFVVVCLYVILSLISSYKLFTRF  185



>emb|CDY48478.1| BnaC05g13380D [Brassica napus]
Length=204

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 82/168 (49%), Gaps = 8/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRVAPVGLCVAALVIMLKDSQTNEY----GEVSYSNLTAFRYLVHANGI  81

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+     +++ + GS     P  W IF  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTIFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLFTRF  185



>gb|KFK43914.1| hypothetical protein AALP_AA1G190800 [Arabis alpina]
Length=205

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 78/169 (46%), Gaps = 8/169 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V   +R AE + R    GL +   V++  DS+  E  SI     + ++ A  +LV ANG+
Sbjct  27   VSPGIRTAETMLRLAPVGLCVAALVVMLKDSETNEFGSI----SYNNLTAFRYLVHANGI  82

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL  L     +M R S     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  83   CAGYSL--LSAAIAAMPRSSSTM--PRVWTFFCFDQILTYVVLAAGAVSTEVLYLAYKGD  138

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYG  119
              + W   C+ YG FC++    +  +  V    ++L  IS++ LF  + 
Sbjct  139  DAITWSDACSSYGSFCHRATASVIITFFVVCFYVVLSIISSYKLFTRFD  187



>ref|XP_006465093.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
 ref|XP_006474165.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
 ref|XP_006483175.1| PREDICTED: CASP-like protein POPTRDRAFT_578614-like isoform X2 
[Citrus sinensis]
Length=125

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 10/118 (8%)
 Frame = -3

Query  445  AAAYSLVQLVRCSVSMIR------GSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsav  284
            AA Y+L+QL R SV + R      GS    + LAW  +  DQ++ Y++ G  +AA + +V
Sbjct  5    AAGYNLLQLGR-SVFVSRYLGNSKGSY---RYLAWVSYLLDQMVVYIAFGTNSAAVEHSV  60

Query  283  yAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNK  110
             A  G  E QWM+ CN + +FC Q+G  + S    C  M++   ISAF+LFRLY   K
Sbjct  61   LALSGMKEFQWMKWCNKFTRFCFQIGGALVSGYAACALMVLATSISAFNLFRLYSSEK  118



>ref|XP_011030770.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
 ref|XP_011015697.1| PREDICTED: CASP-like protein 2A1 [Populus euphratica]
Length=201

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 81/168 (48%), Gaps = 9/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+  V   V+M R S +   P AW  F  DQ++ Y  L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWTFFLLDQVLTYAILAAGTVSTEVLYLASKGD  134

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            + + W   C  +G FC++    IA + +V I    L  +S++ LF  Y
Sbjct  135  TAITWSEACVSFGGFCHKALISIAITFVVVICYAALSLLSSYKLFSKY  182



>ref|XP_007022201.1| CASP-like protein isoform 1 [Theobroma cacao]
 ref|XP_007022203.1| CASP-like protein isoform 1 [Theobroma cacao]
 gb|EOY13726.1| CASP-like protein isoform 1 [Theobroma cacao]
 gb|EOY13728.1| CASP-like protein isoform 1 [Theobroma cacao]
Length=198

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/164 (29%), Positives = 80/164 (49%), Gaps = 9/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R  E + R V   L I   V++  +SQ  E  S+     ++D+ A  +LV ANG+ A Y
Sbjct  39   MRTTETMLRLVPMALCIAALVVMLKNSQSNEFGSV----SYSDLGAFRYLVHANGICAGY  94

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL+  +    +M R S +   P AW +F  DQ++ Y+ L A A + +       G + + 
Sbjct  95   SLLSAII--AAMPRPSTM---PRAWTLFLLDQILTYIILAAGAVSTEVLYLTNKGDAAVT  149

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C  +  FC++    +  + +V    ++L  IS++ LF  Y
Sbjct  150  WSAACGTFASFCHKATTSVIITFVVVACYVVLSLISSYRLFSKY  193



>ref|XP_002317605.1| integral membrane family protein [Populus trichocarpa]
 sp|B9I0G0.1|CSPLA_POPTR RecName: Full=CASP-like protein 2A1; Short=PtCASPL2A1 [Populus 
trichocarpa]
 gb|EEE98217.1| integral membrane family protein [Populus trichocarpa]
Length=201

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 82/168 (49%), Gaps = 9/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V+   R AE + R V   L +   V++  ++Q  +  S+     ++D+ A  +LV  NG+
Sbjct  24   VENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYGSL----SYSDLGAFRYLVHVNGI  79

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+  V   V+M R S +   P AWA F  DQ++ Y+ L A   + +    A  G 
Sbjct  80   CAGYSLLSAVI--VAMPRASTM---PRAWAFFLLDQVLTYVILAAGTVSTEVLYLASKGD  134

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            + + W   C  +G FC++    I  + +V I    L  +S++ LF  Y
Sbjct  135  TTITWSEACVSFGGFCHKALISIVITFVVVICYAALSLLSSYKLFSKY  182



>ref|XP_009790738.1| PREDICTED: CASP-like protein 2A1 [Nicotiana sylvestris]
Length=202

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 94/185 (51%), Gaps = 14/185 (8%)
 Frame = -3

Query  664  GNVPVYHGSNLKVVDKR----VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKA  497
            G+ P+  GS  +  D+     +R AE + R +  GL +V  V++  +SQ  +  S+    
Sbjct  10   GSTPLQKGSQ-EFEDENGSSSMRTAETVLRLLPMGLCVVALVIMLKNSQTNDFGSL----  64

Query  496  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  317
             ++D+    +LV ANG+ A YSL+  +   V+ +   +  ++  AW  F  DQ++ Y+ L
Sbjct  65   SYSDLGTFRYLVHANGICAGYSLLSAI---VAAVPRPITMSR--AWTFFLLDQILTYIIL  119

Query  316  gavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFS  137
             A AA+ +    A  G + + W   C  +G FC++    ++ + IV +   +L  +S++ 
Sbjct  120  AAGAASTEVVYLAYKGDTAVTWSESCGSFGGFCHKATASVSVTFIVSLCYAMLSLLSSYR  179

Query  136  LFRLY  122
            LF  Y
Sbjct  180  LFSKY  184



>ref|XP_006360011.1| PREDICTED: CASP-like protein VIT_01s0010g01870-like isoform X1 
[Solanum tuberosum]
Length=189

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 88/173 (51%), Gaps = 13/173 (8%)
 Frame = -3

Query  610  RLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAYS  431
             + E++ R     L +V  V++  DSQ  +  S+     ++D+    +LV ANG+ AAYS
Sbjct  18   NIGEIMLRLFPMALCVVALVIMLKDSQTNDYGSL----SYSDLGIFRYLVHANGICAAYS  73

Query  430  LVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQW  251
            L+  +  ++   R + L   P AW IF  DQ++ Y+ L A AA+ +    A  G +++ W
Sbjct  74   LLSAIVAALP--RPTTL---PRAWTIFLLDQILTYIILAAGAASTEVIYLAYKGDTDVTW  128

Query  250  MRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY----GDNKSK  104
               C  +G FC +    ++ + IV +  + +  +S++ LF  Y    G N +K
Sbjct  129  SETCGSFGVFCKKATASVSITFIVSLCYVGISLLSSYRLFSKYDAPIGQNNNK  181



>ref|XP_002986549.1| hypothetical protein SELMODRAFT_446616 [Selaginella moellendorffii]
 gb|EFJ12406.1| hypothetical protein SELMODRAFT_446616 [Selaginella moellendorffii]
Length=281

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 90/196 (46%), Gaps = 13/196 (7%)
 Frame = -3

Query  670  SPGNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQV-----------R  524
            S G  PV     +   +   R++ ++ R  +  L I+   L+  D +            R
Sbjct  11   SAGGSPVGDDRKMGDHEHEFRISIILLRSFLLVLVIISEALMVTDRETGSVPLPFFGLPR  70

Query  523  EIFSIRKKAKFTDMKALVFLVIANGLAAAYSLVQLV-RCSVSMIRGSVLFNKPLAWAIFS  347
             +F + K AK+  +  L F V A G+   Y+++ L+    +   +G+V+  K +AW  F 
Sbjct  71   PVF-VTKTAKYELVTGLKFYVDALGVVIGYTVLHLLFNIGLVATKGTVVDCKSVAWISFI  129

Query  346  GDQLMaylslgavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISM  167
             D +M YL L   A A +    A+ G   + W ++CN +G FC      +    I  +  
Sbjct  130  ADSMMGYLLLSGAAVATEIGYLAEEGAPAVLWRKVCNAFGYFCTVYAISVVICFIAALVS  189

Query  166  IILCGISAFSLFRLYG  119
             ++ GISA+ LFRLYG
Sbjct  190  FVVVGISAYHLFRLYG  205



>ref|XP_010498065.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 8/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  86   SL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C+ YG FC++    +  +  V    ++L  IS++ LF  +
Sbjct  142  WSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLFTRF  185



>ref|XP_009117714.1| PREDICTED: CASP-like protein At1g17200 [Brassica rapa]
Length=201

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 83/168 (49%), Gaps = 8/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V   +R AE + R    GL +   V++  DSQ  E  S+     ++++ A  +LV ANG+
Sbjct  23   VSTAIRTAETMLRLAPVGLCLAALVIMLKDSQNNEFGSV----SYSNLSAFWYLVHANGI  78

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  79   CAGYSLLS---AAIAAMPGSSS-TTPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  134

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            + + W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  135  NAITWSDACSSFGSFCHRATASVIITFVVVCLYVLLSLISSYKLFTRF  182



>ref|XP_004975109.1| PREDICTED: CASP-like protein 6-like [Setaria italica]
Length=209

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 9/174 (5%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            RVR  E + R    GL +    ++  D Q  E  ++     ++D+    +LV ANGL AA
Sbjct  34   RVRPVETLLRAAPLGLCVAAMAIMLKDQQTNEYGTV----AYSDLGGFKYLVYANGLCAA  89

Query  436  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  90   YSLVTAFYTAVP--RPATVSR---SWVVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  144

Query  256  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
             W   C ++G FC +    +A +    +  I+L  IS++ LF  Y    S   G
Sbjct  145  TWSEACGVFGVFCRKARTSVAITFGSVLCFILLSLISSYRLFSAYEAPPSSALG  198



>ref|XP_010459293.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=248

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 8/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  74   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLTAFRYLVHANGICAGY  129

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  130  SL--LSAAIAAMPRSSSTM--PRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  185

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C+ YG FC++    +  +  V    ++L  IS++ LF  +
Sbjct  186  WSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLFTRF  229



>ref|XP_006442224.1| hypothetical protein CICLE_v10022266mg [Citrus clementina]
 ref|XP_006477978.1| PREDICTED: CASP-like protein RCOM_0477780-like [Citrus sinensis]
 gb|ESR55464.1| hypothetical protein CICLE_v10022266mg [Citrus clementina]
 gb|KDO50478.1| hypothetical protein CISIN_1g028477mg [Citrus sinensis]
Length=208

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 86/177 (49%), Gaps = 10/177 (6%)
 Frame = -3

Query  622  DKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLA  443
            +  +R AE I R V   L +   VL+  +S+  +  S+     ++D+ A  +LV ANG+ 
Sbjct  33   NAALRTAEPIARLVPMALCVAALVLMLKNSETSDFGSL----SYSDLGAFRYLVHANGIC  88

Query  442  AAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQS  263
            A YSL+  +    +M R S +     AW  F  DQL+ YL L A A + +     + G  
Sbjct  89   AGYSLLSAII--AAMPRPSTMSQ---AWTFFFLDQLLTYLILAAGAVSTEVLYLERKGDL  143

Query  262  ELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNGR  92
             + W  +C  +G FC++    +  + +     ++L  IS++ LF  Y D    C+G+
Sbjct  144  AITWSAVCGSFGGFCHKAIASVIITFVAVACYVVLSLISSYKLFSKY-DAPIACSGK  199



>ref|XP_010476864.1| PREDICTED: CASP-like protein 2A1 [Camelina sativa]
Length=204

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 80/164 (49%), Gaps = 8/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R    GL +   V++  DS+  E  SI     ++++ A  +LV ANG+ A Y
Sbjct  30   MRTAETMLRLAPVGLCVAALVVMLKDSEDNEFGSI----SYSNLAAFRYLVHANGICAGY  85

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL  L     +M R S     P  W  F  DQL+ YL L A A +A+    A  G + + 
Sbjct  86   SL--LSAAIAAMPRSSS--TMPRVWTFFCLDQLLTYLVLAAGAVSAEVLYLAYNGDAAIT  141

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C+ YG FC++    +  +  V    ++L  IS++ LF  +
Sbjct  142  WSDACSSYGSFCHKATASVIITFFVVCFYVVLSLISSYKLFTRF  185



>gb|KDP40019.1| hypothetical protein JCGZ_02017 [Jatropha curcas]
Length=184

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 79/167 (47%), Gaps = 18/167 (11%)
 Frame = -3

Query  598  LIFRCVICGLAIVGAVLIGIDSQVREI----------FSIRKKAKFTDMKALVFLVIANG  449
            L  R V   L +  A+++G++ Q   +           +I   AK+  + A VF V++N 
Sbjct  23   LFLRAVALVLTLAAAIVLGVNKQSEVVPIKLVDSLPPLNIPVTAKWHHLSAFVFFVVSNA  82

Query  448  LAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIG  269
            +A +Y+ + L+ C            K +   I + D LM  L   ++ A     +    G
Sbjct  83   IACSYAAISLLLCFCG--------KKSMGAIIITLDLLMVALLFSSIGATTAIGLMGYKG  134

Query  268  QSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFR  128
             S ++W ++CN++G+FCNQ    I  SLI  I+ ++L  + A SL +
Sbjct  135  NSHVRWNKVCNVFGRFCNQGVAAIVLSLIAAIAFLLLVMLRALSLHK  181



>ref|NP_001131228.1| CASP-like protein 2A1 [Zea mays]
 sp|B4FBQ7.1|CSPL6_MAIZE RecName: Full=CASP-like protein 2A1; Short=ZmCASPL2A1; AltName: 
Full=Salicylic acid-induced protein 1-A [Zea mays]
 gb|ACF79550.1| unknown [Zea mays]
 gb|ACG42502.1| salicylic acid-induced fragment 1 protein [Zea mays]
 gb|ACG42633.1| salicylic acid-induced fragment 1 protein [Zea mays]
 gb|ACG48255.1| salicylic acid-induced fragment 1 protein [Zea mays]
Length=213

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 82/174 (47%), Gaps = 9/174 (5%)
 Frame = -3

Query  616  RVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAA  437
            RVR  E + R    GL +    ++  + Q  E  ++     ++D+    +LV ANGL AA
Sbjct  38   RVRPVETLLRAAPLGLCVAAMTVMLRNQQSNEYGAV----AYSDLGGFKYLVYANGLCAA  93

Query  436  YSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSEL  257
            YSLV     +V   R + +     +W +F  DQ+  YL L A AAAA+    A  G  E+
Sbjct  94   YSLVSAFYTAVP--RPATVSR---SWLVFLLDQVFTYLILAAGAAAAELLYLAYNGDKEV  148

Query  256  QWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLYGDNKSKCNG  95
             W   C ++G FC Q    +A +    +  I+L  IS++ LF  Y    S   G
Sbjct  149  TWSEACGVFGSFCRQARTSVAITFGTVLCFILLSLISSYRLFSAYEAPPSSALG  202



>ref|XP_010666392.1| PREDICTED: CASP-like protein Ni6 [Beta vulgaris subsp. vulgaris]
Length=194

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 6/183 (3%)
 Frame = -3

Query  664  GNVPVYHGSNLKVVDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSI----RKKA  497
            G VP      +   D + R+ ++I R ++   +I   VL+    Q   I S        A
Sbjct  9    GAVPTPQAPPVAPTDNKYRVVDVILRVLLLAASIASVVLMVTSKQTEIIVSPLGSRPNAA  68

Query  496  KFTDMKALVFLVIANGLAAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylsl  317
            KF +  A ++LV A  +A  YS++  +  S+S +   ++  K L W +   D L+  +  
Sbjct  69   KFQNSPAFIYLVAALSVAGLYSIITAL-VSLSYMMKPIVAPK-LFWILLIHDVLLLGIVA  126

Query  316  gavaaaaqsavyAKIGQSELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFS  137
             A   A         G + ++W +ICN+Y KFC  VG  I  SL   + +++L  ++A S
Sbjct  127  AATGTAGGVGYIGLKGNTHVRWGKICNVYDKFCRHVGASIIVSLFAAVVLVLLVFVNANS  186

Query  136  LFR  128
            L+R
Sbjct  187  LYR  189



>ref|XP_006366767.1| PREDICTED: CASP-like protein VIT_01s0010g01870-like [Solanum 
tuberosum]
Length=202

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 83/164 (51%), Gaps = 9/164 (5%)
 Frame = -3

Query  613  VRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGLAAAY  434
            +R AE + R +  GL +V  V++  + Q  +  SI     ++D+    +LV ANG+ A Y
Sbjct  29   MRTAETMLRLLPMGLCVVALVIMLKNQQTNDYGSI----TYSDLGTFRYLVHANGICAGY  84

Query  433  SLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQSELQ  254
            SL+  +   V+++   +  ++  AW  F  DQ++ Y  L A A + +    A  G + + 
Sbjct  85   SLLSAI---VAVVPRPITMSR--AWTFFLLDQILTYAILAAGAVSTEVVYLAYKGDTAVT  139

Query  253  WMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
            W   C  +G FC++    ++ + IVC+    L  +S++ LF  Y
Sbjct  140  WSESCGSFGSFCHKATASVSITFIVCLCYAGLSLLSSYRLFSKY  183



>emb|CDY26265.1| BnaA06g11520D [Brassica napus]
Length=204

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 81/168 (48%), Gaps = 8/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V   +R AE + R    GL +   V++  DSQ  E      +  ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNEY----GEVSYSNLTAFRYLVHANGI  81

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLFTRF  185



>ref|XP_009149166.1| PREDICTED: CASP-like protein At1g17200 isoform X1 [Brassica rapa]
Length=204

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 81/168 (48%), Gaps = 8/168 (5%)
 Frame = -3

Query  625  VDKRVRLAELIFRCVICGLAIVGAVLIGIDSQVREIFSIRKKAKFTDMKALVFLVIANGL  446
            V   +R AE + R    GL +   V++  DSQ  E   +     ++++ A  +LV ANG+
Sbjct  26   VSTGIRTAETMLRLAPVGLCVAALVIMLKDSQTNEYGDV----SYSNLTAFRYLVHANGI  81

Query  445  AAAYSLVQLVRCSVSMIRGSVLFNKPLAWAIFSGDQLMaylslgavaaaaqsavyAKIGQ  266
             A YSL+     +++ + GS     P  W  F  DQ++ Y+ L A A + +    A  G 
Sbjct  82   CAGYSLLS---AAIAAMPGSSS-TMPRVWTFFCLDQILTYVVLAAGAVSTEVLYLAYKGD  137

Query  265  SELQWMRICNMYGKFCNQVGEGIASSLIVCISMIILCGISAFSLFRLY  122
              + W   C+ +G FC++    +  + +V    ++L  IS++ LF  +
Sbjct  138  DAITWSDACSSFGSFCHKATASVIITFVVVCFYVVLSLISSYKLFTRF  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380