BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031P21

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011018830.1|  PREDICTED: caffeic acid 3-O-methyltransferase      310   4e-101   Populus euphratica
ref|XP_006381361.1|  hypothetical protein POPTR_0006s12160g             310   5e-101   
ref|XP_002264566.1|  PREDICTED: caffeic acid 3-O-methyltransferase      306   1e-99    Vitis vinifera
gb|KDP29212.1|  hypothetical protein JCGZ_16601                         305   5e-99    Jatropha curcas
ref|XP_006291371.1|  hypothetical protein CARUB_v10017511mg             304   1e-98    Capsella rubella
ref|XP_010515802.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    302   5e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010546519.1|  PREDICTED: flavone 3'-O-methyltransferase 1        302   5e-98    Tarenaya hassleriana [spider flower]
emb|CDX95399.1|  BnaC04g27590D                                          301   1e-97    
emb|CDY70033.1|  BnaCnng66420D                                          296   1e-97    Brassica napus [oilseed rape]
gb|KHN47498.1|  Caffeic acid 3-O-methyltransferase                      300   2e-97    Glycine soja [wild soybean]
ref|XP_006598126.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    300   2e-97    Glycine max [soybeans]
ref|XP_010504072.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    301   2e-97    Camelina sativa [gold-of-pleasure]
emb|CAN65776.1|  hypothetical protein VITISV_030414                     300   3e-97    Vitis vinifera
ref|XP_010267318.1|  PREDICTED: caffeic acid 3-O-methyltransferase      300   5e-97    Nelumbo nucifera [Indian lotus]
ref|XP_006403721.1|  hypothetical protein EUTSA_v10010488mg             300   5e-97    Eutrema salsugineum [saltwater cress]
ref|XP_009139429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      299   6e-97    Brassica rapa
ref|XP_002519426.1|  o-methyltransferase, putative                      299   9e-97    Ricinus communis
ref|XP_008241354.1|  PREDICTED: caffeic acid 3-O-methyltransferase      299   1e-96    Prunus mume [ume]
ref|XP_006391885.1|  hypothetical protein EUTSA_v10023542mg             298   3e-96    Eutrema salsugineum [saltwater cress]
gb|KFK34550.1|  hypothetical protein AALP_AA5G160800                    298   3e-96    Arabis alpina [alpine rockcress]
ref|XP_010426946.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    297   5e-96    Camelina sativa [gold-of-pleasure]
ref|XP_007202084.1|  hypothetical protein PRUPE_ppa007420mg             297   7e-96    Prunus persica
ref|NP_190882.1|  putative O-diphenol-O-methyl transferase              296   1e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KCW89310.1|  hypothetical protein EUGRSUZ_A01600                     293   2e-95    Eucalyptus grandis [rose gum]
ref|XP_010050337.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    295   2e-95    Eucalyptus grandis [rose gum]
gb|KCW89309.1|  hypothetical protein EUGRSUZ_A01600                     295   3e-95    Eucalyptus grandis [rose gum]
ref|XP_006594704.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    294   5e-95    
gb|KJB62320.1|  hypothetical protein B456_009G411600                    294   6e-95    Gossypium raimondii
ref|XP_008387516.1|  PREDICTED: caffeic acid 3-O-methyltransferase      291   7e-95    
ref|XP_009341082.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    293   3e-94    Pyrus x bretschneideri [bai li]
ref|XP_009341081.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    293   4e-94    Pyrus x bretschneideri [bai li]
ref|XP_009617330.1|  PREDICTED: flavone 3'-O-methyltransferase 1        291   8e-94    Nicotiana tomentosiformis
ref|XP_010098845.1|  Caffeic acid 3-O-methyltransferase                 291   1e-93    Morus notabilis
ref|XP_007149437.1|  hypothetical protein PHAVU_005G070300g             290   2e-93    Phaseolus vulgaris [French bean]
gb|KHG05883.1|  Caffeic acid 3-O-methyltransferase                      289   6e-93    Gossypium arboreum [tree cotton]
ref|XP_010312333.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    289   6e-93    Solanum lycopersicum
ref|XP_004304330.1|  PREDICTED: caffeic acid 3-O-methyltransferase      288   2e-92    Fragaria vesca subsp. vesca
ref|XP_006367254.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    287   3e-92    Solanum tuberosum [potatoes]
ref|XP_007027514.1|  O-methyltransferase family protein                 285   4e-91    
gb|KEH38506.1|  caffeic acid O-methyltransferase                        284   6e-91    Medicago truncatula
ref|XP_004488687.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    283   1e-90    Cicer arietinum [garbanzo]
gb|KGN59032.1|  hypothetical protein Csa_3G747630                       277   3e-88    Cucumis sativus [cucumbers]
ref|XP_010683979.1|  PREDICTED: caffeic acid 3-O-methyltransferase      276   1e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008442758.1|  PREDICTED: caffeic acid 3-O-methyltransferase      273   1e-86    Cucumis melo [Oriental melon]
ref|XP_011101458.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    271   7e-86    Sesamum indicum [beniseed]
ref|XP_004137858.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    273   7e-86    
ref|XP_010935841.1|  PREDICTED: quercetin 3-O-methyltransferase 1...    267   9e-84    Elaeis guineensis
ref|XP_009382782.1|  PREDICTED: caffeic acid 3-O-methyltransferase      263   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO39806.1|  hypothetical protein CISIN_1g025363mg                   257   1e-81    Citrus sinensis [apfelsine]
emb|CBI30187.3|  unnamed protein product                                253   1e-81    Vitis vinifera
gb|KJB62323.1|  hypothetical protein B456_009G411600                    259   3e-81    Gossypium raimondii
ref|XP_006436414.1|  hypothetical protein CICLE_v10033543mg             257   6e-81    Citrus clementina [clementine]
ref|XP_006367255.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    258   9e-81    Solanum tuberosum [potatoes]
ref|XP_006451708.1|  hypothetical protein CICLE_v10010561mg             254   4e-80    
ref|XP_006485837.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    254   2e-79    Citrus sinensis [apfelsine]
ref|XP_003572969.1|  PREDICTED: caffeic acid 3-O-methyltransferase      253   5e-79    Brachypodium distachyon [annual false brome]
gb|ACN25427.1|  unknown                                                 251   5e-78    Zea mays [maize]
dbj|BAJ96291.1|  predicted protein                                      251   5e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAP03056.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    245   8e-78    Limonium latifolium
ref|XP_011098295.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    249   1e-77    Sesamum indicum [beniseed]
gb|AAP03055.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    245   3e-77    Limonium latifolium
ref|NP_001149617.1|  LOC100283243                                       249   3e-77    
ref|NP_001048569.1|  Os02g0823400                                       249   3e-77    
ref|XP_002453074.1|  hypothetical protein SORBIDRAFT_04g037820          248   7e-77    Sorghum bicolor [broomcorn]
gb|KDO39208.1|  hypothetical protein CISIN_1g041308mg                   244   1e-76    Citrus sinensis [apfelsine]
ref|XP_004954455.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    247   1e-76    Setaria italica
gb|AAP03058.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    248   1e-76    Limonium latifolium
emb|CAB65279.1|  O-diphenol-O-methyl transferase                        245   9e-76    Medicago sativa subsp. x varia
ref|XP_004502926.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    244   1e-75    Cicer arietinum [garbanzo]
ref|XP_011101457.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    244   1e-75    
gb|AAP03057.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    238   3e-75    Limonium latifolium
gb|AES72848.2|  caffeic acid O-methyltransferase                        242   8e-75    Medicago truncatula
ref|XP_006451875.1|  hypothetical protein CICLE_v10010158mg             238   9e-75    Citrus clementina [clementine]
ref|XP_003602597.1|  Caffeic acid 3-O-methyltransferase                 241   2e-74    
ref|XP_003602595.1|  Caffeic acid 3-O-methyltransferase                 240   7e-74    Medicago truncatula
ref|XP_006649184.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    236   6e-73    
gb|AAP03051.1|  S-adenosyl-L-methionine: beta-alanine N-methyltra...    230   2e-72    Limonium latifolium
ref|XP_006423903.1|  hypothetical protein CICLE_v10029876mg             231   5e-71    
ref|XP_006432602.1|  hypothetical protein CICLE_v10002505mg             226   3e-70    
gb|KDO38249.1|  hypothetical protein CISIN_1g043063mg                   226   3e-69    Citrus sinensis [apfelsine]
gb|KDO41959.1|  hypothetical protein CISIN_1g021707mg                   218   7e-66    Citrus sinensis [apfelsine]
ref|XP_009787879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    201   7e-62    Nicotiana sylvestris
ref|XP_006425490.1|  hypothetical protein CICLE_v10027189mg             204   1e-60    
gb|EEC74273.1|  hypothetical protein OsI_09508                          205   2e-60    Oryza sativa Indica Group [Indian rice]
ref|XP_006441597.1|  hypothetical protein CICLE_v10023355mg             190   1e-56    
ref|XP_006838729.1|  hypothetical protein AMTR_s00002p00253410          194   3e-56    Amborella trichopoda
gb|EMT14045.1|  Caffeic acid 3-O-methyltransferase                      189   7e-56    
ref|XP_002988275.1|  caffeic acid O-methyltransferase                   182   2e-51    Selaginella moellendorffii
ref|XP_002963872.1|  caffeic acid O-methyltransferase                   181   2e-51    Selaginella moellendorffii
gb|AAA80579.1|  3' flavonoid O-methyltransferase                        180   5e-51    Chrysosplenium americanum [water-carpet]
ref|XP_009392797.1|  PREDICTED: flavone O-methyltransferase 1-like      181   7e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008380838.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    181   8e-51    Malus domestica [apple tree]
gb|ABI54118.1|  caffeic acid O-methyltransferase                        180   9e-51    Malus domestica [apple tree]
emb|CBI23095.3|  unnamed protein product                                176   1e-50    Vitis vinifera
gb|KJB23958.1|  hypothetical protein B456_004G125600                    179   1e-50    Gossypium raimondii
ref|XP_006478090.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    180   2e-50    Citrus sinensis [apfelsine]
gb|ADK97702.1|  putative caffeic acid O-methyltransferase               180   2e-50    Citrus aurantium [bitter orange]
ref|XP_008362842.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   2e-50    
ref|XP_008382714.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   2e-50    
gb|KJB23954.1|  hypothetical protein B456_004G125600                    179   2e-50    Gossypium raimondii
gb|ABI54117.1|  caffeic acid O-methyltransferase                        179   2e-50    Malus domestica [apple tree]
gb|ACT32029.1|  caffeic acid O-methyltransferase 2                      179   3e-50    Gossypium hirsutum [American cotton]
ref|XP_009418616.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    179   4e-50    Musa acuminata subsp. malaccensis [pisang utan]
gb|ADN27527.1|  caffeic acid O-methyltransferase                        179   4e-50    Camellia sinensis [black tea]
ref|XP_007218166.1|  hypothetical protein PRUPE_ppa007511mg             179   4e-50    
gb|AGS49204.1|  O-methyltransferase                                     178   5e-50    Zea mays [maize]
ref|XP_008381500.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    180   5e-50    
gb|KHG13289.1|  Caffeic acid 3-O-methyltransferase                      178   5e-50    Gossypium arboreum [tree cotton]
gb|ACN41351.2|  putative caffeic acid O-methyltransferase               178   6e-50    Betula pendula [white birch]
gb|AGG91492.1|  caffeic acid 3-O-methyltransferase                      178   6e-50    Betula platyphylla [Asian white birch]
ref|XP_010671332.1|  PREDICTED: caffeic acid 3-O-methyltransferase      178   6e-50    Beta vulgaris subsp. vulgaris [field beet]
gb|AGS49202.1|  O-methyltransferase                                     178   7e-50    Zea mays [maize]
gb|AHM25237.1|  noraucuparin O-methyltransferase                        178   8e-50    Sorbus aucuparia [European mountain ash]
gb|AGS49209.1|  O-methyltransferase                                     177   1e-49    Zea mays [maize]
ref|XP_008234634.1|  PREDICTED: caffeic acid 3-O-methyltransferase      177   1e-49    Prunus mume [ume]
sp|Q43609.1|COMT1_PRUDU  RecName: Full=Caffeic acid 3-O-methyltra...    177   1e-49    Prunus dulcis [sweet almond]
ref|XP_007218167.1|  hypothetical protein PRUPE_ppa007511mg             177   1e-49    Prunus persica
gb|AID68566.1|  caffeic O-methyltransferase                             177   1e-49    Punica granatum [granado]
gb|AGO50639.1|  caffeic acid O-methyltransferase                        177   1e-49    Linum usitatissimum
gb|AIJ28474.1|  O-methyltransferase                                     177   1e-49    Vaccinium corymbosum [American blueberry]
ref|XP_004156527.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   1e-49    
ref|XP_004137204.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    177   1e-49    Cucumis sativus [cucumbers]
gb|KDO42947.1|  hypothetical protein CISIN_1g030025mg                   172   2e-49    Citrus sinensis [apfelsine]
ref|XP_010662844.1|  PREDICTED: caffeic acid O-methyltransferase ...    177   2e-49    Vitis vinifera
gb|AGS49189.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|ABI54119.1|  caffeic acid O-methyltransferase                        177   2e-49    Malus domestica [apple tree]
ref|XP_002525818.1|  o-methyltransferase, putative                      177   2e-49    Ricinus communis
gb|ABS57468.1|  caffeic acid O-methyl transferase                       177   2e-49    Leucaena leucocephala [cassie]
gb|AGS49206.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
ref|XP_006478221.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   2e-49    Citrus sinensis [apfelsine]
gb|AGS49190.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|ABI54120.1|  caffeic acid O-methyltransferase                        177   2e-49    Malus domestica [apple tree]
ref|XP_008462913.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    177   2e-49    Cucumis melo [Oriental melon]
gb|AGS49215.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AGS49205.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AGS49191.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AGF25396.1|  caffeic acid 3-O-methyltransferase                      177   2e-49    Zea nicaraguensis
sp|Q06509.1|COMT1_MAIZE  RecName: Full=Caffeic acid 3-O-methyltra...    177   2e-49    Zea mays [maize]
ref|NP_001106047.1|  catechol O-methyltransferase                       177   2e-49    Zea mays [maize]
gb|AGS49187.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
ref|XP_010934913.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    177   2e-49    Elaeis guineensis
gb|AAQ24337.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AGS49195.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AGS49185.1|  O-methyltransferase                                     177   2e-49    Zea mays [maize]
gb|AAQ24338.1|  O-methyltransferase                                     176   3e-49    Zea mays [maize]
ref|NP_001268100.1|  caffeic acid O-methyltransferase                   177   3e-49    Vitis vinifera
gb|ADR31603.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    172   3e-49    Populus trichocarpa [western balsam poplar]
gb|KHN23296.1|  Caffeic acid 3-O-methyltransferase                      176   3e-49    Glycine soja [wild soybean]
ref|XP_006441599.1|  hypothetical protein CICLE_v10020870mg             176   4e-49    Citrus clementina [clementine]
gb|KDP30064.1|  hypothetical protein JCGZ_18389                         176   4e-49    Jatropha curcas
gb|ADR31598.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    172   4e-49    Populus trichocarpa [western balsam poplar]
ref|XP_010918594.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    176   4e-49    Elaeis guineensis
gb|ACT87981.1|  caffeic acid O-methyltransferase                        176   5e-49    Jatropha curcas
gb|AGS49181.1|  O-methyltransferase                                     176   5e-49    Zea mays [maize]
gb|ADR31595.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    172   5e-49    Populus trichocarpa [western balsam poplar]
gb|AAQ24339.1|  O-methyltransferase                                     176   5e-49    Zea mays [maize]
gb|AGS49196.1|  O-methyltransferase                                     176   5e-49    Zea mays [maize]
gb|ADR31604.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    171   5e-49    Populus trichocarpa [western balsam poplar]
gb|AGS49211.1|  O-methyltransferase                                     176   5e-49    Zea mays [maize]
gb|AGS49210.1|  O-methyltransferase                                     176   6e-49    Zea mays [maize]
gb|AIY22648.1|  caffeic acid 3-O-methyl transferase                     172   6e-49    Saccharum arundinaceum
gb|AGJ84131.1|  putative caffeic acid O-methyltransferase               176   6e-49    Hibiscus cannabinus [bimli-jute]
gb|ABG27066.1|  caffeic acid O-methyltransferase                        176   7e-49    Boehmeria nivea [Chinese silk-plant]
ref|XP_006441596.1|  hypothetical protein CICLE_v10023568mg             175   7e-49    Citrus clementina [clementine]
sp|Q8GU25.1|COMT1_ROSCH  RecName: Full=Caffeic acid 3-O-methyltra...    175   9e-49    Rosa chinensis [China rose]
gb|AAQ24342.1|  O-methyltransferase                                     175   9e-49    Zea mays [maize]
gb|AAQ24344.1|  O-methyltransferase                                     175   9e-49    Zea mays [maize]
gb|AAQ24345.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AAQ24348.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AAQ24351.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AAQ24343.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AAQ24361.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AGS49183.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
gb|AGS49184.1|  O-methyltransferase                                     175   1e-48    Zea mays [maize]
ref|XP_007136428.1|  hypothetical protein PHAVU_009G044400g             175   1e-48    Phaseolus vulgaris [French bean]
dbj|BAG71895.1|  5-hydroxyconiferaldehyde O-methyltransferase           174   1e-48    Carthamus tinctorius
gb|AAZ32409.1|  S-methyltransferase                                     174   1e-48    Catharanthus roseus [chatas]
gb|AAY86361.1|  caffeic acid O-methyltransferase                        175   1e-48    Acacia auriculiformis x Acacia mangium
ref|XP_009608171.1|  PREDICTED: caffeic acid 3-O-methyltransferase      174   1e-48    
gb|AIY22649.1|  caffeic acid 3-O-methyl transferase                     170   2e-48    Saccharum arundinaceum
gb|KDP36008.1|  hypothetical protein JCGZ_10407                         174   2e-48    Jatropha curcas
gb|AGS49200.1|  O-methyltransferase                                     174   2e-48    Zea mays [maize]
ref|XP_010934981.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   2e-48    
gb|AAQ24355.1|  O-methyltransferase                                     174   2e-48    Zea mays [maize]
gb|AGS49188.1|  O-methyltransferase                                     174   2e-48    Zea mays [maize]
gb|AGS49219.1|  O-methyltransferase                                     174   2e-48    Zea mays [maize]
gb|AGS49197.1|  O-methyltransferase                                     174   2e-48    Zea mays [maize]
sp|Q43046.1|COMT1_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    174   2e-48    Populus sieboldii x Populus grandidentata
gb|AGS49207.1|  O-methyltransferase                                     174   3e-48    Zea mays [maize]
ref|XP_006441468.1|  hypothetical protein CICLE_v10020874mg             174   3e-48    Citrus clementina [clementine]
gb|AEI54336.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    174   3e-48    Glycine max [soybeans]
gb|AFK40372.1|  unknown                                                 174   3e-48    Lotus japonicus
gb|AGS49213.1|  O-methyltransferase                                     174   3e-48    Zea mays [maize]
gb|AGS49198.1|  O-methyltransferase                                     174   4e-48    Zea mays [maize]
gb|AGS49216.1|  O-methyltransferase                                     173   4e-48    Zea mays [maize]
ref|XP_003526767.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    173   4e-48    Glycine max [soybeans]
ref|XP_008803442.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   4e-48    
dbj|BAK42963.1|  caffeic acid O-methylltransferase                      173   4e-48    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|EMT30204.1|  Caffeic acid 3-O-methyltransferase                      172   4e-48    
ref|XP_006420931.1|  hypothetical protein CICLE_v10005230mg             173   5e-48    Citrus clementina [clementine]
gb|AGS49186.1|  O-methyltransferase                                     173   5e-48    Zea mays [maize]
ref|XP_010537046.1|  PREDICTED: flavone 3'-O-methyltransferase 1        173   5e-48    Tarenaya hassleriana [spider flower]
ref|NP_001266643.1|  quercetin 3-O-methyltransferase 1                  173   5e-48    
ref|XP_010478733.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    173   5e-48    Camelina sativa [gold-of-pleasure]
gb|AGS49199.1|  O-methyltransferase                                     173   5e-48    Zea mays [maize]
ref|NP_001240003.1|  uncharacterized protein LOC100780100               173   6e-48    Glycine max [soybeans]
emb|CDY18302.1|  BnaC09g30520D                                          168   6e-48    Brassica napus [oilseed rape]
ref|XP_010934914.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    173   7e-48    Elaeis guineensis
ref|XP_008803441.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    173   7e-48    Phoenix dactylifera
gb|EYU31472.1|  hypothetical protein MIMGU_mgv1a019059mg                169   7e-48    Erythranthe guttata [common monkey flower]
sp|P59049.1|OMT1_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    172   7e-48    Chrysosplenium americanum [water-carpet]
ref|NP_001242325.1|  uncharacterized protein LOC100805999               172   8e-48    
gb|AFZ78575.1|  caffeic acid O-methyltransferase                        172   8e-48    Populus tomentosa [Chinese white poplar]
gb|AEW26161.1|  caffeic acid-O-methyltransferase                        169   8e-48    Medicago sativa subsp. x varia
gb|ADB82906.1|  caffeic O-methyltransferase1                            172   9e-48    Eucalyptus camaldulensis
ref|XP_003634161.1|  PREDICTED: caffeic acid 3-O-methyltransferase      172   9e-48    Vitis vinifera
gb|AGS49182.1|  O-methyltransferase                                     172   9e-48    Zea mays [maize]
ref|XP_010048429.1|  PREDICTED: caffeic acid 3-O-methyltransferase      172   9e-48    Eucalyptus grandis [rose gum]
gb|AAD48913.1|AF139533_1  caffeate O-methyltransferase                  172   9e-48    Liquidambar styraciflua [American sweet gum]
ref|XP_009757562.1|  PREDICTED: caffeic acid 3-O-methyltransferase      172   1e-47    Nicotiana sylvestris
ref|XP_010520935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-47    Tarenaya hassleriana [spider flower]
gb|ACY66932.1|  caffeic O-methyltransferase 1                           172   1e-47    Eucalyptus camaldulensis
emb|CDY19037.1|  BnaC01g20310D                                          172   1e-47    Brassica napus [oilseed rape]
gb|AGS49194.1|  O-methyltransferase                                     172   1e-47    Zea mays [maize]
ref|XP_008357058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-47    Malus domestica [apple tree]
ref|XP_004502769.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    172   1e-47    Cicer arietinum [garbanzo]
ref|XP_002317838.1|  Chain A family protein                             172   1e-47    Populus trichocarpa [western balsam poplar]
sp|Q00763.1|COMT1_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    172   1e-47    Populus tremuloides
gb|AEV93478.1|  caffeic acid O-methyltransferase                        172   1e-47    Caragana korshinskii
ref|XP_007039215.1|  Caffeic acid 3-O-methyltransferase 1               172   1e-47    
gb|ADX98508.1|  caffeic acid 3-O-methyltransferase                      172   2e-47    Panicum virgatum
gb|AEW26209.1|  caffeic acid-O-methyltransferase                        168   2e-47    Medicago sativa subsp. caerulea
ref|XP_006478222.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   2e-47    Citrus sinensis [apfelsine]
ref|XP_006478347.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   2e-47    
gb|AGS49214.1|  O-methyltransferase                                     172   2e-47    Zea mays [maize]
dbj|BAC78827.1|  caffeic acid O-methyltransferase                       172   2e-47    Rosa chinensis var. spontanea
sp|Q42653.1|OMT2_CHRAE  RecName: Full=Quercetin 3-O-methyltransfe...    171   2e-47    Chrysosplenium americanum [water-carpet]
ref|XP_006478226.1|  PREDICTED: anthranilate N-methyltransferase-...    172   2e-47    
gb|KJB52492.1|  hypothetical protein B456_008G264900                    172   2e-47    Gossypium raimondii
ref|NP_001289246.1|  caffeic acid 3-O-methyltransferase                 172   2e-47    Pyrus x bretschneideri [bai li]
gb|KHG13754.1|  Caffeic acid 3-O-methyltransferase                      172   2e-47    Gossypium arboreum [tree cotton]
ref|XP_006441603.1|  hypothetical protein CICLE_v10020875mg             171   2e-47    Citrus clementina [clementine]
ref|XP_006478241.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    173   2e-47    
gb|AEW26163.1|  caffeic acid-O-methyltransferase                        167   2e-47    Medicago sativa subsp. x varia
ref|XP_006485822.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   2e-47    
ref|XP_009395003.1|  PREDICTED: flavone O-methyltransferase 1-like      172   2e-47    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006442372.1|  hypothetical protein CICLE_v10020761mg             171   3e-47    Citrus clementina [clementine]
gb|KHN19569.1|  Caffeic acid 3-O-methyltransferase                      167   3e-47    Glycine soja [wild soybean]
gb|AFM73597.1|  caffeate O-methyltransferase                            169   3e-47    Populus simonii
gb|AGS49217.1|  O-methyltransferase                                     171   3e-47    Zea mays [maize]
ref|XP_011003285.1|  PREDICTED: caffeic acid 3-O-methyltransferase 3    171   3e-47    Populus euphratica
ref|XP_006477839.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   3e-47    Citrus sinensis [apfelsine]
ref|XP_009361272.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   3e-47    
gb|AAF28353.1|AF220491_1  O-methyltransferase                           171   4e-47    Fragaria x ananassa
gb|AAQ67347.1|  caffeic acid 3-O-methyltransferase                      171   4e-47    Saccharum hybrid cultivar [sugarcane]
sp|P46484.1|COMT1_EUCGU  RecName: Full=Caffeic acid 3-O-methyltra...    171   4e-47    Eucalyptus gunnii
gb|AGS49192.1|  O-methyltransferase                                     171   4e-47    Zea mays [maize]
ref|XP_004307899.1|  PREDICTED: caffeic acid 3-O-methyltransferase      171   4e-47    Fragaria vesca subsp. vesca
gb|KDO41090.1|  hypothetical protein CISIN_1g018681mg                   171   4e-47    Citrus sinensis [apfelsine]
ref|XP_004972800.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   4e-47    Setaria italica
ref|XP_003559686.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    171   5e-47    Brachypodium distachyon [annual false brome]
ref|XP_009361274.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   5e-47    Pyrus x bretschneideri [bai li]
sp|O82054.1|COMT1_SACOF  RecName: Full=Caffeic acid 3-O-methyltra...    171   5e-47    Saccharum officinarum [noble cane]
ref|XP_009361271.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   5e-47    Pyrus x bretschneideri [bai li]
gb|KEH20132.1|  caffeic acid O-methyltransferase                        171   5e-47    Medicago truncatula
dbj|BAO79382.1|  hypothetical plant O-methyltransferase                 171   5e-47    Anthriscus sylvestris
ref|XP_010527383.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    171   5e-47    Tarenaya hassleriana [spider flower]
gb|KCW89068.1|  hypothetical protein EUGRSUZ_A01397                     172   6e-47    Eucalyptus grandis [rose gum]
gb|ADI24332.1|  caffeic acid 3-O-methyltransferase                      170   6e-47    Miscanthus sinensis
ref|XP_008376828.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    170   7e-47    Malus domestica [apple tree]
ref|XP_002864309.1|  O-methyltransferase 1                              170   7e-47    
prf||1906376A  O-methyltransferase                                      170   8e-47 
ref|XP_010035325.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    170   9e-47    Eucalyptus grandis [rose gum]
gb|AAF60951.1|  O-methyltransferase                                     170   9e-47    Populus trichocarpa x Populus deltoides
ref|XP_002518944.1|  o-methyltransferase, putative                      167   9e-47    
gb|KCW90804.1|  hypothetical protein EUGRSUZ_A02870                     169   1e-46    Eucalyptus grandis [rose gum]
ref|XP_010061962.1|  PREDICTED: caffeic acid 3-O-methyltransferase      170   1e-46    Eucalyptus grandis [rose gum]
gb|AEO14871.1|  caffeic acid O-methyltransferase                        170   1e-46    Salvia miltiorrhiza [Chinese salvia]
ref|XP_011043758.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    170   1e-46    Populus euphratica
gb|AGS49208.1|  O-methyltransferase                                     169   1e-46    
ref|XP_009361268.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   1e-46    
gb|AFK34973.1|  unknown                                                 164   1e-46    
gb|KHN06374.1|  Anthranilate N-methyltransferase                        170   1e-46    
ref|XP_010482824.1|  PREDICTED: flavone 3'-O-methyltransferase 1        169   1e-46    
ref|XP_002893750.1|  O-methyltransferase family 2 protein               169   1e-46    
ref|XP_003528760.1|  PREDICTED: anthranilate N-methyltransferase        169   1e-46    
sp|P28002.1|COMT1_MEDSA  RecName: Full=Caffeic acid 3-O-methyltra...    169   1e-46    
gb|ACY06328.1|  S-adenosyl-L-methionine: caffeic acid 3-0-methylt...    169   1e-46    
ref|XP_002321948.1|  Chain A family protein                             169   1e-46    
gb|ACJ76442.1|  caffeic acid 3-O-methyltransferase 2                    169   2e-46    
gb|ABU53653.1|  caffeic acid O-3-methyltransferase                      169   2e-46    
sp|Q9XGW0.1|COMT1_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    169   2e-46    
gb|KFK27028.1|  hypothetical protein AALP_AA8G324800                    169   2e-46    
ref|XP_008376825.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   2e-46    
ref|XP_006829216.1|  hypothetical protein AMTR_s00001p00272250          169   2e-46    
dbj|BAE94403.1|  Caffeic acid 3-O-methyltransferase                     169   2e-46    
ref|NP_200227.1|  caffeic acid/5-hydroxyferulic acid O-methyltran...    169   2e-46    
ref|XP_003626614.1|  Caffeic acid 3-O-methyltransferase                 169   2e-46    
gb|AAG43822.1|AF212316_1  caffeic acid O-methyltransferase              169   2e-46    
ref|XP_011084579.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    168   2e-46    
sp|Q41086.1|COMT2_POPTM  RecName: Full=Caffeic acid 3-O-methyltra...    169   2e-46    
ref|XP_010696333.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   2e-46    
gb|AEW26176.1|  caffeic acid-O-methyltransferase                        165   2e-46    
ref|XP_003626617.1|  Caffeic acid 3-O-methyltransferase                 169   2e-46    
ref|XP_010442991.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    169   2e-46    
gb|AID69230.1|  caffeic acid O-methyltransferase                        164   2e-46    
ref|XP_009119948.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    169   3e-46    
ref|XP_007139032.1|  hypothetical protein PHAVU_009G259300g             169   3e-46    
ref|XP_009388361.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   3e-46    
gb|AFQ94040.1|  monolignol 4-O-methyltransferase 4                      169   3e-46    
ref|XP_006428523.1|  hypothetical protein CICLE_v10013676mg             160   3e-46    
ref|XP_007139027.1|  hypothetical protein PHAVU_009G258800g             169   3e-46    
ref|XP_006280681.1|  hypothetical protein CARUB_v10026645mg             169   3e-46    
sp|O04385.2|IEMT_CLABR  RecName: Full=(Iso)eugenol O-methyltransf...    169   3e-46    
ref|XP_010034911.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    169   3e-46    
pdb|3REO|A  Chain A, Monolignol O-Methyltransferase (Momt)              169   3e-46    
gb|AEO14870.1|  caffeic acid O-methyltransferase                        169   3e-46    
gb|AFK35470.1|  unknown                                                 168   3e-46    
ref|XP_008382917.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   3e-46    
ref|XP_008376824.1|  PREDICTED: caffeic acid 3-O-methyltransferase      168   3e-46    
sp|Q43047.1|COMT3_POPKI  RecName: Full=Caffeic acid 3-O-methyltra...    168   3e-46    
ref|XP_006305218.1|  hypothetical protein CARUB_v10009584mg             168   3e-46    
ref|XP_008347272.1|  PREDICTED: caffeic acid 3-O-methyltransferase      168   3e-46    
gb|AAC18863.1|  caffeic acid 3-O-methyltransferase                      168   3e-46    
gb|KDP32876.1|  hypothetical protein JCGZ_12168                         168   3e-46    
ref|XP_004494877.1|  PREDICTED: anthranilate N-methyltransferase-...    168   4e-46    
ref|XP_010446534.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    168   4e-46    
dbj|BAJ34520.1|  unnamed protein product                                168   4e-46    
gb|KDP32878.1|  hypothetical protein JCGZ_12170                         168   4e-46    
sp|O23760.1|COMT1_CLABR  RecName: Full=Caffeic acid 3-O-methyltra...    168   4e-46    
ref|XP_010461123.1|  PREDICTED: quercetin 3-O-methyltransferase 1       168   5e-46    
ref|XP_003602396.1|  Caffeic acid O-methyltransferase                   168   5e-46    
gb|AFK42771.1|  unknown                                                 168   5e-46    
gb|ADR31597.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    162   5e-46    
ref|XP_010048400.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    168   5e-46    
gb|AAN03726.1|  caffeic acid O-methyltransferase                        167   6e-46    
gb|ACF04799.1|  caffeic acid 3-O-methytransferase                       168   6e-46    
dbj|BAE94400.1|  Caffeic acid 3-O-methyltransferase                     168   6e-46    
ref|XP_008788729.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    168   6e-46    
gb|AAB96879.1|  O-methyltransferase 1                                   167   7e-46    
gb|ACT32028.1|  caffeic acid O-methyltransferase 1                      167   7e-46    
ref|XP_009398124.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   7e-46    
ref|XP_009802353.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   8e-46    
emb|CDY18306.1|  BnaC09g30560D                                          167   9e-46    
ref|XP_006401613.1|  hypothetical protein EUTSA_v10013897mg             167   9e-46    
gb|AFK39235.1|  unknown                                                 167   9e-46    
ref|XP_007139029.1|  hypothetical protein PHAVU_009G259000g             167   9e-46    
ref|XP_006442371.1|  hypothetical protein CICLE_v10024037mg             167   9e-46    
gb|KDP35860.1|  hypothetical protein JCGZ_10599                         167   1e-45    
emb|CAA52462.1|  catechol O-methyltransferase                           167   1e-45    
ref|NP_174579.1|  O-methyltransferase-like protein                      167   1e-45    
gb|AFZ78574.1|  caffeic acid O-methyltransferase                        167   1e-45    
ref|XP_003528001.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    167   1e-45    
gb|AAF63200.1|  caffeic acid O-3-methyltransferase                      167   1e-45    
ref|XP_006413044.1|  hypothetical protein EUTSA_v10027501mg             166   2e-45    
gb|AFK39562.1|  unknown                                                 166   2e-45    
ref|XP_007139030.1|  hypothetical protein PHAVU_009G259100g             166   2e-45    
ref|XP_002864307.1|  O-methyltransferase 1                              166   2e-45    
gb|EPS64988.1|  hypothetical protein M569_09791                         166   2e-45    
sp|O81646.1|COMT1_CAPCH  RecName: Full=Caffeic acid 3-O-methyltra...    166   2e-45    
gb|AGS49203.1|  O-methyltransferase                                     166   3e-45    
dbj|BAD18975.1|  phloroglucinol O-methyltransferase                     166   3e-45    
ref|XP_010520934.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    166   3e-45    
ref|XP_002869549.1|  hypothetical protein ARALYDRAFT_354029             166   3e-45    
sp|Q9FQY8.2|COMT1_CAPAN  RecName: Full=Caffeic acid 3-O-methyltra...    166   3e-45    
gb|ADO16247.1|  caffeic acid O-methyltransferase                        166   4e-45    
sp|Q9XGV9.1|COMT2_OCIBA  RecName: Full=Caffeic acid 3-O-methyltra...    166   4e-45    
ref|XP_010241050.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    166   4e-45    
ref|XP_009119951.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    166   4e-45    
gb|ABI54121.1|  caffeic acid O-methyltransferase                        161   4e-45    
sp|A8J6X1.1|BMT_GLELI  RecName: Full=Bergaptol O-methyltransferas...    165   4e-45    
emb|CDY43839.1|  BnaC03g14720D                                          165   6e-45    
ref|XP_009132451.1|  PREDICTED: flavone 3'-O-methyltransferase 1        165   6e-45    
emb|CAA52461.1|  catechol O-methyltransferase                           165   6e-45    
ref|XP_011084580.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   6e-45    
sp|Q8LL87.1|COMT1_COFCA  RecName: Full=Caffeic acid 3-O-methyltra...    164   7e-45    
ref|XP_011075886.1|  PREDICTED: LOW QUALITY PROTEIN: caffeic acid...    165   8e-45    
gb|AAK68907.1|  caffeic acid O-methyltransferase                        165   8e-45    
ref|XP_006415131.1|  hypothetical protein EUTSA_v10008040mg             164   8e-45    
gb|EAY85717.1|  hypothetical protein OsI_07085                          164   9e-45    
gb|AAQ01670.1|  catechol O-methyltransferase                            164   9e-45    
gb|EMS55685.1|  Tricetin 3',4',5'-O-trimethyltransferase                164   9e-45    
ref|XP_006472905.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   1e-44    
ref|XP_004509702.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    165   1e-44    
ref|XP_006434352.1|  hypothetical protein CICLE_v10001555mg             164   1e-44    
gb|KEH15746.1|  caffeic acid O-methyltransferase                        165   1e-44    
emb|CDP20700.1|  unnamed protein product                                164   1e-44    
ref|XP_011070409.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    164   1e-44    
gb|AAC18623.1|  bispecific caffeic acid/5-hydroxyferulic acid O-m...    164   1e-44    
ref|XP_004509701.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    164   1e-44    
ref|XP_004235028.1|  PREDICTED: caffeic acid 3-O-methyltransferase      164   1e-44    
ref|XP_010911558.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    164   1e-44    
gb|AET00984.2|  caffeic acid O-methyltransferase                        164   2e-44    
gb|AFK41218.1|  unknown                                                 164   2e-44    
ref|XP_003618025.1|  Caffeic acid 3-O-methyltransferase                 164   2e-44    
ref|XP_009384339.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    164   2e-44    
ref|XP_008775842.1|  PREDICTED: tricetin 3',4',5'-O-trimethyltran...    164   2e-44    
ref|XP_007099684.1|  Caffeic acid 3-O-methyltransferase 1               163   2e-44    
ref|XP_010520933.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    164   2e-44    
ref|XP_011097031.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    163   2e-44    
sp|Q6T1F6.1|BMT_AMMMJ  RecName: Full=Bergaptol O-methyltransferas...    163   2e-44    
ref|XP_010433307.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    163   2e-44    
gb|AER35881.1|  S-adenosyl-L-methionine:flavonoid O-methyltransfe...    163   2e-44    
ref|XP_010438549.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    163   3e-44    
ref|XP_010538869.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    164   3e-44    
gb|EMT17011.1|  Caffeic acid 3-O-methyltransferase                      163   3e-44    
ref|XP_010418164.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    163   3e-44    
ref|XP_007163881.1|  hypothetical protein PHAVU_L008600g                163   3e-44    
sp|Q43239.1|COMT1_ZINVI  RecName: Full=Caffeic acid 3-O-methyltra...    163   3e-44    
gb|AJK93384.1|  caffeic acid O-methyltransferase                        163   3e-44    
ref|XP_007139026.1|  hypothetical protein PHAVU_009G258700g             163   3e-44    
gb|AGS49201.1|  O-methyltransferase                                     163   3e-44    
ref|XP_011038013.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    163   3e-44    
ref|XP_010473409.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    163   3e-44    
dbj|BAO31651.1|  O-methyltransferase                                    163   3e-44    
emb|CDM87233.1|  unnamed protein product                                163   3e-44    
ref|XP_004148264.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    163   3e-44    
gb|ABS18316.1|  caffeic acid-3-O-methyltransferase                      163   3e-44    
sp|Q38J50.1|FOMT2_WHEAT  RecName: Full=Tricetin 3',4',5'-O-trimet...    163   4e-44    
ref|XP_009384387.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    163   4e-44    
ref|XP_007143654.1|  hypothetical protein PHAVU_007G090100g             163   4e-44    
ref|XP_006386660.1|  hypothetical protein POPTR_0002s18130g             163   4e-44    
ref|XP_002300513.1|  eugenol O-methyltransferase family protein         163   4e-44    
ref|XP_002302676.2|  eugenol O-methyltransferase family protein         162   4e-44    
emb|CDY29856.1|  BnaA03g48770D                                          163   5e-44    
ref|XP_007135330.1|  hypothetical protein PHAVU_010G120200g             163   5e-44    
ref|XP_002302677.1|  eugenol O-methyltransferase family protein         162   5e-44    
gb|AFO69477.1|  caffeic acid O-methyltransferase                        162   5e-44    
ref|XP_004169229.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   6e-44    
ref|XP_006302438.1|  hypothetical protein CARUB_v10020520mg             162   6e-44    
gb|AFK44249.1|  unknown                                                 162   6e-44    
gb|AAK68908.1|  caffeic acid O-methyltransferase                        162   6e-44    
sp|Q8W013.1|COMT1_CATRO  RecName: Full=Caffeic acid 3-O-methyltra...    162   6e-44    
emb|CDX84055.1|  BnaC08g07320D                                          162   7e-44    
gb|AAO43609.1|  caffeic acid O-methyltransferase                        162   7e-44    
gb|AAK68910.1|  caffeic acid O-methyltransferase                        162   7e-44    
ref|XP_006386659.1|  hypothetical protein POPTR_0002s18120g             162   7e-44    
pdb|4PGH|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    162   8e-44    
gb|ADR31594.1|  caffeic acid 5-hydroxyferulic acid 35-O-methyltra...    158   8e-44    
pdb|4PGG|A  Chain A, Caffeic Acid O-methyltransferase From Sorghu...    162   8e-44    
ref|XP_004150935.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    162   9e-44    
ref|XP_010448093.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    162   9e-44    
ref|XP_007223223.1|  hypothetical protein PRUPE_ppa007212mg             162   9e-44    
ref|XP_007139028.1|  hypothetical protein PHAVU_009G258900g             162   1e-43    
gb|ADE88153.1|  caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-...    162   1e-43    
gb|AAL57301.1|AF387790_1  O-methyltransferase                           162   1e-43    
ref|XP_002445083.1|  hypothetical protein SORBIDRAFT_07g003860          162   1e-43    
gb|AAK68909.1|  caffeic acid O-methyltransferase                        162   1e-43    
gb|AAL91506.1|AF484252_1  caffeic acid O-methyltransferase II           162   1e-43    
ref|XP_006659136.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    162   1e-43    
emb|CAA50561.1|  catechol O-methyltransferase                           162   1e-43    
gb|AAD10253.1|  caffeic acid O-methyltransferase                        161   1e-43    
emb|CBI19007.3|  unnamed protein product                                161   1e-43    
pdb|3P9C|A  Chain A, Crystal Structure Of Perennial Ryegrass Lpom...    161   1e-43    
gb|AFK45226.1|  unknown                                                 161   1e-43    
ref|XP_003598824.1|  O-methyltransferase                                162   1e-43    
ref|XP_009107965.1|  PREDICTED: caffeic acid 3-O-methyltransferase 1    161   1e-43    
gb|ACI42878.1|  caffeic acid ortho-methyltransferase                    160   2e-43    
ref|XP_006413045.1|  hypothetical protein EUTSA_v10025522mg             161   2e-43    
dbj|BAO79380.1|  5-hydroxyconiferylaldehyde O-methyltransferase         161   2e-43    
gb|ACU24201.1|  unknown                                                 161   2e-43    
gb|AAD29844.1|AF064696_1  catechol O-methyltransferase                  161   2e-43    
ref|XP_009784058.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    161   2e-43    
gb|ACN40509.1|  unknown                                                 157   2e-43    
gb|KFK45045.1|  hypothetical protein AALP_AA1G337000                    161   2e-43    
gb|AAD29841.1|AF064693_1  catechol O-methyltransferase                  161   2e-43    
gb|ABP63535.1|  caffeic acid 3-O-methyltransferase                      161   2e-43    
ref|XP_007211258.1|  hypothetical protein PRUPE_ppa021447mg             161   2e-43    
ref|XP_009137685.1|  PREDICTED: flavone 3'-O-methyltransferase 1-...    161   2e-43    
gb|AFX98069.1|  caffeic acid O-methyltransferase                        161   2e-43    
ref|XP_004248417.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    161   2e-43    
ref|XP_008465607.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    157   2e-43    
ref|XP_010660322.1|  PREDICTED: caffeic acid 3-O-methyltransferase      160   3e-43    
ref|XP_007139031.1|  hypothetical protein PHAVU_009G259200g             161   3e-43    
gb|AAD29842.1|AF064694_1  catechol O-methyltransferase                  160   3e-43    
gb|AJK93385.1|  caffeic acid O-methyltransferase                        160   3e-43    
gb|KHN11367.1|  Caffeic acid 3-O-methyltransferase                      160   3e-43    
ref|XP_010068758.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   3e-43    
gb|AFD53036.1|  caffeic acid-O-methyltransferase                        160   3e-43    
emb|CAN76660.1|  hypothetical protein VITISV_032827                     160   3e-43    
ref|XP_003634428.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   3e-43    
emb|CAN69214.1|  hypothetical protein VITISV_033821                     160   3e-43    
gb|AEO21927.1|  bergaptol-O-methyltransferase                           160   4e-43    
ref|XP_003554786.1|  PREDICTED: anthranilate N-methyltransferase        160   4e-43    
ref|XP_009597864.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   4e-43    
ref|XP_010671879.1|  PREDICTED: caffeic acid 3-O-methyltransferas...    160   4e-43    
ref|XP_006413027.1|  hypothetical protein EUTSA_v10025520mg             160   4e-43    
gb|EYU45322.1|  hypothetical protein MIMGU_mgv1a009747mg                159   5e-43    
emb|CCC55423.1|  caffeic acid O-3-methyltransferase                     160   5e-43    
gb|ABK25932.1|  unknown                                                 160   5e-43    
emb|CDX92835.1|  BnaC07g40930D                                          160   5e-43    
ref|XP_002869540.1|  hypothetical protein ARALYDRAFT_913747             160   6e-43    
gb|AFD61598.1|  caffeic acid 3-O-methyltransferase                      160   6e-43    
gb|AHM25236.1|  3,5-dihydroxybiphenyl O-methyltransferase               160   7e-43    
gb|AGS49193.1|  O-methyltransferase                                     159   8e-43    
gb|AAD10255.1|  caffeic acid O-methyltransferase                        159   8e-43    
ref|XP_002515087.1|  o-methyltransferase, putative                      159   9e-43    
ref|XP_004499845.1|  PREDICTED: isoliquiritigenin 2'-O-methyltran...    159   9e-43    
ref|XP_007030039.1|  Caffeic acid 3-O-methyltransferase 1               159   9e-43    
gb|ABO41852.1|  putative caffeic acid methyltransferase                 159   9e-43    



>ref|XP_011018830.1| PREDICTED: caffeic acid 3-O-methyltransferase [Populus euphratica]
Length=364

 Score =   310 bits (794),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY GF+GV RLVDVGGSAGDCLRMI++KHP + QGINFDLPEVV KAP IPG+T
Sbjct  187  MEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVT  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDMFKSIP+GDAIFMKW+LTTW D ECK IM +CY ALP GGKLVACEPVLP  +DD
Sbjct  247  NVGGDMFKSIPDGDAIFMKWILTTWTDNECKLIMENCYKALPMGGKLVACEPVLPKDSDD  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  307  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKQLGQSVGFSHFRAFYVDYFYTVLEFQK  364



>ref|XP_006381361.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
 gb|ERP59158.1| hypothetical protein POPTR_0006s12160g [Populus trichocarpa]
Length=364

 Score =   310 bits (794),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/178 (80%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY GF+GV RLVDVGGSAGDCLRMI++KHP + QGINFDLPEVV KAP IPG+T
Sbjct  187  MEAMLDGYDGFKGVERLVDVGGSAGDCLRMILKKHPGVRQGINFDLPEVVAKAPIIPGVT  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDMFKSIP+GDAIFMKW+LTTW D ECK IM +CY ALP GGKL+ACEPVLP  +DD
Sbjct  247  NVGGDMFKSIPDGDAIFMKWILTTWTDNECKLIMENCYKALPVGGKLIACEPVLPKDSDD  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEEE++QL +SVGFS FRAFYVD+FYTVLEFQK
Sbjct  307  SHRTRALLEGDIFVMTIYRAKGKHRTEEEFKQLGQSVGFSYFRAFYVDYFYTVLEFQK  364



>ref|XP_002264566.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=358

 Score =   306 bits (784),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY+GF+GV RLVDVGGSAGDCLRMI++KH +I +GINFDLPEVV KAPNIPG+T
Sbjct  181  MKAILNGYNGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPNIPGVT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKS+P+GDAIFMKW+LTTW DEECK IM +CY ALP GGK++ACEPVLP ++D+
Sbjct  241  HVGGDMFKSVPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDN  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEEE+RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  301  SLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFPHLRAFYIDHFYTVLEFQK  358



>gb|KDP29212.1| hypothetical protein JCGZ_16601 [Jatropha curcas]
Length=357

 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+G+ +LVDVGGSAGDCLRMI++K+P+I +GINFDLPEVV KAPNIPG+T
Sbjct  180  MKAILNGYDGFQGMEKLVDVGGSAGDCLRMILKKYPNIREGINFDLPEVVAKAPNIPGVT  239

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+ D IFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP Q+DD
Sbjct  240  HVGGDMFKSIPSADGIFMKWVLTTWTDEECKQIMENCYKALPVGGKLIACEPVLPKQSDD  299

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRT EE++ L +SVGFS F+AFY+D+FYTVLEF K
Sbjct  300  SHRTRALLEGDIFVMTIYRAKGKHRTAEEFKLLGQSVGFSHFQAFYIDYFYTVLEFHK  357



>ref|XP_006291371.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
 gb|EOA24269.1| hypothetical protein CARUB_v10017511mg [Capsella rubella]
Length=359

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+ V RLVDVGGSAGDCLRMI++  P++ +GINFDLPEVV KAPNIPG++
Sbjct  182  MKAILEGYEGFKSVERLVDVGGSAGDCLRMILQHFPNVREGINFDLPEVVAKAPNIPGVS  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P+GDAIFMKW+LTTW DEECKEIM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  242  HVGGDMFQSVPSGDAIFMKWVLTTWTDEECKEIMKNCYNALPVGGKLIACEPVLPKETDD  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GF +FR FY+D+FYT+LEFQK
Sbjct  302  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFPTFRPFYIDYFYTILEFQK  359



>ref|XP_010515802.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=355

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+ V +L+DVGGSAGDCLRMI+E+ P++ +GINFDLPEVV KAP+IPG+T
Sbjct  178  MKAILEGYDGFKSVEQLIDVGGSAGDCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVT  237

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+SIP+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  238  HVGGDMFQSIPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDD  297

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  298  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  355



>ref|XP_010546519.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=354

 Score =   302 bits (773),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY GF+ V  LVDVGGSAGDCLRMI+ K P++ QGINFDLPEVV KAP IPG+T
Sbjct  177  MRAILDGYDGFKSVEHLVDVGGSAGDCLRMILRKFPNVRQGINFDLPEVVSKAPPIPGVT  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  237  HVGGDMFKSIPSGDAIFMKWVLTTWTDEECKQIMRNCYNALPPGGKLIACEPVLPKETDD  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR+KGKHRTEEE++QL  + GFS FR FY+D+FYTVLEFQK
Sbjct  297  SHRTRALLEGDIFVMTIYRSKGKHRTEEEFKQLGLASGFSLFRPFYIDYFYTVLEFQK  354



>emb|CDX95399.1| BnaC04g27590D [Brassica napus]
Length=359

 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IPG+T
Sbjct  182  MKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVT  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD
Sbjct  242  HMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDD  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEEY++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  302  SHRTRALLEGDIFVMTIYRTKGKHRTEEEYKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>emb|CDY70033.1| BnaCnng66420D [Brassica napus]
Length=230

 Score =   296 bits (759),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IPG+T
Sbjct  53   MKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVT  112

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD
Sbjct  113  HMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPKETDD  172

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  173  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  230



>gb|KHN47498.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=337

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A L+GY GF+GV +LVDVGGS GDCLRMI++KHP+I +GINFDLPEVV KAP IP +T
Sbjct  160  MRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVT  219

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFMKW+LTTW DEECK IM SC+ ALP+GGKL+ACEPVLP  +D+
Sbjct  220  HVGGDMFKSIPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDE  279

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  280  SHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  337



>ref|XP_006598126.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Glycine max]
Length=356

 Score =   300 bits (769),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A L+GY GF+GV +LVDVGGS GDCLRMI++KHP+I +GINFDLPEVV KAP IP +T
Sbjct  179  MRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILQKHPTIKEGINFDLPEVVAKAPQIPCVT  238

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFMKW+LTTW DEECK IM SC+ ALP+GGKL+ACEPVLP  +D+
Sbjct  239  HVGGDMFKSIPQGDAIFMKWVLTTWTDEECKHIMQSCHKALPEGGKLIACEPVLPEHSDE  298

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  299  SHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  356



>ref|XP_010504072.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=385

 Score =   301 bits (771),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+ V RLVDVGGSAG CLRMI+E+ P++ +GINFDLPEVV KAP+IPG+T
Sbjct  208  MKAILEGYDGFKSVERLVDVGGSAGVCLRMILEQFPNVREGINFDLPEVVAKAPSIPGVT  267

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+SIP+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  268  HVGGDMFQSIPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDD  327

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  328  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  385



>emb|CAN65776.1| hypothetical protein VITISV_030414 [Vitis vinifera]
Length=358

 Score =   300 bits (768),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+GV RLVDVGGSAGDCLRMI++KH +I +GINFDLPEVV KAP IPG+T
Sbjct  181  MKAILNGYSGFDGVQRLVDVGGSAGDCLRMILQKHTNIKEGINFDLPEVVAKAPTIPGVT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKS+P+GDAIFMKW+LTTW DEECK IM +CY ALP GGK++ACEPVLP ++D+
Sbjct  241  HVGGDMFKSVPDGDAIFMKWVLTTWTDEECKLIMKNCYNALPVGGKMIACEPVLPKESDN  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEEE+RQL  S GF    AFY+D FYTVLEFQK
Sbjct  301  SLRTRALLEGDIFVMTIYRAKGKHRTEEEFRQLGLSAGFPHLXAFYIDXFYTVLEFQK  358



>ref|XP_010267318.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nelumbo nucifera]
Length=354

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY+GF+GV RLVDVGGSAGDCLRMI+ KHP + +GINFDLPEVV KAPNIPG+T
Sbjct  177  MKAILEGYNGFKGVERLVDVGGSAGDCLRMILHKHPHVREGINFDLPEVVAKAPNIPGVT  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+SIP GDAIFMKW+LTTW D+ECK IM +CY ALP GGK++ACEPVLP ++D 
Sbjct  237  HVGGDMFESIPAGDAIFMKWVLTTWTDDECKLIMRNCYEALPPGGKMIACEPVLPKESDR  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVM IYRAKGKHRTEEE++QL  + GF  FRAFY+D FYTVLEFQK
Sbjct  297  SHRTRALLEGDIFVMAIYRAKGKHRTEEEFKQLGLASGFPHFRAFYIDQFYTVLEFQK  354



>ref|XP_006403721.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
 gb|ESQ45174.1| hypothetical protein EUTSA_v10010488mg [Eutrema salsugineum]
Length=361

 Score =   300 bits (767),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+E+ P++ +GINFDL EVV KAP IPG+T
Sbjct  184  MKAILDGYDGFKSVEHLVDVGGSAGDCLRMIIEQFPNVRRGINFDLLEVVAKAPKIPGVT  243

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  244  HIGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPAGGKLIACEPVLPKETDD  303

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  304  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  361



>ref|XP_009139429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brassica rapa]
Length=359

 Score =   299 bits (766),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ QGINFDLPEVV KAP IPG+T
Sbjct  182  MKAILDGYDGFKYVEHLVDVGGSAGDCLRMIIKQFPNVRQGINFDLPEVVAKAPKIPGVT  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKLVACEPVLP +TDD
Sbjct  242  HMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYKALPVGGKLVACEPVLPQETDD  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GFS+FR FY+D+FYT+LEFQK
Sbjct  302  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRPFYIDYFYTILEFQK  359



>ref|XP_002519426.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF42840.1| o-methyltransferase, putative [Ricinus communis]
Length=357

 Score =   299 bits (765),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+GV ++VDVGGSAGDCL+ I++K+P++ +GINFDLPEVV KAPNIPG+T
Sbjct  180  MKAVLNGYDGFQGVEKIVDVGGSAGDCLKTILQKYPNVREGINFDLPEVVAKAPNIPGVT  239

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKS+P+ DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP QTDD
Sbjct  240  HVGGDMFKSVPSADAIFMKWILTTWTDDECKVIMENCYKALPVGGKLIACEPVLPNQTDD  299

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEEE+++L  SVGFS FR  Y D F+TVLEFQK
Sbjct  300  SHRTRALLEGDIFVMTIYRAKGKHRTEEEFKKLGHSVGFSHFRPLYFDHFHTVLEFQK  357



>ref|XP_008241354.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=368

 Score =   299 bits (765),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHPS+ +GINFDLPEVV KAP I G++
Sbjct  191  MKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVS  250

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+GDAIFMKW+L+TW D ECK IM +CY ALP GGKL+ACEPVLP ++DD
Sbjct  251  HVGGDMFKSIPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDD  310

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE D+FVMTIYRAKGK+RTEEE RQL  S GFS FR  Y+D+FYT+LEFQK
Sbjct  311  SSRTRALLENDVFVMTIYRAKGKNRTEEELRQLGLSAGFSHFRPIYIDYFYTLLEFQK  368



>ref|XP_006391885.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
 gb|ESQ29171.1| hypothetical protein EUTSA_v10023542mg [Eutrema salsugineum]
Length=363

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ +GINFDLPEVV KAP IPG+T
Sbjct  186  MKAILDGYDGFKSVEHLVDVGGSAGDCLRMILKQFPNVREGINFDLPEVVAKAPKIPGVT  245

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  246  HVGGDMFLSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDD  305

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEG+IFVMTIYR KGKHRTEEE+++L  S GF SFR FY+D+FYT+LEFQK
Sbjct  306  SHRTRALLEGNIFVMTIYRTKGKHRTEEEFKELGLSAGFPSFRPFYIDYFYTILEFQK  363



>gb|KFK34550.1| hypothetical protein AALP_AA5G160800 [Arabis alpina]
Length=360

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+E+ P++ +GINFDLPEVV KAP IPG+ 
Sbjct  183  MKAILDGYDGFKSVDHLVDVGGSAGDCLRMILEQFPNVREGINFDLPEVVAKAPKIPGVI  242

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF+S+P+GDAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  243  HMGGDMFQSVPSGDAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDD  302

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GFS+FR FY+D+FYT+ EFQK
Sbjct  303  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFSTFRPFYIDYFYTIFEFQK  360



>ref|XP_010426946.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Camelina 
sativa]
Length=356

 Score =   297 bits (760),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V RLVDVGGSAGDCLRMI+E+ P++ +GINFDL EVV KAP IPG+ 
Sbjct  179  MKAILDGYDGFKSVERLVDVGGSAGDCLRMILEQFPNVREGINFDLHEVVAKAPTIPGVI  238

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+SIP G+AIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TDD
Sbjct  239  HVGGDMFQSIPTGEAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDD  298

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+++L  S GF++FR FY+D+FYT+LEFQK
Sbjct  299  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKELGLSAGFTTFRPFYIDYFYTILEFQK  356



>ref|XP_007202084.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
 gb|EMJ03283.1| hypothetical protein PRUPE_ppa007420mg [Prunus persica]
Length=368

 Score =   297 bits (760),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHPS+ +GINFDLPEVV KAP I G++
Sbjct  191  MKAILDGYDGFEGVGRLVDVGGSAGDCLRMILQKHPSVREGINFDLPEVVAKAPTIAGVS  250

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+GDAIFMKW+L+TW D ECK IM +CY ALP GGKL+ACEPVLP ++DD
Sbjct  251  HVGGDMFKSIPSGDAIFMKWVLSTWTDSECKLIMENCYKALPVGGKLIACEPVLPTKSDD  310

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE DIFVMTIYRAKGK+RTE+E RQL  S GFS F+  Y+D+FYTVLEFQK
Sbjct  311  SPRTRALLENDIFVMTIYRAKGKNRTEDELRQLGLSAGFSHFKPIYIDYFYTVLEFQK  368



>ref|NP_190882.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
 gb|AAK56277.1|AF367289_1 AT3g53140/T4D2_70 [Arabidopsis thaliana]
 emb|CAB64217.1| caffeic acid O-methyltransferase-like protein [Arabidopsis thaliana]
 gb|AAM91448.1| AT3g53140/T4D2_70 [Arabidopsis thaliana]
 gb|AEE79041.1| putative O-diphenol-O-methyl transferase [Arabidopsis thaliana]
Length=359

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+ V  LVDVGGSAGDCLRMI+++ P++ +GINFDLPEVV KAPNIPG+T
Sbjct  182  MKAILDGYDGFKSVDILVDVGGSAGDCLRMILQQFPNVREGINFDLPEVVAKAPNIPGVT  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P+ DAIFMKW+LTTW DEECK+IM +CY ALP GGKL+ACEPVLP +TD+
Sbjct  242  HVGGDMFQSVPSADAIFMKWVLTTWTDEECKQIMKNCYNALPVGGKLIACEPVLPKETDE  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE+ +L  S GF +FR FY+D+FYT+LEFQK
Sbjct  302  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFIELGLSAGFPTFRPFYIDYFYTILEFQK  359



>gb|KCW89310.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=285

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG+T
Sbjct  108  MKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVT  167

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD
Sbjct  168  HVGGDMFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDD  227

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  228  SHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  285



>ref|XP_010050337.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Eucalyptus 
grandis]
Length=360

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG+T
Sbjct  183  MKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVT  242

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD
Sbjct  243  HVGGDMFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDD  302

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  303  SHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  360



>gb|KCW89309.1| hypothetical protein EUGRSUZ_A01600 [Eucalyptus grandis]
Length=345

 Score =   295 bits (754),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF GV RLVDVGGSAGDCLRMIM KH  + +GINFDLPEVV KAP IPG+T
Sbjct  168  MKAILDGYDGFSGVGRLVDVGGSAGDCLRMIMGKHTHVREGINFDLPEVVAKAPPIPGVT  227

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFM+W+LTTW D+ECK+I+ +C+ ALP GGKL+ACEPVLP  +DD
Sbjct  228  HVGGDMFKSIPAGDAIFMRWILTTWTDDECKQILENCFKALPAGGKLIACEPVLPQDSDD  287

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTE+E++QL  S GF  F+AFY+D FY VLEFQK
Sbjct  288  SHRTRALLEGDIFVMTIYRAKGKHRTEQEFQQLGLSTGFPRFQAFYIDHFYAVLEFQK  345



>ref|XP_006594704.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Glycine max]
Length=355

 Score =   294 bits (753),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++A L+GY GF+GV +LVDVGGS GDCLRMI+EKHP+I +GINFDLPEVV KAP IP +T
Sbjct  178  IRAMLEGYDGFQGVEKLVDVGGSGGDCLRMILEKHPTIKEGINFDLPEVVAKAPQIPFVT  237

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFK IP GDAIFMKW+LTTW DEECK IM +C+ ALP+GGKL+ACEPVLP  +D+
Sbjct  238  HVGGDMFKFIPQGDAIFMKWVLTTWTDEECKHIMQNCHKALPEGGKLIACEPVLPEDSDE  297

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEE++RQL+   GF  FRAF+VD FYTVLEFQK
Sbjct  298  SHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLAIDAGFPRFRAFHVDHFYTVLEFQK  355



>gb|KJB62320.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=361

 Score =   294 bits (753),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 156/178 (88%), Gaps = 1/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG+T
Sbjct  185  MRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVT  243

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+SIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD
Sbjct  244  HVGGDMFESIPAADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDD  303

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  304  SHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>ref|XP_008387516.1| PREDICTED: caffeic acid 3-O-methyltransferase [Malus domestica]
Length=284

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G++
Sbjct  107  MKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVREGINFDLPEVVAKAPTIAGVS  166

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIF+KW+L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D+
Sbjct  167  HVGGDMFKSIPRGDAIFLKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDE  226

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE DIFVMTIYRAKGK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  227  SHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  284



>ref|XP_009341082.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X2 [Pyrus 
x bretschneideri]
Length=369

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G++
Sbjct  192  MKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVS  251

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIF KW+L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D+
Sbjct  252  HVGGDMFKSIPRGDAIFFKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDE  311

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE DIFVMTIYRAKGK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  312  SHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  369



>ref|XP_009341081.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform X1 [Pyrus 
x bretschneideri]
Length=372

 Score =   293 bits (749),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GFEGV RLVDVGGSAGDCLRMI++KHP++ +GINFDLPEVV KAP I G++
Sbjct  195  MKAILDGYDGFEGVERLVDVGGSAGDCLRMILQKHPNVKEGINFDLPEVVAKAPTIAGVS  254

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIF KW+L+TW D ECK I+ +CY ALP+GGKL+ACEPVLP ++D+
Sbjct  255  HVGGDMFKSIPRGDAIFFKWILSTWTDSECKVILENCYKALPEGGKLIACEPVLPKKSDE  314

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE DIFVMTIYRAKGK+R+E+E RQL  S GFS F+ FY+D+FYTV+EFQK
Sbjct  315  SHRTRALLENDIFVMTIYRAKGKNRSEDELRQLGLSAGFSHFKPFYIDYFYTVIEFQK  372



>ref|XP_009617330.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Nicotiana tomentosiformis]
Length=366

 Score =   291 bits (746),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+ Y GF+GV  LVDVGGS GDCL+MI+EKH SI  GINFDLPEVV KAP IP I 
Sbjct  188  MKAILESYEGFQGVKILVDVGGSGGDCLKMILEKHQSIQLGINFDLPEVVGKAPKIPRIN  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFK +P GDAIFMKW+LTTW D+ECK+IM SCY ALP+ GKL+ACEPVLP  TDD
Sbjct  248  HIGGDMFKYVPKGDAIFMKWVLTTWTDDECKQIMKSCYNALPEKGKLIACEPVLPHHTDD  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++RTR LLEGDIFVMTIYRAKGKHRTE+EYRQL RS GF+  R FY+D F+T+LEFQK
Sbjct  308  SKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRGFYIDHFFTILEFQK  365



>ref|XP_010098845.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
 gb|EXB75933.1| Caffeic acid 3-O-methyltransferase [Morus notabilis]
Length=359

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 154/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GFEGV RLVDVGGSAGDCLRMI++K+P++T+ INFDLPEVV +AP++PG+T
Sbjct  182  MKAILNGYDGFEGVRRLVDVGGSAGDCLRMILQKYPNVTEAINFDLPEVVARAPHVPGVT  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFK IP  DAIFMKW+LTTW D+EC+ IM SC  A+P GGKL+ACEPVLP +TDD
Sbjct  242  HVGGDMFKLIPEADAIFMKWILTTWTDDECQAIMESCCKAVPGGGKLIACEPVLPKETDD  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LL GDIFVMTIYRAKGKHRTE+EYR+L  + GF  F+AFY+D+F+TVLEF K
Sbjct  302  SHRTRALLSGDIFVMTIYRAKGKHRTEDEYRKLGLAAGFPHFQAFYIDYFHTVLEFTK  359



>ref|XP_007149437.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
 gb|ESW21431.1| hypothetical protein PHAVU_005G070300g [Phaseolus vulgaris]
Length=354

 Score =   290 bits (742),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A L+GY GF+GV RLVDVGGS GDCLRMI+ K+P+I +GINFDLPEVV KAP  P +T
Sbjct  177  MRAMLEGYDGFQGVERLVDVGGSGGDCLRMILLKYPNIKEGINFDLPEVVAKAPPTPCVT  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFMKW+LTTW DEE K+IM +C+ ALP+GGKL+ACEPVLP  +D+
Sbjct  237  HVGGDMFKSIPQGDAIFMKWVLTTWTDEEIKQIMQNCHKALPEGGKLIACEPVLPEHSDE  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRTEE++RQL+   GF  FRAF VD FYTVLEFQK
Sbjct  297  SHRTRALLEGDIFVMTIYRAKGKHRTEEQFRQLANDAGFPRFRAFNVDHFYTVLEFQK  354



>gb|KHG05883.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=361

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 155/178 (87%), Gaps = 1/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP+IPG+T
Sbjct  185  MRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAPSIPGVT  243

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDM +SIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD
Sbjct  244  YVGGDMLESIPVADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDD  303

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  304  SHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  361



>ref|XP_010312333.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Solanum lycopersicum]
Length=361

 Score =   289 bits (740),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L GY GF+GV  LVDVGGS GDCL+MI+EKH  I  GINFDLPEVV+KAP IP I 
Sbjct  183  MKAILQGYDGFQGVKTLVDVGGSGGDCLKMILEKHTDIELGINFDLPEVVEKAPQIPSIK  242

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF  IP GDAIFMKW+LTTW D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD
Sbjct  243  HVGGDMFDYIPKGDAIFMKWVLTTWTDDECKEIMKSCYNALPEKGKFIACEPVLPHHTDD  302

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++RTR LLEGDIFVMTIYRAKGKHRTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  303  SKRTRALLEGDIFVMTIYRAKGKHRTEEEYRQLGRAAGFNECKGFYIDHFFTILEFHK  360



>ref|XP_004304330.1| PREDICTED: caffeic acid 3-O-methyltransferase [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +KA LDGY GF+GVTRLVDVGGSAGDCL+MIM+++P++ +GINFDLPEVV KAP I G+T
Sbjct  181  IKAVLDGYDGFQGVTRLVDVGGSAGDCLKMIMDRYPNVREGINFDLPEVVAKAPTIAGVT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+ D IFMKW+L+TW D ECK I+ +CY ALP GGKL+ACEPV+P ++DD
Sbjct  241  HVGGDMFKSIPSADVIFMKWILSTWTDCECKLILENCYKALPAGGKLIACEPVVPRKSDD  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLE DIFVMTIYR KGK+RTEEE RQL  S GFS FR  Y+D+FYTVLEFQK
Sbjct  301  SHRTRALLENDIFVMTIYRTKGKNRTEEELRQLGHSAGFSHFRPIYIDYFYTVLEFQK  358



>ref|XP_006367254.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Solanum tuberosum]
Length=361

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L+GY GF+GV  LVDVGGS GDCL+MI++KH +I  GINFDLPEVV+KAP IP I 
Sbjct  183  MKAILEGYDGFQGVKTLVDVGGSGGDCLKMILDKHTNIELGINFDLPEVVEKAPQIPSIK  242

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF  IP GDAIFMKW+LTTW D+ECKEIM SCY ALP+ GK +ACEPVLP  TDD
Sbjct  243  HVGGDMFDYIPKGDAIFMKWVLTTWTDDECKEIMKSCYIALPEKGKFIACEPVLPHHTDD  302

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++RTR LLEGDIFVMTIYRAKGKHRTEEEYRQL R+ GF+  + FY+D F+T+LEF K
Sbjct  303  SKRTRALLEGDIFVMTIYRAKGKHRTEEEYRQLGRAAGFNDCKGFYIDHFFTILEFHK  360



>ref|XP_007027514.1| O-methyltransferase family protein [Theobroma cacao]
 gb|EOY08016.1| O-methyltransferase family protein [Theobroma cacao]
Length=356

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A L+ Y GF+GV RLVDVGGS G+CLRMI++KHP + +GINFDLPEVV KAP IPG++
Sbjct  179  MRAILNSYDGFKGVKRLVDVGGSVGECLRMILQKHPHVEEGINFDLPEVVAKAPTIPGVS  238

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP+GD IFMKW+L TW D+ECK IM +CY ALP GGKL+ACEPVLP  +DD
Sbjct  239  HVGGDMFKSIPSGDGIFMKWVLVTWTDDECKLIMENCYKALPVGGKLIACEPVLPKDSDD  298

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYR KGKHRTEEE++QL  S GF  FRAF  D FY+VLEFQK
Sbjct  299  SHRTRALLEGDIFVMTIYRTKGKHRTEEEFKQLGLSAGFPHFRAFCFDDFYSVLEFQK  356



>gb|KEH38506.1| caffeic acid O-methyltransferase [Medicago truncatula]
Length=354

 Score =   284 bits (726),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA  + YHGF+ V +LVDVGGS GDCLRMI++K+P+I QG NFDLPEVV KAP IPG+T
Sbjct  177  MKALFESYHGFQNVEKLVDVGGSGGDCLRMILQKYPNIKQGFNFDLPEVVAKAPQIPGVT  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFK IP  DAIFMKW+LTTW DEE K IM +CY ALP GGKL+ACEPVLP  +DD
Sbjct  237  HVGGDMFKYIPQADAIFMKWVLTTWTDEEIKHIMLNCYKALPAGGKLIACEPVLPETSDD  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR  L GDIFVMTIYRAKGKHRTEE++RQL+ S GF+ F++F+VD+F+ VLEFQK
Sbjct  297  SHRTRASLAGDIFVMTIYRAKGKHRTEEQFRQLAISAGFNLFKSFHVDYFHIVLEFQK  354



>ref|XP_004488687.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=353

 Score =   283 bits (724),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA L  Y+GF+GV +LVDVGGS GDCLRMI+ K+PSI + INFDLP+VV KAP IPG+T
Sbjct  176  MKALLASYNGFQGVEKLVDVGGSGGDCLRMILHKYPSIKEAINFDLPQVVAKAPQIPGVT  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFK +P GDAIFMKW+L TW D+E K IM +CY ALP GGKL+ACEPVLP  +DD
Sbjct  236  HVGGDMFKYVPQGDAIFMKWVLITWTDKEIKHIMQNCYKALPAGGKLIACEPVLPEDSDD  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LL+GDIFVMTIYRAKGKHRTEE+++QL  S GF+ F+AF+VD FY VLEFQK
Sbjct  296  SHRTRALLQGDIFVMTIYRAKGKHRTEEQFKQLGISAGFNLFKAFHVDHFYAVLEFQK  353



>gb|KGN59032.1| hypothetical protein Csa_3G747630 [Cucumis sativus]
Length=370

 Score =   277 bits (709),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 150/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+P I +GINFDLPEVV +AP IPG++
Sbjct  193  MKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPGVS  252

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP GDAIFMKW+L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD+
Sbjct  253  HVGGDMFKSIPTGDAIFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDE  312

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LL  D+F+MTIY+AK K RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  313  SHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  370



>ref|XP_010683979.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=383

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDG-YHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            MKA ++G Y GF+GV +LVDVGGSAGDCL+MIM K+  I +GINFDLPEVV +AP IPG+
Sbjct  205  MKAVVEGGYDGFDGVVKLVDVGGSAGDCLKMIMSKYGGIKEGINFDLPEVVAQAPQIPGV  264

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            THVGGDMFKSIP GDAIFMKW+LTTW D+E K IM +CY +LP GGKL+ACEPVLP  +D
Sbjct  265  THVGGDMFKSIPCGDAIFMKWVLTTWTDDEIKLIMKNCYDSLPAGGKLIACEPVLPETSD  324

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            D+ RTR LL GDIFVMTIY AKG+HR EEEYRQL  S GF  FRA ++D+F+TVLEFQK
Sbjct  325  DSHRTRALLSGDIFVMTIYGAKGRHRMEEEYRQLGNSAGFPHFRAVHIDYFFTVLEFQK  383



>ref|XP_008442758.1| PREDICTED: caffeic acid 3-O-methyltransferase [Cucumis melo]
Length=371

 Score =   273 bits (698),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+PSI +GINFDLPEVV +AP IPG++
Sbjct  194  MKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPSIKEGINFDLPEVVARAPPIPGVS  253

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMFKSIP  DA+FMKW+L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +TD+
Sbjct  254  HVGGDMFKSIPTADAMFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKTDE  313

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LL  D+F+MTIY+AK K RTEE++RQL  S GFS+ R F++D+FY +LEF K
Sbjct  314  SHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFTK  371



>ref|XP_011101458.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=354

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKAFL+ Y GF+GV  LVDVGGSAGDCLRMIM K+PSI +G+NFDLPEVV+KAP IPG+ 
Sbjct  176  MKAFLNSYDGFQGVGTLVDVGGSAGDCLRMIMSKNPSIKKGVNFDLPEVVEKAPKIPGVE  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD+ K+IP+   IFMKW+LTTW D+ECK I+ +C+ ALP GGK+VACEPVLP  TD+
Sbjct  236  HVGGDLLKTIPSAVDIFMKWILTTWTDDECKHILKNCHDALPPGGKVVACEPVLPNHTDN  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  181
            + R+R LLEGDIFVMTIYR+KGKHRTE EYR+L  + GF  F+A   +D FYTVLEFQK
Sbjct  296  SHRSRALLEGDIFVMTIYRSKGKHRTEMEYRELGIAAGFRYFKAKILLDQFYTVLEFQK  354



>ref|XP_004137858.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 ref|XP_004169388.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=409

 Score =   273 bits (697),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP--G  541
            MKA LDGY GF+GV +LVDVGGSAGDCLRMI++K+P I +GINFDLPEVV +AP IP  G
Sbjct  230  MKAVLDGYDGFKGVEKLVDVGGSAGDCLRMILQKYPHIKEGINFDLPEVVARAPTIPETG  289

Query  540  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  361
            ++HVGGDMFKSIP GDAIFMKW+L+TW D+ECK I+ +C  +LP GGKL+ACEP LP +T
Sbjct  290  VSHVGGDMFKSIPTGDAIFMKWVLSTWTDDECKIILENCCKSLPVGGKLIACEPTLPEKT  349

Query  360  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            D++ RTR LL  D+F+MTIY+AK K RTEE++RQL  S GFS+ R F++D+FY +LEFQK
Sbjct  350  DESHRTRALLASDVFIMTIYKAKSKQRTEEQFRQLGLSAGFSALRPFHIDYFYCLLEFQK  409



>ref|XP_010935841.1| PREDICTED: quercetin 3-O-methyltransferase 1 isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   267 bits (683),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            M AFL+G+   F GV  +VDVGGS+GDCLR IM++ P++ +G+NFDLPEVV KAP  PG+
Sbjct  231  MDAFLNGHAAAFAGVRTVVDVGGSSGDCLRAIMQRVPTVQRGVNFDLPEVVAKAPKYPGM  290

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            THVGGDMFK+IP GDAIFMKW+L TW DEEC  I+ +CY ALP+ GK++ACEPVLP +TD
Sbjct  291  THVGGDMFKAIPAGDAIFMKWVLMTWTDEECMLILKNCYKALPEKGKVIACEPVLPEETD  350

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++QRTR LLE DIFVMTIYR +G+ RTEEE+RQ+  SVGFS+F+AFY D FYT+LEFQK
Sbjct  351  NSQRTRALLENDIFVMTIYRVQGRGRTEEEFRQIGLSVGFSNFKAFYSDHFYTILEFQK  409



>ref|XP_009382782.1| PREDICTED: caffeic acid 3-O-methyltransferase [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -3

Query  714  MKAFLDGY--HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  541
            M+A LDGY   GF  V  LVDVGGS+G CL MIM + PS+ +GINFDLPEVV +AP + G
Sbjct  191  MEALLDGYGSAGFGSVETLVDVGGSSGACLDMIMRRFPSVKRGINFDLPEVVAEAPPLAG  250

Query  540  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  361
            +THVGG+MF+SIP GDAIFMKW+LTTW DEEC  I+ +CY ALP+GGK++ACEPVLP++T
Sbjct  251  VTHVGGNMFESIPTGDAIFMKWVLTTWTDEECTAILRNCYNALPEGGKVIACEPVLPVET  310

Query  360  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            D+++RTR LLEGDIFVM IYR  G+ RTEEE+RQL   VGF++FRA Y+D FY V+E+QK
Sbjct  311  DNSRRTRALLEGDIFVMAIYRTLGRERTEEEFRQLGGVVGFTAFRAIYLDPFYAVVEYQK  370



>gb|KDO39806.1| hypothetical protein CISIN_1g025363mg [Citrus sinensis]
Length=254

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  85   MTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVT  144

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  +++
Sbjct  145  HIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNE  204

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIFVMTIYRAKG HRTE+E++QL    GF   R + V
Sbjct  205  SQRTRALLEGDIFVMTIYRAKGNHRTEQEFKQLGFFAGFPHLRLYRV  251



>emb|CBI30187.3| unnamed protein product [Vitis vinifera]
Length=149

 Score =   253 bits (645),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -3

Query  627  MIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEE  448
            MI++KH +I +GINFDLPEVV KAPNIPG+THVGGDMFKS+P+GDAIFMKW+LTTW DEE
Sbjct  1    MILQKHTNIKEGINFDLPEVVAKAPNIPGVTHVGGDMFKSVPDGDAIFMKWVLTTWTDEE  60

Query  447  CKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEE  268
            CK IM +CY ALP GGK++ACEPVLP ++D++ RTR LLEGDIFVMTIYRAKGKHRTEEE
Sbjct  61   CKLIMKNCYNALPVGGKMIACEPVLPKESDNSLRTRALLEGDIFVMTIYRAKGKHRTEEE  120

Query  267  YRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +RQL  S GF   RAFY+D FYTVLEFQK
Sbjct  121  FRQLGLSAGFPHLRAFYIDHFYTVLEFQK  149



>gb|KJB62323.1| hypothetical protein B456_009G411600 [Gossypium raimondii]
Length=347

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 142/178 (80%), Gaps = 15/178 (8%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+A LDGY G +GV RLVDVGGSAGDCLRMI++K+P + +GINFDLPEVV KAP      
Sbjct  185  MRAILDGYDGLKGVKRLVDVGGSAGDCLRMILQKYPHV-EGINFDLPEVVAKAP------  237

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
                    SIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP ++DD
Sbjct  238  --------SIPAADAIFMKWVLTTWTDDECKAIMENCYKALPVGGKLIACEPVLPKESDD  289

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            + RTR LLEGDIFVMTIYRAKGKHRT++E++QL  S GF  FRAFY+D+FYTVLEFQK
Sbjct  290  SHRTRALLEGDIFVMTIYRAKGKHRTQDEFKQLGLSAGFPHFRAFYIDYFYTVLEFQK  347



>ref|XP_006436414.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
 gb|ESR49654.1| hypothetical protein CICLE_v10033543mg [Citrus clementina]
Length=317

 Score =   257 bits (656),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  148  MTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVT  207

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  +++
Sbjct  208  HIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNE  267

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIFVMTIYRAKG HRTE+E++QL    GF   R + V
Sbjct  268  SQRTRALLEGDIFVMTIYRAKGNHRTEQEFKQLGFFAGFPHLRLYRV  314



>ref|XP_006367255.1| PREDICTED: caffeic acid 3-O-methyltransferase 2-like [Solanum 
tuberosum]
Length=360

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 140/178 (79%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEGV  LVDVGGS GDCL+MI+EKHPSI  GINFDLP+VV+KAP IP I 
Sbjct  183  MKVMLERYDGFEGVKTLVDVGGSVGDCLKMILEKHPSIELGINFDLPKVVEKAPQIPRIK  242

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDM   IP GDAIFMKW+L  + ++ECK+IM SCY ALP+ GK + C+PVLP  TDD
Sbjct  243  HVGGDMLDYIPKGDAIFMKWILAIFTEDECKQIMKSCYNALPEKGKFIICDPVLPHHTDD  302

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++RTR LLE DI+ M IYRA+GKHRTEEEYRQL R+ GF+  +  Y+D F+T+LEF K
Sbjct  303  SKRTRALLEIDIYGMAIYRAQGKHRTEEEYRQLGRAAGFTDCKGVYIDHFFTILEFYK  360



>ref|XP_006451708.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
 gb|ESR64948.1| hypothetical protein CICLE_v10010561mg, partial [Citrus clementina]
Length=305

 Score =   254 bits (650),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY+GF+GV RLV+VGGSAGDCLRMI++KH  I +G+NFDLPEVV +AP+IPG+T
Sbjct  136  MTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPGVT  195

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  +++
Sbjct  196  HIGGDMFKSIPATDAIFMKWVLTTWTDDECKLIMENCYKALPTGGKLIACEPVLPDDSNE  255

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIF MTIYRAKGKH TE+E++QL  S GF   R + V
Sbjct  256  SQRTRALLEGDIFFMTIYRAKGKHMTEQEFKQLGFSTGFPHLRLYRV  302



>ref|XP_006485837.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=337

 Score =   254 bits (648),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + L+GY+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  148  MTSVLEGYNGFKGVKRLVDVGGSAGDCLRMILQKHRFICEGINFDLPEVVAEAPSIPGVT  207

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY ALP GGKL+ACEPVLP  +++
Sbjct  208  HIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKALPAGGKLIACEPVLPDDSNE  267

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSF  229
            +QRTR LLEGDIFVMTIYRAKGKH TE+E++QL  S+  SS 
Sbjct  268  SQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSLHSSSL  309



>ref|XP_003572969.1| PREDICTED: caffeic acid 3-O-methyltransferase [Brachypodium distachyon]
Length=362

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            M+A LDGY G FE V  LVDVGGS+G CL MIM +  +I QGINFDLP+VV  AP I G+
Sbjct  184  MEALLDGYAGGFEDVRTLVDVGGSSGACLDMIMRRVGTIAQGINFDLPDVVAAAPPIAGV  243

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
             HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+ +CYGALP+GGKL+ACEPV+P  TD
Sbjct  244  RHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKNCYGALPEGGKLIACEPVVPETTD  303

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + RTR LLE DIFVMT YR +G+ R+EEE+RQL  + GF++FRA Y+D FY VLE+ K
Sbjct  304  TSTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGLAAGFTAFRAIYLDPFYAVLEYLK  362



>gb|ACN25427.1| unknown [Zea mays]
 gb|AFW63931.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 141/182 (77%), Gaps = 4/182 (2%)
 Frame = -3

Query  714  MKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  544
            M A LDGY    GF GV  LVDVGGS+G CL MIM + P+IT+GINFDLP+VV  AP I 
Sbjct  193  MGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIA  252

Query  543  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQ  364
            G+ HVGGDMFKSIP+GDAIFMKW+LTTW D+EC  I+ +C+ ALP GGKLVACEPV+P +
Sbjct  253  GVRHVGGDMFKSIPSGDAIFMKWVLTTWTDDECTAILRNCHAALPDGGKLVACEPVVPEE  312

Query  363  TDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEF  187
            TD + RTR LLE DIFVMT YR +G+ R+EEE+R L   + GF++FRA Y+D FY VLE+
Sbjct  313  TDSSTRTRALLENDIFVMTTYRTQGRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEY  372

Query  186  QK  181
             K
Sbjct  373  TK  374



>dbj|BAJ96291.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00225.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=367

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 140/179 (78%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYHG-FEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            M+A LDGY G FEGV  LVDVGGS+G CL MIM + P+I +G+NFDLP+VV  AP I G+
Sbjct  189  MEALLDGYEGGFEGVGTLVDVGGSSGACLEMIMRRVPTIREGVNFDLPDVVAAAPPIAGV  248

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
             HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+  C+ ALP GGKLVACEPV+P  TD
Sbjct  249  KHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKKCHDALPDGGKLVACEPVVPETTD  308

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + RTR LLE DIFVMT YR +G+ R+EEE+RQL  + GF+ FRA Y+D FY +LE+ K
Sbjct  309  ASTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGIAAGFAGFRALYLDPFYALLEYVK  367



>gb|AAP03056.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=206

 Score =   245 bits (625),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGI
Sbjct  28   MKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGI  87

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            THVGG+MF+S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D
Sbjct  88   THVGGNMFESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSD  147

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++ RTR LL  DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  148  ESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  206



>ref|XP_011098295.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Sesamum indicum]
Length=355

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 143/180 (79%), Gaps = 2/180 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+ FLD Y GF+GV  LVDVGG++GDCLR+IM K+ SI +GINFDLPEVV+KAP IPGI 
Sbjct  176  METFLDRYDGFQGVETLVDVGGNSGDCLRLIMNKYKSIKKGINFDLPEVVEKAPKIPGIE  235

Query  534  HVGGDMFKS-IPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            HVGGD+ KS IP GDAIFMKW+L T  DEECK I+ +C  ALP GGKL+ C+P+LP  TD
Sbjct  236  HVGGDLLKSNIPPGDAIFMKWLLVTCTDEECKHILKNCSDALPSGGKLIICDPLLPNHTD  295

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  181
            D+ R+R +LE DI++MT+YR KGKHRTE EYR L  + GF++ +A F +D ++TVLEF+K
Sbjct  296  DSHRSRAILEADIYIMTMYRTKGKHRTETEYRALGVAAGFTNLKANFKIDNYFTVLEFEK  355



>gb|AAP03055.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=234

 Score =   245 bits (625),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGI
Sbjct  56   MKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGI  115

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            THVGG+MF+S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D
Sbjct  116  THVGGNMFESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSD  175

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++ RTR LL  DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  176  ESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  234



>ref|NP_001149617.1| LOC100283243 [Zea mays]
 gb|ACG36095.1| caffeic acid 3-O-methyltransferase [Zea mays]
Length=374

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 140/182 (77%), Gaps = 4/182 (2%)
 Frame = -3

Query  714  MKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  544
            M A LDGY    GF GV  LVDVGGS+G CL MIM + P+IT+GINFDLP+VV  AP I 
Sbjct  193  MGALLDGYGAAGGFRGVATLVDVGGSSGACLEMIMRRVPTITEGINFDLPDVVAAAPPIA  252

Query  543  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQ  364
            G+ HVGGDMFKSIP+GDAIFMKW+LTTW D+EC  I+ +C+  LP GGKLVACEPV+P +
Sbjct  253  GVRHVGGDMFKSIPSGDAIFMKWVLTTWTDDECTAILRNCHAXLPDGGKLVACEPVVPEE  312

Query  363  TDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLS-RSVGFSSFRAFYVDFFYTVLEF  187
            TD + RTR LLE DIFVMT YR +G+ R+EEE+R L   + GF++FRA Y+D FY VLE+
Sbjct  313  TDSSTRTRALLENDIFVMTTYRTQGRERSEEEFRHLGVDAAGFTAFRAIYLDPFYAVLEY  372

Query  186  QK  181
             K
Sbjct  373  TK  374



>ref|NP_001048569.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAD22923.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAD22855.1| putative O-diphenol-O-methyl transferase [Oryza sativa Japonica 
Group]
 dbj|BAF10483.1| Os02g0823400 [Oryza sativa Japonica Group]
 dbj|BAG97074.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58073.1| hypothetical protein OsJ_08933 [Oryza sativa Japonica Group]
Length=365

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 2/180 (1%)
 Frame = -3

Query  714  MKAFLDGYH--GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  541
            M+A L+GY   GFEGV+ LVDVGGS+G CL MIM +  +I  G+NFDLP+VV  AP IPG
Sbjct  186  MEALLEGYGDGGFEGVSTLVDVGGSSGACLEMIMRRVRTIRDGVNFDLPDVVAAAPPIPG  245

Query  540  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  361
            + HVGGDMFKSIP+GDAIFMKW+LTTW +EEC  I+S+C+ ALP GGK++ACEPV+P  T
Sbjct  246  VRHVGGDMFKSIPSGDAIFMKWVLTTWTNEECTAILSNCHKALPGGGKVIACEPVVPDTT  305

Query  360  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            D + RTR LLE DIFVM  YR +G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  306  DGSTRTRALLENDIFVMATYRTQGRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  365



>ref|XP_002453074.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
 gb|EES06050.1| hypothetical protein SORBIDRAFT_04g037820 [Sorghum bicolor]
Length=377

 Score =   248 bits (634),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 138/181 (76%), Gaps = 3/181 (2%)
 Frame = -3

Query  714  MKAFLDGYH---GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIP  544
            M A LDGY    GF GV  LVDVGGS+G CL MIM + P+I +GINFDLP+VV  AP I 
Sbjct  197  MHALLDGYGFDGGFHGVATLVDVGGSSGACLEMIMRRVPTIKEGINFDLPDVVADAPAIA  256

Query  543  GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQ  364
            G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+ +C+ ALP GGKLVACEPV+P +
Sbjct  257  GVRHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILRNCHAALPDGGKLVACEPVVPEE  316

Query  363  TDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQ  184
            TD + RTR LLE DIFVMT YR +G+ R+EEE+  L  + GF+ FRA Y+D FY VLE+ 
Sbjct  317  TDSSTRTRALLENDIFVMTTYRTQGRERSEEEFHHLGIAAGFTGFRAIYLDPFYAVLEYT  376

Query  183  K  181
            K
Sbjct  377  K  377



>gb|KDO39208.1| hypothetical protein CISIN_1g041308mg [Citrus sinensis]
Length=244

 Score =   244 bits (622),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 138/174 (79%), Gaps = 0/174 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY GF+GV RLVDVGGSAGDCLR+I++KH  I +GINFDLPEVV KAP+IP +T
Sbjct  53   MTSVLDGYDGFKGVKRLVDVGGSAGDCLRIILQKHCFICEGINFDLPEVVAKAPSIPEVT  112

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSI   DAIFMKW+LTTW D+ECK IM + Y AL  G KL+ACEPVLP  +++
Sbjct  113  HIGGDMFKSIHVVDAIFMKWVLTTWTDDECKLIMENYYKALLAGRKLIACEPVLPDDSNE  172

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVL  193
            +QRTR LLEGDIFVMTIYRAKGKH+TE+E++QL  S GF   RAF    F   L
Sbjct  173  SQRTRALLEGDIFVMTIYRAKGKHKTEQEFKQLGFSTGFPHLRAFISIIFTLFL  226



>ref|XP_004954455.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Setaria italica]
Length=344

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYH-GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            M+A LDGY  GFEGV  LVDVGGS+G CL MIM +  +I +GINFDLP+VV  AP I G+
Sbjct  164  MEALLDGYAAGFEGVATLVDVGGSSGACLEMIMRRVDTIREGINFDLPDVVAAAPPIVGV  223

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
             HVGGDMFKSIP+GDAIFMKW+LTTW +EEC  I+ +CY ALP GGK++ACEPV+P +TD
Sbjct  224  RHVGGDMFKSIPSGDAIFMKWVLTTWTNEECTAILGNCYSALPDGGKVIACEPVVPEETD  283

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + RTR LLE DIFVMT YR +G+ R+E+E+R L  + GF+ FRA Y+D  Y VLE+ K
Sbjct  284  GSTRTRALLENDIFVMTTYRTQGRERSEDEFRNLGIAAGFTGFRAIYLDPLYAVLEYTK  342



>gb|AAP03058.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=375

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 138/179 (77%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFL-DGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGI  538
            MKA L  GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGI
Sbjct  197  MKALLGSGYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGI  256

Query  537  THVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTD  358
            THVGG+MF+S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D
Sbjct  257  THVGGNMFESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSD  316

Query  357  DTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++ RTR LL  DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  317  ESHRTRALLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  375



>emb|CAB65279.1| O-diphenol-O-methyl transferase [Medicago sativa subsp. x varia]
Length=358

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M   L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +PGIT
Sbjct  181  MNEMLEKYDGFKGVETLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGIT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD  +S+P GDAIF KW + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD+
Sbjct  241  HVGGDALESVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDE  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +QRTR LL GDIF+MT+YR KGKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  301  SQRTRALLSGDIFIMTMYRTKGKHRTEEQFKQLGISTGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_004502926.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=361

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+  L+ Y GF+GV  L DVGG++G CL MIM K+P+I +GIN+D P +V  AP  P IT
Sbjct  184  MREMLENYDGFQGVETLADVGGNSGVCLNMIMNKYPNIRKGINYDFPAMVSSAPEFPDIT  243

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGD  +S+P GDAIFMKW+   W DEECK+ + +CY ALP  GKL+ CEPVLP  TD+
Sbjct  244  HIGGDALQSVPAGDAIFMKWIFLAWTDEECKKTLQNCYKALPVDGKLIVCEPVLPELTDE  303

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +QRTR LL GDIF+MT+YR KGKHRTEE+++QL  S GF  FRAFY+D +  VLEFQK
Sbjct  304  SQRTRALLGGDIFIMTMYRTKGKHRTEEQFKQLGASTGFFRFRAFYIDPYLAVLEFQK  361



>ref|XP_011101457.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Sesamum indicum]
Length=360

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 141/179 (79%), Gaps = 1/179 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MKAFLDGY GF+GV  LVDVGG++G+CLRMIM K+ SI +G+ FDLPEVV+KAP IPGI 
Sbjct  182  MKAFLDGYDGFQGVETLVDVGGNSGECLRMIMSKYQSIKKGVKFDLPEVVEKAPKIPGIE  241

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD+ KS+P GDAIFMKW+L    D+ECK+I  +C+ ALP GGKL+ C+P+LP + DD
Sbjct  242  HVGGDVLKSVPPGDAIFMKWILVACTDDECKQIFKNCFDALPPGGKLIVCDPLLPDRADD  301

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRA-FYVDFFYTVLEFQK  181
             + +R +LE DI++MT+YR KGKHRTE E R+L  + GF + +  F VD ++TVLEFQK
Sbjct  302  NRSSRAILEADIYIMTMYRTKGKHRTETECRELGLAAGFHNLKPKFNVDHYFTVLEFQK  360



>gb|AAP03057.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=188

 Score =   238 bits (606),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 133/170 (78%), Gaps = 0/170 (0%)
 Frame = -3

Query  690  HGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFK  511
            +GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+MF+
Sbjct  19   NGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNMFE  78

Query  510  SIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLL  331
            S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR LL
Sbjct  79   SVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRALL  138

Query  330  EGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
              DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V+EFQK
Sbjct  139  VADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPVVEFQK  188



>gb|AES72848.2| caffeic acid O-methyltransferase [Medicago truncatula]
Length=335

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M   L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +PGIT
Sbjct  158  MNEMLEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGIT  217

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD  + +P GDAIF KW + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD+
Sbjct  218  HVGGDALELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDE  277

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +QRTR LL GDIF+MT+Y+ KGKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  278  SQRTRALLSGDIFIMTMYKTKGKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  335



>ref|XP_006451875.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
 gb|ESR65115.1| hypothetical protein CICLE_v10010158mg [Citrus clementina]
Length=222

 Score =   238 bits (606),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LD Y+ F+GV +LVDVGGSAGDCLRMI++KH  I +GINFD+PEVV +AP+I G+T
Sbjct  53   MTSVLDSYNRFKGVKQLVDVGGSAGDCLRMILQKHRFIYEGINFDVPEVVGEAPSILGVT  112

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGD FKSIP  DAIFMKW+LTTW D+E K IM +CY ALP GGKL+AC+PVL   +++
Sbjct  113  HIGGDTFKSIPAADAIFMKWVLTTWTDDEYKLIMENCYKALPAGGKLIACKPVLLDDSNE  172

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIFVMTIYRAKGKHRTE+E++QL  S GF   R + V
Sbjct  173  SQRTRALLEGDIFVMTIYRAKGKHRTEQEFKQLGFSAGFLHLRLYRV  219



>ref|XP_003602597.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
Length=358

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M   L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP +PGIT
Sbjct  181  MNEMLEKYDGFKGVESLVDVGGNSGVILNMIMNKYPNILKGINFDLPDMISSAPQLPGIT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD  + +P GDAIF KW + TW DEECK+++ +CY ALP  GKL+ CEPV P  TD+
Sbjct  241  HVGGDALELVPAGDAIFTKWTMLTWTDEECKKVLQNCYKALPVNGKLIVCEPVSPELTDE  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +QRTR LL GDIF+MT+Y+ KGKHRTEE+++QL  S GF  FRAF++D ++ VLEFQK
Sbjct  301  SQRTRALLSGDIFIMTMYKTKGKHRTEEQFKQLGISAGFLRFRAFHIDPYFPVLEFQK  358



>ref|XP_003602595.1| Caffeic acid 3-O-methyltransferase [Medicago truncatula]
 gb|ACJ84599.1| unknown [Medicago truncatula]
 gb|AES72846.1| caffeic acid O-methyltransferase [Medicago truncatula]
 gb|AFK37235.1| unknown [Medicago truncatula]
Length=358

 Score =   240 bits (613),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+  L+ Y GF+GV  LVDVGG++G  L MIM K+P+I +GINFDLP+++  AP  PGIT
Sbjct  181  MREMLENYDGFKGVETLVDVGGNSGVSLNMIMNKYPNILKGINFDLPDMISSAPQYPGIT  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGD  +S+P GDAIF+KW + TW DEE K+ + SCY ALP  GKL+ CEPVLP QTD+
Sbjct  241  HVGGDALESVPAGDAIFIKWTVLTWTDEEFKKALQSCYKALPVAGKLILCEPVLPEQTDE  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            ++RTR LL  DI++MT+YR KGKHRTEE+++QL  S GF SFRAF++D +  VLEF K
Sbjct  301  SKRTRALLAADIWIMTMYRTKGKHRTEEQFKQLGISAGFKSFRAFHIDPYLPVLEFHK  358



>ref|XP_006649184.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Oryza brachyantha]
Length=313

 Score =   236 bits (602),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = -3

Query  666  LVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDMFKSIPNGDAI  487
            LVDVGGS+G CL MIM +  +I +G+NFDLP+VV  AP IPG+ HVGGDMFKSIP+GDAI
Sbjct  152  LVDVGGSSGACLEMIMRRVRTIREGLNFDLPDVVAAAPPIPGVKHVGGDMFKSIPSGDAI  211

Query  486  FMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMT  307
            FMKW+LTTW ++EC  I+ +CY ALP GGKLVACEPV+P  TD + RTR LLE DIFVMT
Sbjct  212  FMKWVLTTWTNDECTAILRNCYAALPAGGKLVACEPVVPDTTDGSTRTRALLENDIFVMT  271

Query  306  IYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             YR +G+ R+EEE+RQL  +VGF+ FRA Y+D FY +LE+ K
Sbjct  272  TYRTQGRERSEEEFRQLGLAVGFTFFRAIYLDPFYALLEYTK  313



>gb|AAP03051.1| S-adenosyl-L-methionine: beta-alanine N-methyltransferase [Limonium 
latifolium]
Length=167

 Score =   230 bits (586),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = -3

Query  696  GYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITHVGGDM  517
            GY GFEGV  LVDVGGS+GDCLRMI+ K+  I + INFDLPEVV KAP IPGITHVGG+ 
Sbjct  1    GYDGFEGVKTLVDVGGSSGDCLRMIINKYKDIPKAINFDLPEVVAKAPKIPGITHVGGNT  60

Query  516  FKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDTQRTRL  337
            F+S+P+GDAIF+KW+LT + DEE   +M +C  ALP GGKL+  EP LP  +D++ RTR 
Sbjct  61   FESVPSGDAIFVKWVLTCFTDEEVITLMRNCNKALPVGGKLICSEPTLPENSDESHRTRA  120

Query  336  LLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTV  196
            LL  DIF+MT YRAKGKHRTEEEYRQL    GF  FR  +VD+F+ V
Sbjct  121  LLVADIFIMTTYRAKGKHRTEEEYRQLGLLAGFPKFRVIHVDYFFPV  167



>ref|XP_006423903.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
 gb|ESR37143.1| hypothetical protein CICLE_v10029876mg [Citrus clementina]
Length=294

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LD Y+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  148  MTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVT  207

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF SIP  +AIFMKW+L TW D+ECK IM +CY AL  GGKL+ACEPVL   +++
Sbjct  208  HIGGDMFNSIPAANAIFMKWVLATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNE  267

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTE  274
            +QRTR LLEGDIFVMTIYRAKGKHRTE
Sbjct  268  SQRTRALLEGDIFVMTIYRAKGKHRTE  294



>ref|XP_006432602.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
 gb|ESR45842.1| hypothetical protein CICLE_v10002505mg [Citrus clementina]
Length=206

 Score =   226 bits (575),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 16/167 (10%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY GF+GV RLVDVGGSAG                INFDLPEVV +AP+IPG+T
Sbjct  53   MTSILDGYDGFKGVKRLVDVGGSAG----------------INFDLPEVVAEAPSIPGVT  96

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY A+P GGKL+ACEPVLP  +++
Sbjct  97   HIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNE  156

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIFVMTIYRAKGKH TE+E++QL  S GF   R + V
Sbjct  157  SQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAGFPHLRLYRV  203



>gb|KDO38249.1| hypothetical protein CISIN_1g043063mg [Citrus sinensis]
Length=301

 Score =   226 bits (577),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/167 (65%), Positives = 127/167 (76%), Gaps = 16/167 (10%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY GF+GV RLVDVGGSAG                INFDLPEVV +AP+IPG+T
Sbjct  148  MTSILDGYDGFKGVKRLVDVGGSAG----------------INFDLPEVVAEAPSIPGVT  191

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY A+P GGKL+ACEPVLP  +++
Sbjct  192  HIGGDMFKSIPAADAIFMKWVLTTWTDDECKLIMENCYKAIPAGGKLIACEPVLPDDSNE  251

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
            +QRTR LLEGDIFVMTIYRAKGKH TE+E++QL  S GF   R + V
Sbjct  252  SQRTRALLEGDIFVMTIYRAKGKHMTEQEFKQLGFSAGFPHLRLYRV  298



>gb|KDO41959.1| hypothetical protein CISIN_1g021707mg [Citrus sinensis]
Length=309

 Score =   218 bits (555),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LD Y+GF+GV RLVDVGGSAGDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  148  MTSVLDSYNGFKGVKRLVDVGGSAGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVT  207

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF SIP  +AIFMKW+L TW D+ECK IM +CY AL  GGKL+ACEPVL   +++
Sbjct  208  HIGGDMFNSIPAANAIFMKWVLATWTDDECKLIMENCYKALLAGGKLIACEPVLLDDSNE  267

Query  354  TQRTRLLLEGDIFVMTIYRAK  292
            +QRTR LLEGDIFVMTIYRAK
Sbjct  268  SQRTRALLEGDIFVMTIYRAK  288



>ref|XP_009787879.1| PREDICTED: caffeic acid 3-O-methyltransferase-like, partial [Nicotiana 
sylvestris]
Length=121

 Score =   201 bits (512),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -3

Query  540  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  361
            I H+GGDMFK +P G+AIFMKW+LTTW D+ECK+IM SCY ALP+ GKL+ACEPVLP  T
Sbjct  1    INHIGGDMFKYVPKGNAIFMKWVLTTWTDDECKQIMKSCYNALPKKGKLIACEPVLPHHT  60

Query  360  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            DD++RTR LLEGDIFVMTIYRAKGKHRTE+EYRQL RS GF+  R FY+D F+TVLEF K
Sbjct  61   DDSKRTRALLEGDIFVMTIYRAKGKHRTEDEYRQLGRSAGFADCRGFYIDHFFTVLEFHK  120



>ref|XP_006425490.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
 gb|ESR38730.1| hypothetical protein CICLE_v10027189mg, partial [Citrus clementina]
Length=298

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 114/149 (77%), Gaps = 11/149 (7%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY+GF+GV RLVDVGGS GDCLRMI++KH  I +GINFDLPEVV +AP+IPG+T
Sbjct  116  MTSVLDGYNGFKGVKRLVDVGGSVGDCLRMILQKHHFICEGINFDLPEVVGEAPSIPGVT  175

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMFKSIP  DAIFMKW+           IM  CY ALP GGKL+ CEPVLP  +++
Sbjct  176  HIGGDMFKSIPAADAIFMKWL-----------IMEKCYKALPAGGKLIVCEPVLPDDSNE  224

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEE  268
            +QRTR LLEGDIFVMTIYRAK    T+  
Sbjct  225  SQRTRALLEGDIFVMTIYRAKAYQWTKNR  253



>gb|EEC74273.1| hypothetical protein OsI_09508 [Oryza sativa Indica Group]
Length=345

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 125/180 (69%), Gaps = 22/180 (12%)
 Frame = -3

Query  714  MKAFLDGYH--GFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPG  541
            M+A L+GY   GFEGV+ LVDVGGS+G CL M+M +  +I  G+NFDLP+VV  AP IPG
Sbjct  186  MEALLEGYGDGGFEGVSTLVDVGGSSGACLEMMMRRVRTIRDGVNFDLPDVVAAAPPIPG  245

Query  540  ITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQT  361
            + HVGGDMFKSIP+GDAIFMK                    ALP GGK++ACEPV+P  T
Sbjct  246  VRHVGGDMFKSIPSGDAIFMK--------------------ALPGGGKVIACEPVVPDTT  285

Query  360  DDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            D + RTR LLE DIFVM  YR +G+ R+EEE+R L  + GF+SFRA Y+D FY VLE+ K
Sbjct  286  DGSTRTRALLENDIFVMATYRTQGRERSEEEFRHLGLAAGFASFRAIYLDPFYAVLEYTK  345



>ref|XP_006441597.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
 gb|ESR54837.1| hypothetical protein CICLE_v10023355mg [Citrus clementina]
Length=181

 Score =   190 bits (482),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -3

Query  555  PNIPGITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPV  376
            P+IP +TH+GG MFKSI   DAIFMKW+LTTW D+ECK IM +CY ALP GG+L+ACEPV
Sbjct  57   PSIPRVTHIGGGMFKSIHAVDAIFMKWVLTTWTDDECKLIMENCYKALPAGGELIACEPV  116

Query  375  LPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTV  196
            LP  ++++QRTR LLEGDIFVMTIYRAKGKHR E+E++QL  S  F   RAFY D+F+T+
Sbjct  117  LPDDSNESQRTRALLEGDIFVMTIYRAKGKHRIEQEFKQLGFSASFPHLRAFYFDYFHTL  176

Query  195  LEFQK  181
            LEFQK
Sbjct  177  LEFQK  181



>ref|XP_006838729.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
 gb|ERN01298.1| hypothetical protein AMTR_s00002p00253410 [Amborella trichopoda]
Length=352

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/178 (52%), Positives = 124/178 (70%), Gaps = 1/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M  FL+ Y GFEGV R+VD+GGS+G CL+ I++KH  + +GINFDLP+VV+ AP   GI 
Sbjct  176  MDWFLERYDGFEGVRRVVDLGGSSGFCLKKILDKHKGL-EGINFDLPKVVEAAPPYLGIE  234

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDM + +P GD IFMK +L +W D+EC  ++ +CY ALP+ GK++A E VLP+ TD 
Sbjct  235  HVGGDMLEWVPQGDVIFMKGILCSWDDDECVGLLKNCYKALPEKGKVIALEQVLPMHTDT  294

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  TR LL+ D+F+M IY    K RTE+ +R+LS + GF +        FYT LEFQK
Sbjct  295  SPSTRALLQADVFLMAIYSPGSKRRTEDIFRRLSEAAGFRTLEIVLPGSFYTALEFQK  352



>gb|EMT14045.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=197

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 94/197 (48%), Positives = 118/197 (60%), Gaps = 48/197 (24%)
 Frame = -3

Query  627  MIMEKHPSITQGINFDLPEVVQKA------------------------------------  556
            MIM + P+I +G+NFDLP VV  A                                    
Sbjct  1    MIMRRVPTIREGVNFDLPNVVAAAHPIAEVFTCSEFRVSTSTVDEFDSEVSVQSTLVLLA  60

Query  555  ----PNIP--------GITHVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGAL  412
                 N+P        G+ HVGGDMFKSIP+GDAIFMKW+LTTW ++EC  I+  C+ AL
Sbjct  61   ILAKKNLPVQVQSDCAGVKHVGGDMFKSIPSGDAIFMKWVLTTWTNDECTAILKKCHEAL  120

Query  411  PQGGKLVACEPVLPIQTDDTQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSS  232
            P+GGKL+ACEPV+P  TD + RTR LLE DIFVMT YR +G+ R+EEE+RQL  + GF+ 
Sbjct  121  PEGGKLIACEPVVPDTTDASTRTRALLENDIFVMTTYRTQGRERSEEEFRQLGLTAGFAG  180

Query  231  FRAFYVDFFYTVLEFQK  181
            FRA Y+D FY VLE+ K
Sbjct  181  FRALYLDPFYAVLEYVK  197



>ref|XP_002988275.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|EFJ10694.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M A L+ YHGF+G+  LVDVGG  G  L +I++K+P I +GINFDLP VV KAP IPG+ 
Sbjct  178  MNAILEAYHGFKGIGTLVDVGGGVGTSLAVILKKYPEI-KGINFDLPHVVAKAPQIPGVE  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+L  W DE C  ++ +CY ++P+ GK++  + VLP   D 
Sbjct  237  HVGGDMFVSVPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDT  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
                R+ L  D+  M +Y   GK RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  297  GAGARVALSIDLL-MLVYNPGGKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>ref|XP_002963872.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
 gb|ADE88151.1| caffeyl alcohol/5-hydroxyconiferyl alcohol 3/5-O-methyltransferase 
[Selaginella moellendorffii]
 gb|EFJ35743.1| caffeic acid O-methyltransferase [Selaginella moellendorffii]
Length=353

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M A L+ YHGF+G+  LVDVGG  G  L +I++K+P I +GINFDLP VV KAP IPG+ 
Sbjct  178  MNAILEAYHGFKGIGTLVDVGGGVGTSLTVILKKYPEI-KGINFDLPHVVAKAPQIPGVE  236

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+L  W DE C  ++ +CY ++P+ GK++  + VLP   D 
Sbjct  237  HVGGDMFVSVPQGDAIFMKWILHDWSDEACITLLKNCYKSIPEHGKVIVVDSVLPSVLDT  296

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
                R+ L  D+  M +Y   GK RT E++ +L+++ GFSS +      F +V+EF K
Sbjct  297  GAGARVALSIDLL-MLVYNPGGKERTFEDFEKLAKASGFSSVKVPVTVDFISVVEFHK  353



>gb|AAA80579.1| 3' flavonoid O-methyltransferase [Chrysosplenium americanum]
Length=343

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 119/178 (67%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +K  L+ Y GF+G+T LVDVGG  G  L  I+ K+P+I +GINFDLP V+Q AP  PGI 
Sbjct  164  IKKILETYKGFQGLTSLVDVGGGTGATLTKILSKYPTI-RGINFDLPHVIQDAPEYPGIE  222

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W +E+C +++ +CY ALP  GK++  E +LP+  D 
Sbjct  223  HVGGDMFVSVPKGDAIFMKWICHDWNEEQCLKLLKNCYDALPNNGKVIVAEYILPVVPDS  282

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  ++L +  D+ ++T   + GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  283  SLASKLSVTADVMIVT-QNSGGKERTEKEFEALAKAAGFQGFQVFCNAFTIYIIEFSK  339



>ref|XP_009392797.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   181 bits (458),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 114/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GF+ V RLVDVGG  G  L MI  KHP I   INFDLP V+ +AP  PG+ H
Sbjct  188  KKLLDIYRGFDDVNRLVDVGGGIGATLFMITSKHPHI-HAINFDLPHVISEAPPFPGVEH  246

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P+GDAI MKW+L  W DE C +I+ SC+ ALP+ GK++  E VLP+  + T
Sbjct  247  VGGDMFASVPSGDAILMKWILHDWSDEHCAKILKSCWEALPEKGKVIVVECVLPVVPEPT  306

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             R + +   D+ +M  +   GK RTEEE+  L++  GFS F+A Y+     V+EF K
Sbjct  307  PRAQGVFHVDL-IMLAHNPGGKERTEEEFHGLAKQAGFSGFKATYIFANAWVIEFTK  362



>ref|XP_008380838.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=365

 Score =   181 bits (458),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDG  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ABI54118.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWTDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDG  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>emb|CBI23095.3| unnamed protein product [Vitis vinifera]
Length=236

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+ 
Sbjct  59   MKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVE  117

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKWM   W D  C + + +CY ALP  GK++  E +LP+  D 
Sbjct  118  HVGGDMFVSVPKGDAIFMKWMCYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDT  177

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+  +  D+ +M  Y   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  178  SLATKTAVHIDV-IMLAYNTGGKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  234



>gb|KJB23958.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=318

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  141  MKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVE  199

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY ALP  GK++  E +LP   D 
Sbjct  200  HVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDP  259

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  260  SLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  316



>ref|XP_006478090.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
 gb|KDO46359.1| hypothetical protein CISIN_1g017777mg [Citrus sinensis]
Length=366

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  189  MKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVE  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIF+KW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  +++++  D  +M  +   GK RTE+E+R L+++ GF  F+     F   ++EF K
Sbjct  308  SLASKVVIHVDC-IMLAHNPGGKERTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>gb|ADK97702.1| putative caffeic acid O-methyltransferase [Citrus aurantium]
Length=366

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  189  MKKILENYKGFEGLNSVVDVGGGIGATLNMIISKYPSI-KGINFDLPHVIQDAPAFPGVE  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIF+KW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFIKWICHDWSDEHCVKFLKNCYEALPVNGKVIVAESILPVTPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  +++++  D  +M  +   GK RTE+E+R L+++ GF  F+     F   ++EF K
Sbjct  308  SLASKVVIHVDC-IMLAHNPGGKERTEQEFRALAKAAGFQGFQVVSSAFNTYIMEFLK  364



>ref|XP_008362842.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=253

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  76   MKKLLENYNGFEGLTCIVDVGGGTGAILNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  134

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  135  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDS  194

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  195  SLATKGVVHID-EIMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  251



>ref|XP_008382714.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=229

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  52   MKNLLENYNGFEGLTSIVDVGGGTGIVLNMIVFKYPSI-KGINFDLPYVIEDAPQYPGVE  110

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  111  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYSALPDNGKVIVAECILPVAPDS  170

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  171  SLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  227



>gb|KJB23954.1| hypothetical protein B456_004G125600 [Gossypium raimondii]
Length=365

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDP  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  307  SLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>gb|ABI54117.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>gb|ACT32029.1| caffeic acid O-methyltransferase 2 [Gossypium hirsutum]
Length=365

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYDGFEGLKTLVDVGGGTGATLNMIVTKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDSGKVIVAECILPDYPDP  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  307  SLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFVK  363



>ref|XP_009418616.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 115/177 (65%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV  LVDVGG  G  L MI  KHP I +GINFDLP V+ +AP  PG+ H
Sbjct  188  KKLLDIYRGFEGVKVLVDVGGGIGATLYMITTKHPRI-RGINFDLPHVISEAPPFPGVEH  246

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            +GGDMF S+P GDAIFMKW+L  W DE C +I+ +C  ALP+ GK++  E VLP+  + T
Sbjct  247  IGGDMFASVPRGDAIFMKWILHDWSDEHCTKILKNCCEALPEKGKVIVVECVLPVVPEPT  306

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             R + +   D+ +M  +   GK RTE+E+  L++  GFS F+A Y+     V+EF K
Sbjct  307  PRAQGVFNIDL-IMLAHNPGGKERTEKEFEGLAKEAGFSGFKASYIFANTWVMEFTK  362



>gb|ADN27527.1| caffeic acid O-methyltransferase [Camellia sinensis]
Length=363

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GF+G+T +VDVGG  G  L MI+ KHP+I +GINFDLP V++ AP+ PG+ 
Sbjct  186  MKKILDIYGGFDGLTTVVDVGGGTGATLNMIVSKHPTI-KGINFDLPHVIEDAPSYPGVE  244

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY ALP  GK++  E +LP+  D 
Sbjct  245  HVGGDMFVSVPKGDAIFMKWICHDWSDDHCLKFLKNCYDALPHNGKVIIAECILPVAPDT  304

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               T+ ++  D+ +M  +   GK RT++E+  L++  GF+ FR     F   V+EF K
Sbjct  305  KLATKNVVHIDV-IMLAHNPGGKERTQKEFEALAKGAGFAGFRVMCCAFNTYVMEFLK  361



>ref|XP_007218166.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19365.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   179 bits (453),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PGI 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGIN  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|AGS49204.1| O-methyltransferase [Zea mays]
Length=364

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + R +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKARGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_008381500.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=433

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  256  MKKLLENYNGFEGLTSIVDVGGGTGAVLXMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  314

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  315  HVGGDMFVSVPKGDAIFMKWICHDWXDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDG  374

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  375  SLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  431



>gb|KHG13289.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=365

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  L M++ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYDGFEGLKTLVDVGGGTGATLNMLVTKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + +  CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLKKCYEALPDNGKVIVAECILPDYPDP  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RTE+E+  L+RS GF  F+     F   ++EF K
Sbjct  307  SLATKLVVHIDC-IMLAHNPGGKERTEKEFEALARSAGFQGFQVKCCAFGTYIMEFLK  363



>gb|ACN41351.2| putative caffeic acid O-methyltransferase [Betula pendula]
Length=365

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVD  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  307  SLATKGVIHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>gb|AGG91492.1| caffeic acid 3-O-methyltransferase [Betula platyphylla]
Length=365

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-RGINFDLPHVIEDAPSYPGVD  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYDALPNNGKVIVAECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  307  SLATKGVIHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQVLGCAFNTYIMEFIK  363



>ref|XP_010671332.1| PREDICTED: caffeic acid 3-O-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GFEG++ LVDVGG  G  L MI+ KHP+I +GINFDLP V++ AP   G+ 
Sbjct  185  MKRILDTYKGFEGLSTLVDVGGGTGATLNMIISKHPTI-KGINFDLPHVIEDAPAYNGVE  243

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + + +CY +LP  GK++ CE +LP+  + 
Sbjct  244  HVGGDMFESVPKGDAIFMKWICHDWSDEHCLKFLKNCYASLPDHGKVIVCEYILPVAPET  303

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
                R +   D  +M  +   GK RTE+E+  L++  GF  FR     +   V+EF K
Sbjct  304  NHAARTVFHVDA-IMLAHNPGGKERTEQEFEGLAKGAGFEGFRVACSAYDTKVIEFYK  360



>gb|AGS49202.1| O-methyltransferase [Zea mays]
Length=364

 Score =   178 bits (451),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 84/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS FRA Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFRATYIYANAWAIEFIK  364



>gb|AHM25237.1| noraucuparin O-methyltransferase [Sorbus aucuparia]
Length=365

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLEIYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKESGFQGFRVVCSAFNIYAIEFLK  363



>gb|AGS49209.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPQFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_008234634.1| PREDICTED: caffeic acid 3-O-methyltransferase [Prunus mume]
Length=365

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>sp|Q43609.1|COMT1_PRUDU RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Prunus dulcis]
 emb|CAA58218.1| caffeic O-methyltransferase [Prunus dulcis]
Length=365

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>ref|XP_007218167.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
 gb|EMJ19366.1| hypothetical protein PRUPE_ppa007511mg [Prunus persica]
Length=365

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ L++  GF  F      F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEQEFQALAKGAGFQGFNVACSAFNTYVIEFLK  363



>gb|AID68566.1| caffeic O-methyltransferase [Punica granatum]
Length=370

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP++PG+ 
Sbjct  193  MKKILETYKGFEGLNTIVDVGGGTGAVLSMIVAKYPSI-KGINFDLPHVIEDAPSLPGVE  251

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  252  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDHGKVIVAECILPLSPDP  311

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  312  SLATKGVIHIDC-IMLAHNPGGKERTEKEFEALAKGAGFEGFRVACCAFNTYVMEFLK  368



>gb|AGO50639.1| caffeic acid O-methyltransferase [Linum usitatissimum]
Length=367

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GF+ +  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP +PG+ 
Sbjct  189  MKKILETYTGFDVLKSLVDVGGGTGAVLSMILSKHPSI-KGINFDLPHVIEDAPALPGVQ  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D+ C + + +C+ ALP  GK++ CE ++P+  D 
Sbjct  248  HVGGDMFASVPTGDAIFMKWICHDWSDQHCLKFLKNCFDALPANGKVIVCECIMPVAPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  TR ++  D  +M  +   GK RT+ E+  L++  GF  FR     F   V+EF K
Sbjct  308  SLATRNVVHIDC-IMLAHNPGGKERTQAEFESLAKGAGFQGFRVVCSAFNTYVMEFLK  364



>gb|AIJ28474.1| O-methyltransferase [Vaccinium corymbosum]
Length=370

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  L MI  K+P+I +GINFDLP V++ AP  PG+ 
Sbjct  193  MKKILEIYQGFEGLTSLVDVGGGTGATLHMIRSKYPTI-KGINFDLPHVIEDAPTYPGVE  251

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E  LP+  D 
Sbjct  252  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYDALPNNGKVIVAECNLPVAPDT  311

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  ++ ++  D+ +M  +   GK RT+EE+  L++  GF  FR     F   V+EF K
Sbjct  312  SLASKNVIHIDV-IMLAHNPGGKERTKEEFEALAKGAGFEGFRVMCSAFNTYVMEFLK  368



>ref|XP_004156527.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
Length=359

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDA  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  301  SLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>ref|XP_004137204.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cucumis sativus]
 gb|KGN53621.1| hypothetical protein Csa_4G091880 [Cucumis sativus]
Length=359

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPLAPDA  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  301  SLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFDGFKVHCCAFNTYVMEFLK  357



>gb|KDO42947.1| hypothetical protein CISIN_1g030025mg [Citrus sinensis]
Length=184

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I  K+P I +GINFDLP V+Q +P  PG+ 
Sbjct  9    LQKILEAYKGFEHIKQLVDVGGSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVK  67

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +C+ ++P+GGK++  E VLP   ++
Sbjct  68   HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPEN  127

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
               +++    D+ VMT Y   GK RT+ E+  L+   GFS  R  +V FF+   V+EF K
Sbjct  128  GTHSKINSLADVLVMTQYPG-GKERTKHEFTTLATEAGFSGIR--FVCFFHNLWVMEFYK  184



>ref|XP_010662844.1| PREDICTED: caffeic acid O-methyltransferase isoform X1 [Vitis 
vinifera]
Length=372

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+ 
Sbjct  195  MKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVE  253

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKWM   W D  C + + +CY ALP  GK++  E +LP+  D 
Sbjct  254  HVGGDMFVSVPKGDAIFMKWMCYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDT  313

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+  +  D+ +M  Y   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  314  SLATKTAVHIDV-IMLAYNTGGKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  370



>gb|AGS49189.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYAGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ABI54119.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +C+ ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCHAALPDNGKVIVAECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_002525818.1| o-methyltransferase, putative [Ricinus communis]
 gb|EEF36570.1| o-methyltransferase, putative [Ricinus communis]
Length=365

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+PSI +G NFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSVVDVGGGTGAVLSMIVSKYPSI-KGTNFDLPHVIEDAPSFPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C   + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFASVPKGDAIFMKWICHDWSDEHCLNFLKNCYDALPANGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKGVIHIDC-IMLAHNPGGKERTEKEFEALAKGAGFQGFQVMCCAFNSYVMEFLK  363



>gb|ABS57468.1| caffeic acid O-methyl transferase [Leucaena leucocephala]
 gb|ABU41320.1| caffeic acid o-methyl transferase [Leucaena leucocephala]
Length=365

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  + MI+ K+PSI  GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLTSLVDVGGGTGAVISMIVSKYPSI-NGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W DE C + + +CY ALP+ GK++  E +LP   D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDEHCVKFLKNCYDALPENGKVIVAECILPASPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L+++ GF  FR     F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKAAGFQGFRVCCSAFNTYIMEFLK  363



>gb|AGS49206.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAIASRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTETT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006478221.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=352

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ LR I  K+P I +GINFDLP V+Q +P  PG+ 
Sbjct  177  LQKILEAYKGFEHIKQLVDVGGSLGNTLREITSKYPHI-KGINFDLPHVIQHSPEYPGVK  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +CY ++P+GGK++  E VLP   + 
Sbjct  236  HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
            +  +++    D+ VMT Y   GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  296  STHSKINSLADVLVMTQYPG-GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AGS49190.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ABI54120.1| caffeic acid O-methyltransferase [Malus domestica]
Length=365

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLENYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+  GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVSKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVIVAEYILPVAPDG  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKEVVHSDA-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCSAFNTYAIEFLK  363



>ref|XP_008462913.1| PREDICTED: caffeic acid 3-O-methyltransferase 1 [Cucumis melo]
Length=359

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PG+ 
Sbjct  182  MKKILETYKGFEGLNSVVDVGGGTGAVLNMIVSKYPSI-RGINFDLPHVIQDAPPYPGVE  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  241  HVGGDMFVSVPKGDAIFMKWICHDWSDHHCLKFLKNCYDALPEHGKVIVAECILPVAPDA  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ LS++ GF  F+     F   V+EF K
Sbjct  301  SLATKGVIHIDL-IMLAHNPGGKERTEKEFQALSKAAGFLGFKVHCCAFNTYVMEFLK  357



>gb|AGS49215.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49205.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49191.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGF25396.1| caffeic acid 3-O-methyltransferase [Zea nicaraguensis]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q06509.1|COMT1_MAIZE RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Zea mays]
 gb|AAB03364.1| O-methyltransferase [Zea mays]
 gb|AAQ24346.1| O-methyltransferase [Zea mays]
 gb|AAQ24347.1| O-methyltransferase [Zea mays]
 gb|AGS49180.1| O-methyltransferase [Zea mays]
 gb|AGS49218.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|NP_001106047.1| catechol O-methyltransferase [Zea mays]
 gb|AAQ24340.1| O-methyltransferase [Zea mays]
 gb|AAQ24341.1| O-methyltransferase [Zea mays]
 gb|ABQ58826.1| flavonoid O-methyltransferase [Zea mays]
 gb|AFW61191.1| brown midrib3 [Zea mays]
 gb|AGS49212.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49187.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010934913.1| PREDICTED: tricetin 3',4',5'-O-trimethyltransferase-like [Elaeis 
guineensis]
Length=367

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 114/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFE +  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP +PG+ H
Sbjct  193  KKLLESYKGFEDINVLVDVGGGIGATLHMITSKYPHI-KGINFDLPHVISEAPPLPGVEH  251

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF SIP+GDAI MKW++  W DE C +I+ +CY ALP  G+++ CE +LP+  +  
Sbjct  252  VGGDMFASIPSGDAILMKWIMHDWSDEHCAKILENCYKALPNNGRVILCECILPVAPEPV  311

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               + +   D+ +M  +   GK RTE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  312  PSAQGVFHLDM-IMLAHNPGGKERTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>gb|AAQ24337.1| O-methyltransferase [Zea mays]
 gb|AAQ24349.1| O-methyltransferase [Zea mays]
 gb|AAQ24352.1| O-methyltransferase [Zea mays]
 gb|AAQ24367.1| O-methyltransferase [Zea mays]
 gb|AAQ24369.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49195.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49185.1| O-methyltransferase [Zea mays]
Length=364

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AAQ24338.1| O-methyltransferase [Zea mays]
 gb|AAQ24360.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|NP_001268100.1| caffeic acid O-methyltransferase [Vitis vinifera]
 gb|AAF44672.1|AF239740_1 caffeic acid O-methyltransferase [Vitis vinifera]
Length=386

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+ 
Sbjct  209  MKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVE  267

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKWM   W D  C + + +CY ALP  GK++  E +LP+  D 
Sbjct  268  HVGGDMFVSVPKGDAIFMKWMCYEWDDAHCLKFLENCYQALPDNGKVIVAECILPVVPDT  327

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+  +  D+ +M  Y   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  328  SLATKSAVHIDV-IMLAYNTGGKARTEKEFEALAKGAGFQGFKVVCCAFNSWIMEFCK  384



>gb|ADR31603.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=203

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  27   MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  85

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  86   HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  145

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  146  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  202



>gb|KHN23296.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFE +  LVDVGG  G  + MI+ KHP+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>ref|XP_006441599.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 ref|XP_006441601.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
 gb|ESR54839.1| hypothetical protein CICLE_v10020870mg [Citrus clementina]
 gb|ESR54841.1| hypothetical protein CICLE_v10020873mg [Citrus clementina]
Length=352

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I  K+P I +GINFDLP V+Q +P  PG+ 
Sbjct  177  LQKILEAYKGFEHIKQLVDVGGSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVK  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +CY ++P+GGK++  E VLP   + 
Sbjct  236  HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCYKSIPEGGKVIVVESVLPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
            +  +++    D+ VMT Y   GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  296  STHSKINSLADVLVMTQYPG-GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|KDP30064.1| hypothetical protein JCGZ_18389 [Jatropha curcas]
Length=365

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYNALPANGKVIVAECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK R E+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKSVIHIDC-IMLAHNPGGKERNEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>gb|ADR31598.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   172 bits (435),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  44   MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVX  102

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  103  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  162

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  163  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>ref|XP_010918594.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=362

 Score =   176 bits (446),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +K  LD Y GFE +  LVDVGG  G  L+MI+ K+P I QGINFDLP V+  AP IPG+ 
Sbjct  187  VKKMLDTYKGFEDLKHLVDVGGGLGATLQMIVSKYPHI-QGINFDLPHVISGAPLIPGVV  245

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP+ DAIFMKW+L  W DE C +I+ +C+ ALP  GK++  E +LP     
Sbjct  246  HVGGDMFSSIPSADAIFMKWILHDWSDEHCLKILKNCWKALPNNGKVIVAECLLPEAPKA  305

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               T++L  GD+ ++T Y   GK RT++E+  L++  GF+ F+A        V+EF K
Sbjct  306  NAETQVLYYGDLAMLT-YNIGGKERTKKEFESLAKEAGFAHFKAECCALNMWVMEFLK  362



>gb|ACT87981.1| caffeic acid O-methyltransferase [Jatropha curcas]
Length=365

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  + MI+ K+PS+ +GINFDLP V+Q AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVINMIVSKYPSL-KGINFDLPHVIQDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYSALPANGKVIVAECILPVAPDA  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK R E+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKSVIHIDC-IMLAHNPGGKERNEKEFEALAKGAGFQGFQVLCSAFNTYVMEFLK  363



>gb|AGS49181.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDLHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|ADR31595.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31596.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31601.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31605.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31606.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
 gb|ADR31608.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=220

 Score =   172 bits (435),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  44   MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  102

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  103  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  162

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  163  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  219



>gb|AAQ24339.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK +  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49196.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASAPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYVNAWAIEFIK  364



>gb|ADR31604.1| caffeic acid 5-hydroxyferulic acid 35-O-methyltransferase ferulic 
acid complex chain A [Populus trichocarpa]
Length=216

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  40   MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  98

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  99   HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  158

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  159  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  215



>gb|AGS49211.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y       +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYTYANAWAIEFIK  364



>gb|AGS49210.1| O-methyltransferase [Zea mays]
Length=364

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+  M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-TMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AIY22648.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
Length=224

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFEGV+ LVDVGG  G  L  I   HP I +G+NFDLP V+ +AP  PG+ H
Sbjct  50   KKLLEFYTGFEGVSTLVDVGGGIGATLHAITSHHPQI-RGVNFDLPHVISEAPPFPGVQH  108

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMFKS+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+  
Sbjct  109  VGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAV  168

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   G+ R E E+R L++  GFS F+A Y+      +EF K
Sbjct  169  PKAQGVFHVDM-IMLAHNPGGRERYEREFRDLAKGAGFSGFKATYIYANAWAIEFIK  224



>gb|AGJ84131.1| putative caffeic acid O-methyltransferase [Hibiscus cannabinus]
Length=365

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GF+G+  LVDVGG  G  + MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYDGFDGLKTLVDVGGGTGATINMIVSKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W DE C + ++ CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFESVPKGDAIFMKWICHDWSDEHCSKFLNKCYEALPDNGKVIVAECILPDYPDA  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RT++E+  L++  GF  FR     F   ++EF K
Sbjct  307  SLATKLVVHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFRVKCCAFGTYIMEFLK  363



>gb|ABG27066.1| caffeic acid O-methyltransferase [Boehmeria nivea]
Length=365

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+  +PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLETYKGFEGLNSVVDVGGGTGAVLSMIVSNYPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + SCY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKSCYDALPNNGKVIVAECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ +   D+ +M  +   GK R E+E++ L++  GF  FR     F   V+EF K
Sbjct  307  SLATKGVAHIDV-IMLAHNPGGKERAEKEFQALAKGAGFQGFRVVCSAFNTYVMEFLK  363



>ref|XP_006441596.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
 gb|ESR54836.1| hypothetical protein CICLE_v10023568mg [Citrus clementina]
Length=352

 Score =   175 bits (444),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I+ K+P I +GINFDLP V+Q AP  PG+ 
Sbjct  177  IQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-KGINFDLPHVIQHAPEYPGVK  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +C+ ++P+GGK++  E VLP   + 
Sbjct  236  HVGGDMFRSVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  +++   GD+ VMT Y   GK RT+ E+  L+   GFS  R     F   V+EF K
Sbjct  296  STHSKINFLGDVLVMTQYPG-GKERTKHEFMTLATGAGFSGVRFDCFFFNLWVMEFHK  352



>sp|Q8GU25.1|COMT1_ROSCH RecName: Full=Caffeic acid 3-O-methyltransferase; Short=CAOMT; 
Short=COMT; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase [Rosa chinensis]
 emb|CAD29457.1| caffeic acid O-methyltransferase [Rosa chinensis]
Length=365

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQ  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ VM  +   GK RTE+E+  L++  GF   R     F   V+EF K
Sbjct  307  SLATKGVVHIDV-VMLAHNPGGKERTEQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>gb|AAQ24342.1| O-methyltransferase [Zea mays]
Length=359

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24344.1| O-methyltransferase [Zea mays]
 gb|AAQ24358.1| O-methyltransferase [Zea mays]
 gb|AAQ24362.1| O-methyltransferase [Zea mays]
Length=359

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24345.1| O-methyltransferase [Zea mays]
 gb|AAQ24354.1| O-methyltransferase [Zea mays]
Length=358

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24348.1| O-methyltransferase [Zea mays]
 gb|AAQ24350.1| O-methyltransferase [Zea mays]
 gb|AAQ24356.1| O-methyltransferase [Zea mays]
 gb|AAQ24363.1| O-methyltransferase [Zea mays]
 gb|AAQ24365.1| O-methyltransferase [Zea mays]
 gb|AAQ24366.1| O-methyltransferase [Zea mays]
 gb|AAQ24368.1| O-methyltransferase [Zea mays]
 gb|AAQ24370.1| O-methyltransferase [Zea mays]
Length=358

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24351.1| O-methyltransferase [Zea mays]
 gb|AAQ24357.1| O-methyltransferase [Zea mays]
 gb|AAQ24359.1| O-methyltransferase [Zea mays]
Length=358

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24343.1| O-methyltransferase [Zea mays]
 gb|AAQ24353.1| O-methyltransferase [Zea mays]
 gb|AAQ24364.1| O-methyltransferase [Zea mays]
Length=359

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AAQ24361.1| O-methyltransferase [Zea mays]
Length=359

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 109/166 (66%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AGS49183.1| O-methyltransferase [Zea mays]
Length=364

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +    + +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFH-VVMIMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYADAWAIEFIK  364



>gb|AGS49184.1| O-methyltransferase [Zea mays]
Length=364

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP ++ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHVS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E  LP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECALPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_007136428.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
 gb|ESW08422.1| hypothetical protein PHAVU_009G044400g [Phaseolus vulgaris]
Length=365

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAIINMIVSKYPNI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W DE C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDEHCLKFLKNCYDALPENGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVLCSAFNSYIMEFLK  363



>dbj|BAG71895.1| 5-hydroxyconiferaldehyde O-methyltransferase [Carthamus tinctorius]
Length=356

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GF GV  LVDVGG  G  L MI+ KHPSI +GINFDLP V+Q A N PGI 
Sbjct  181  MKKILDVYPGFNGVKTLVDVGGGTGASLSMILSKHPSI-KGINFDLPHVIQDATNYPGIE  239

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W D  C + + +CY ALP+ GK++  E +LP   D 
Sbjct  240  HVGGDMFESVPKGDAIFMKWICHDWSDAHCLKFLKNCYKALPENGKVIVAECILPETPDS  299

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E++ L+++ GF  F          ++EF K
Sbjct  300  SLATKNVVHIDV-IMLAHNPGGKERTEKEFQALAKAAGFKGFHKPCSALNTWLMEFTK  356



>gb|AAZ32409.1| S-methyltransferase [Catharanthus roseus]
Length=362

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 1/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L  Y GFE +  LVDVGG  G  L +I  K+P++ +GIN+DLP V Q AP  PG+ 
Sbjct  186  VQEILKNYKGFENLKTLVDVGGGLGVTLDLITSKYPNL-KGINYDLPHVTQNAPTYPGVV  244

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+L  W DE C +++ +CY ALP+ GK++A + +LP+  D+
Sbjct  245  HVGGDMFESVPKGDAIFMKWILHDWDDEHCLKLLKNCYKALPENGKVIAVDAILPMNPDN  304

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ + + D+F + +Y   GK RTE E+  L    GF   R   V     V+EF K
Sbjct  305  SSSTKHISQVDLFTLVLYHPGGKERTENEFLALVAEAGFGGIRKVCVCCDLWVMEFYK  362



>gb|AAY86361.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
 gb|ADQ53456.1| caffeic acid O-methyltransferase [Acacia auriculiformis x Acacia 
mangium]
Length=365

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+PSI +GINFDLP V+++AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPSI-KGINFDLPHVIEEAPSFPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W DE C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDEHCVKFLKNCYDALPENGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFRVCCSAFNSYIMEFLK  363



>ref|XP_009608171.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana tomentosiformis]
Length=363

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  + MI+ KHPSI +GINFDLP V+  AP  PG+ 
Sbjct  188  MKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKHPSI-KGINFDLPHVIGDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVIIAECILPEAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+  +  DI VM  +   GK RTE+E+  L++  GF+ FR     +   V+EF K
Sbjct  307  SLATKNTVHVDI-VMLAHNPGGKERTEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>gb|AIY22649.1| caffeic acid 3-O-methyl transferase, partial [Saccharum arundinaceum]
 gb|AIY22650.1| caffeic acid 3-O-methyl transferase, partial [Miscanthus sp. 
LK-2014]
Length=224

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 110/177 (62%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFEGV+ LVDVGG  G  L  I   HP I +GINFDLP V+ +AP  PG+ H
Sbjct  50   KKLLEFYTGFEGVSTLVDVGGGIGATLHAITSHHPQI-KGINFDLPHVISEAPPFPGVQH  108

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMFKS+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+  
Sbjct  109  VGGDMFKSVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAV  168

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   G+ R E E+  L++  GFS F+A Y+      +EF K
Sbjct  169  PKAQGVFHVDM-IMLAHNPGGRERYEREFHDLAKGAGFSGFKATYIYANAWAIEFIK  224



>gb|KDP36008.1| hypothetical protein JCGZ_10407 [Jatropha curcas]
Length=365

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+  L+ Y GFEG+T LVDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP+ PG+ 
Sbjct  188  MRKILETYKGFEGLTSLVDVGGGIGAVLNMIVTKYPSM-KGINFDLPHVIEDAPSFPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF + P GDAIFMKW+   W DE C +++ +CY A+P  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVTAPKGDAIFMKWICHDWSDEYCLKLLKNCYNAIPANGKVIVAEYILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTEEE+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKAVIHMDC-LMLAHLPGGKERTEEEFETLAKGAGFQGFQVICSAFNTYVMEFLK  363



>gb|AGS49200.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/175 (47%), Positives = 112/175 (64%), Gaps = 2/175 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVIFEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEF  187
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEF  362



>ref|XP_010934981.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=240

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFE V  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP  PG+ H
Sbjct  66   KKLLEFYKGFEDVNVLVDVGGGIGATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEH  124

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P+GDAI MKW++  W DE C +I+ +CY ALP  GK++ CE +LP+  +  
Sbjct  125  VGGDMFTSVPSGDAILMKWIMHDWSDEHCAKILENCYKALPNNGKVILCECILPVAPEPV  184

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               + +   D+ +M  +   GK RTE++Y+ L++  GF+ F+A Y      VL F K
Sbjct  185  PSAQSVFHLDM-IMLAHNPGGKERTEKQYQDLTKRAGFTGFKAQYCFSTAWVLVFTK  240



>gb|AAQ24355.1| O-methyltransferase [Zea mays]
Length=358

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 108/166 (65%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK +  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKAIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYI  353



>gb|AGS49188.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W    C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSGAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49219.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R   E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERHGREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49197.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I   HP I+ G+NF+LP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSHHPHIS-GVNFNLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRKLAKGAGFSGFKATYIYANAWAIEFIK  364



>sp|Q43046.1|COMT1_POPKI RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus sieboldii x Populus 
grandidentata]
 dbj|BAA08558.1| caffeic acid O-methyltransferase [Populus kitakamiensis]
Length=365

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+PN DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPNADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L+   GF  F      F   V+EF+K
Sbjct  307  SLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLANGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|AGS49207.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K   D Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KRLQDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_006441468.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
 gb|ESR54708.1| hypothetical protein CICLE_v10020874mg [Citrus clementina]
Length=352

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/180 (46%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I  K+P I +GINFDLP V+Q +P  PG+ 
Sbjct  177  LQKILEAYKGFEHIKQLVDVGGSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVK  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +CY ++P+ GK++  E VLP   + 
Sbjct  236  HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCYKSIPEDGKVIVVESVLPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
            +  +++    D+ VMT Y   GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  296  STHSKINSLADVLVMTQYPG-GKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>gb|AEI54336.1| S-adenosyl-L-methionine: caffeic acid 3-0-methyltransferase [Glycine 
max]
Length=365

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 115/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ ++T +   GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKGVVHIDVIMLT-HNPGGKERTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>gb|AFK40372.1| unknown [Lotus japonicus]
Length=365

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAVINMIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFQVLCCAFNSYVMEFLK  363



>gb|AGS49213.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y  FEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYPDFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>gb|AGS49198.1| O-methyltransferase [Zea mays]
Length=364

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I  G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLLAITSRHPHI-PGVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVDECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSRFKATYIYANAWAIEFIK  364



>gb|AGS49216.1| O-methyltransferase [Zea mays]
Length=364

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ + P  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISETPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI +KW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILVKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_003526767.1| PREDICTED: caffeic acid 3-O-methyltransferase isoform 1 [Glycine 
max]
 gb|KHN23294.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V+  AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLPHVIGDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPEADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVLCCAFNTYVMEFLK  363



>ref|XP_008803442.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X2 
[Phoenix dactylifera]
Length=330

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +K  LD Y GFEG+  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP IPG+ 
Sbjct  155  VKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLPHVISEAPVIPGVV  213

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DAIFMKW+L  W DE C  I+ +C+ ALP  GK++  E +LP   + 
Sbjct  214  HVGGDMFSSIPRADAIFMKWILHDWSDEHCLNILKNCWKALPDNGKVIVAECLLPEAPET  273

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               T++    D+ ++T Y   GK RT++E+  L++  GFS F+A        V+EF K
Sbjct  274  NAETQIRYYADLAMLT-YNIGGKERTKKEFESLAKEAGFSRFKAECCVLNIWVMEFLK  330



>dbj|BAK42963.1| caffeic acid O-methylltransferase [Chrysanthemum x morifolium]
Length=355

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GF+ ++ LVDVGG  G  L MI+ KHPSI +GINFDLP V+Q A   PGI 
Sbjct  180  MKKILDIYDGFDNLSTLVDVGGGTGASLNMIVSKHPSI-KGINFDLPHVIQDATTYPGIE  238

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+P GDAIFMKW+   W D  C + + +CY ALP  GK++  E +LP   D 
Sbjct  239  HVGGDMFESVPKGDAIFMKWICHDWSDAHCLKFLKNCYKALPDNGKVIVAECILPETPDT  298

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF+ FR         V+EF K
Sbjct  299  SPATQNVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFTGFRKACCALNTWVMEFTK  355



>gb|EMT30204.1| Caffeic acid 3-O-methyltransferase [Aegilops tauschii]
Length=339

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 116/177 (66%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GF+GV  LVDVGG  G  +  I+ ++PSI +G+NFDLP V+ +AP+  G+ H
Sbjct  165  KKLLEFYKGFDGVGTLVDVGGGVGATIHTILCRYPSI-EGVNFDLPHVISEAPSFAGVHH  223

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            +GGDMFK +P+GDAI MKW+L  W DE C  ++S+CY ALP  GK+V  E +LP++ D+T
Sbjct  224  IGGDMFKKVPSGDAILMKWILHDWNDEHCTTLLSNCYDALPAHGKVVIVEYILPVKPDET  283

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               +   E D+ ++T +   GK R   EY +L+RS GF+S +A YV     V+E  K
Sbjct  284  ATAQRSFEADMIMLT-HTPGGKERYLREYEELARSAGFASVKATYVYSNIWVIELNK  339



>ref|XP_006420931.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
 gb|ESR34171.1| hypothetical protein CICLE_v10005230mg [Citrus clementina]
Length=363

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 117/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK FL+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP  PGI 
Sbjct  186  MKKFLENYKGFEGLQSVVDVGGGIGASLDMIISKYPSI-KGINFDLPHVIQDAPAYPGIE  244

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  +AIFMKW+   W +E C +I+ +CY ALP+ GK++  + +LP+  D 
Sbjct  245  HVGGDMFVSIPKAEAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVVDCILPVLPDT  304

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  ++ +++ D F M  Y   G+  TE++++ L+++ GF  F+     F   ++EF K
Sbjct  305  SLASKQVIQLDCF-MLAYTIGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK  361



>gb|AGS49186.1| O-methyltransferase [Zea mays]
Length=364

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+ +L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFCELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010537046.1| PREDICTED: flavone 3'-O-methyltransferase 1 [Tarenaya hassleriana]
Length=366

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG++ +VDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ PGI 
Sbjct  189  MKKILETYNGFEGLSSVVDVGGGIGATLSMIVSKYPAI-KGINFDLPHVIEDAPSYPGIE  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDP  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  308  SLLTKQVVHIDC-IMLAHNPGGKERTEKEFEALAKGSGFHGFQVVCNAFGTYIMEFLK  364



>ref|NP_001266643.1| quercetin 3-O-methyltransferase 1 [Zea mays]
 gb|ACG37598.1| quercetin 3-O-methyltransferase 1 [Zea mays]
Length=364

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A  +      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATCIYANAWAIEFIK  364



>ref|XP_010478733.1| PREDICTED: flavone 3'-O-methyltransferase 1-like [Camelina sativa]
Length=352

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 114/178 (64%), Gaps = 1/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+ FL  Y+GF+GV  LVDVGG  G  L  I+ KHP I + INFDLP V+  +    GI 
Sbjct  174  MEEFLKSYNGFDGVKSLVDVGGGDGSILSRIISKHPHIIKAINFDLPSVINTSSASSGIE  233

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +V GDMF SIP G+AIFMKWML +W DE C +I+S+CY +LP  GK++  + V+P    D
Sbjct  234  YVSGDMFTSIPKGEAIFMKWMLHSWDDEHCVKILSNCYQSLPSNGKVIVVDMVIPDLPGD  293

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            T   R L + ++F+M +    GK RT++E+  L+R  GFSS +  +    ++V+EF K
Sbjct  294  TLLDRSLFQFELFMMNM-NPSGKERTKKEFETLARLAGFSSVQVPFTSLCFSVVEFHK  350



>gb|AGS49199.1| O-methyltransferase [Zea mays]
Length=364

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD   GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFCTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|NP_001240003.1| uncharacterized protein LOC100780100 [Glycine max]
 gb|ACU22737.1| unknown [Glycine max]
 gb|KHN19570.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=365

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F+     F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFQVLCCAFNTYVMEFLK  363



>emb|CDY18302.1| BnaC09g30520D [Brassica napus]
 emb|CDY18304.1| BnaC09g30540D [Brassica napus]
Length=206

 Score =   168 bits (426),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+  LVDVGG  G  L+MI+ K+P++ +GINFDLP V++ AP+ PG+ 
Sbjct  29   MKKILETYNGFEGLVSLVDVGGGIGATLKMIVSKYPNL-KGINFDLPHVIEDAPSHPGVE  87

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP+ GK++  E +LP   D 
Sbjct  88   HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYEALPENGKVILAECILPETLDS  147

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M      GK RTE+EY  L++  GF   +     F   V+E  K
Sbjct  148  SLSTKQVVNVDC-IMLALNPGGKERTEKEYEALAKGSGFEGIKVVCNVFGVYVIELLK  204



>ref|XP_010934914.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Elaeis guineensis]
Length=367

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFE V  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP  PG+ H
Sbjct  193  KKLLEFYKGFEDVNVLVDVGGGIGATLHMITSKYPHI-KGINFDLPHVISEAPPFPGVEH  251

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            +GGDMF S+P+GDAI MKW++  W DE C +I+ +C+ ALP  GK++ CE +LP+  +  
Sbjct  252  IGGDMFASVPSGDAILMKWIMHDWSDEHCAKILENCHKALPNNGKVILCECILPVAPEPI  311

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               + +   D+ +M  +   GK RTE+EY+ L++  GF+ F+A Y      VLEF K
Sbjct  312  PSAQGVFHVDM-IMLAHNPGGKERTEKEYQDLAKGAGFTGFKAQYCFSTAWVLEFTK  367



>ref|XP_008803441.1| PREDICTED: caffeic acid 3-O-methyltransferase-like isoform X1 
[Phoenix dactylifera]
Length=362

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +K  LD Y GFEG+  LVDVGG  G  L MI  K+P I +GINFDLP V+ +AP IPG+ 
Sbjct  187  VKKMLDTYEGFEGLKDLVDVGGGLGATLHMIASKYPHI-KGINFDLPHVISEAPVIPGVV  245

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DAIFMKW+L  W DE C  I+ +C+ ALP  GK++  E +LP   + 
Sbjct  246  HVGGDMFSSIPRADAIFMKWILHDWSDEHCLNILKNCWKALPDNGKVIVAECLLPEAPET  305

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
               T++    D+ ++T Y   GK RT++E+  L++  GFS F+A        V+EF K
Sbjct  306  NAETQIRYYADLAMLT-YNIGGKERTKKEFESLAKEAGFSRFKAECCVLNIWVMEFLK  362



>gb|EYU31472.1| hypothetical protein MIMGU_mgv1a019059mg, partial [Erythranthe 
guttata]
Length=242

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 114/163 (70%), Gaps = 2/163 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            +K  L+ Y GFEG+  +VDVGG  G  L MI+ K+PSI +GINFDLP V+Q AP+ PG+ 
Sbjct  67   VKKILEIYDGFEGIESVVDVGGGTGAILNMIISKYPSI-KGINFDLPHVIQHAPSYPGVE  125

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            H+GGDMF S+P GDAIFMKW++  W DE+C +++ +C+ +L + GK++  E ++P + D 
Sbjct  126  HIGGDMFVSVPKGDAIFMKWIVHDWSDEQCLKLLKNCHNSLQENGKVILAELIMPEEPDK  185

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFR  226
            +  T+ +L  D+ ++T +   G+ RTE+E+  L+++ GF  FR
Sbjct  186  SVATKTVLHSDVLMLT-HNPGGRERTEKEFHTLAKAAGFREFR  227



>sp|P59049.1|OMT1_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 1; AltName: Full=Flavonol 
3-O-methyltransferase 1 [Chrysosplenium americanum]
Length=343

 Score =   172 bits (436),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK     Y GF+G+T LVDVGG  G  L MI+ K+P+I + INFDLP V++ AP  PGI 
Sbjct  164  MKKVFQAYQGFQGLTSLVDVGGGTGATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIE  222

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C +++ +CY ALP  GK++  E +LP   D 
Sbjct  223  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDS  282

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+  +  +   GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  283  SLATKGVVHIDVITVA-HNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>ref|NP_001242325.1| uncharacterized protein LOC100805999 [Glycine max]
 gb|ACU21012.1| unknown [Glycine max]
Length=365

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFE +  LVDVGG  G  + MI+ KHP+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYTGFESLKSLVDVGGGTGAVINMIVSKHPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  + +LP+  D 
Sbjct  247  YVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYQALPDNGKVIVAQCILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGSGFQGFRVVCCAFNTNIMEFLK  363



>gb|AFZ78575.1| caffeic acid O-methyltransferase [Populus tomentosa]
Length=365

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSFPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  307  SLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|AEW26161.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26162.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26169.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26170.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26174.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26179.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26180.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26183.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26184.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26185.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26188.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26189.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26190.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26192.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26193.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26194.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26195.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26196.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26197.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26198.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26199.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26202.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26203.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26204.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26207.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26208.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26214.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26217.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26219.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26220.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26227.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26228.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26229.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26230.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26239.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
 gb|AEW26241.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
 gb|AEW26242.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26245.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
 gb|AEW26246.1| caffeic acid-O-methyltransferase, partial [Medicago falcata]
Length=224

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  47   MKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  105

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  106  HVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  165

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RT++E+  L++  GF  F+     F   ++EF K
Sbjct  166  SLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>gb|ADB82906.1| caffeic O-methyltransferase1 [Eucalyptus camaldulensis]
Length=366

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP +PG+ 
Sbjct  189  MKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVK  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY ALP  GK++  E VLP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  308  SLATKNVIHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>ref|XP_003634161.1| PREDICTED: caffeic acid 3-O-methyltransferase [Vitis vinifera]
Length=364

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  L MI+ K+P+I +GINFDLP V+  AP+ PG+ 
Sbjct  187  MKKILEAYKGFEGLTSIVDVGGGTGATLNMIISKYPTI-KGINFDLPHVIDDAPSYPGVE  245

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDMF S+P GDAIFMKW+   W D  C + + +CY ALP  GK++  E +LP+  D 
Sbjct  246  NVGGDMFVSVPKGDAIFMKWICHDWSDAHCLKFLKNCYQALPDNGKVIVAECILPVAPDT  305

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F+     F   ++EF K
Sbjct  306  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFKVVCCAFNTWIMEFCK  362



>gb|AGS49182.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I++ +NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHISR-VNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W    C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSGAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKATYIYANAWAIEFIK  364



>ref|XP_010048429.1| PREDICTED: caffeic acid 3-O-methyltransferase [Eucalyptus grandis]
Length=366

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP +PG+ 
Sbjct  189  MKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVK  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY ALP  GK++  E VLP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  308  SLATKNVIHIDC-IMLAHNPGGKERTQKEFEALAKGAGFQGFQVMCCAFGTHVMEFLK  364



>gb|AAD48913.1|AF139533_1 caffeate O-methyltransferase [Liquidambar styraciflua]
Length=367

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+P I +GINFDLP V+++AP+ PG+ 
Sbjct  190  MKKILETYKGFEGLGSVVDVGGGTGAHLNMIIAKYPMI-KGINFDLPHVIEEAPSYPGVE  248

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + +  CY ALP  GK++  E +LP+  D 
Sbjct  249  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKKCYEALPTNGKVILAECILPVAPDA  308

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  FR     +   ++EF K
Sbjct  309  SLPTKAVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFEGFRVALCAYNTWIIEFLK  365



>ref|XP_009757562.1| PREDICTED: caffeic acid 3-O-methyltransferase [Nicotiana sylvestris]
Length=363

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  + MI+ K+PSI +GINFDLP V+  AP  PG+ 
Sbjct  188  MKKILEDYKGFEGLNSIVDVGGGTGATVNMIVSKYPSI-KGINFDLPHVIGDAPTYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W DE C + + +CY ALP  GK++  E +LP   D 
Sbjct  247  HVGGDMFASVPKADAIFMKWICHDWSDEHCLKFLKNCYEALPANGKVIIAECILPEAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+  +  DI VM  +   GK RTE+E+  L++  GF+ FR     +   V+EF K
Sbjct  307  SLATKNTVHVDI-VMLAHNPGGKERTEKEFEALAKGAGFTGFRKACCAYNTWVMEFNK  363



>ref|XP_010520935.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Tarenaya 
hassleriana]
Length=356

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 118/178 (66%), Gaps = 3/178 (2%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG++ LVDVGG     L MI+ K+P++ +G NFDLP VV+ AP+ PGI 
Sbjct  182  MKKILETYNGFEGLSSLVDVGGGVRAILNMIVSKYPNV-KGTNFDLPHVVEVAPSYPGIK  240

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            +VGGDMF+++P GDAIFMKW+   W DE+C +++ +CY ALP  GK++  E +LP+  D 
Sbjct  241  NVGGDMFETVPKGDAIFMKWICHDWNDEQCLKLLKNCYKALPDNGKVIVAEWILPLVRDS  300

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L +  D+ ++ +    GK RT++E+  L+R  GF  F+     F   ++EF K
Sbjct  301  SLSTKLAIHTDVVMLAL--NPGKERTKDEFEALARGAGFQGFKVICNAFGTCIMEFLK  356



>gb|ACY66932.1| caffeic O-methyltransferase 1 [Eucalyptus camaldulensis]
Length=366

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  +VDVGG  G  L MI+ K+PS+ +GINFDLP V++ AP +PG+ 
Sbjct  189  MKKILETYKGFEGLETVVDVGGGTGAVLSMIVAKYPSM-KGINFDLPHVIEDAPPLPGVK  247

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W D+ C + + +CY ALP  GK++  E VLP+  D 
Sbjct  248  HVGGDMFVSVPKGDAIFMKWICHDWSDDHCAKFLKNCYDALPNNGKVIVAECVLPVYPDT  307

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RT++E+  L++  GF  F+     F   V+EF K
Sbjct  308  SLATKNVIHIDC-IMLAHNPGGKERTQKEFETLAKGAGFQGFQVMCCAFGTHVMEFLK  364



>emb|CDY19037.1| BnaC01g20310D [Brassica napus]
Length=369

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG++ +VDVGG  G  L MI+ K+P+I +G NFDLP V++ AP++ GI 
Sbjct  192  MKKILEAYKGFEGLSSVVDVGGGIGASLHMIVSKYPTI-KGTNFDLPHVIENAPSLAGIE  250

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HV GDMF S+P GDAIF+KW+   W DE C +++ +CY ALP  GK++A E ++PI  D 
Sbjct  251  HVKGDMFVSVPIGDAIFLKWVCHDWSDEHCLKLLKNCYEALPDDGKVIAVECLVPIAPDS  310

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  + A G+ RTEEE+  L+R VGF  F+     F   ++EF K
Sbjct  311  SLLTKQIVHLDCIMMA-HTAGGRERTEEEFESLARRVGFKGFQVICSVFGTYIMEFYK  367



>gb|AGS49194.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 108/166 (65%), Gaps = 2/166 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYV  214
             + + +   D+ +M  +   GK R   E+R+L++  GFS F+A Y+
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYGREFRELAKGAGFSGFKATYI  353



>ref|XP_008357058.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Malus domestica]
Length=367

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKLLETYKGFEGLTSVVDVGGGIGSVIHMIVSKYPSI-KGINFDLPHVIKDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAI MK +   W DE C +++ +C+ ALP  GK++  E ++P+  D 
Sbjct  247  HVGGDMFVSVPKGDAIVMKHICHDWSDEHCLKLLKNCHAALPDNGKVILVEIIIPVSPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L    D+  M      GK RTEEE+  L++  GF  FR     F   V+EF K
Sbjct  307  SLATKLANHIDVL-MLANNPGGKERTEEEFEALAKESGFQGFRVMCSAFHSNVIEFLK  363



>ref|XP_004502769.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Cicer arietinum]
Length=365

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+  G+ 
Sbjct  188  MKKILEIYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYQGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFASIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++S GF  F+ F   F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKSAGFQGFKVFCSAFNTYIMEFLK  363



>ref|XP_002317838.1| Chain A family protein [Populus trichocarpa]
 gb|ABK92533.1| unknown [Populus trichocarpa]
 gb|ACC63886.1| caffeic acid 3-O-methyltransferase [Populus trichocarpa]
 gb|ACJ76441.1| caffeic acid 3-O-methyltransferase 1 [Populus trichocarpa]
 gb|EEE96058.1| Chain A family protein [Populus trichocarpa]
Length=364

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKLLETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>sp|Q00763.1|COMT1_POPTM RecName: Full=Caffeic acid 3-O-methyltransferase 1; Short=CAOMT-1; 
Short=COMT-1; AltName: Full=S-adenosysl-L-methionine:caffeic 
acid 3-O-methyltransferase 1 [Populus tremuloides]
 emb|CAA44006.1| lignin bispecific acid/5-hydroxyferulic acid methyltransferase 
[Populus tremuloides]
 gb|AAB61731.1| caffeic acid/5-hydroxyferulic acid O-methyltransferase [Populus 
tremuloides]
Length=365

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 114/178 (64%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T LVDVGG  G  +  I+ K+PSI +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILETYKGFEGLTSLVDVGGGTGAVVNTIVSKYPSI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W D  C + + +CY ALP+ GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDAHCLKFLKNCYDALPENGKVILVECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   V+EF+K
Sbjct  307  SLATKGVVHVDV-IMLAHNPGGKERTEKEFEGLAKGAGFQGFEVMCCAFNTHVIEFRK  363



>gb|AEV93478.1| caffeic acid O-methyltransferase [Caragana korshinskii]
Length=365

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  + MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  188  MKKILELYTGFEGLKSLVDVGGGTGAVVNMIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKADAVFMKWICHDWSDEHCLKFLKNCYEALPNNGKVIVAECILPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RTE+E+  L++  GF  F      F   ++EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTEKEFEALAKGAGFQGFHVLCCAFNTYIMEFLK  363



>ref|XP_007039215.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
 gb|EOY23716.1| Caffeic acid 3-O-methyltransferase 1 [Theobroma cacao]
Length=365

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M+  L+ Y GFEGV  LVDVGG  G  L MI+ KHPSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MRKILETYDGFEGVKTLVDVGGGIGASLSMIISKHPSI-KGINFDLPHVIEDAPAYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E  LP   D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCSKFLKNCYQALPDNGKVIVAECNLPDYPDP  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RT +E+  L++  GF  F+     F   ++EF K
Sbjct  307  SLATKLVVHIDC-IMLAHNPGGKERTAKEFEALAKGAGFQGFQVKCCAFGTYIMEFLK  363



>gb|ADX98508.1| caffeic acid 3-O-methyltransferase [Panicum virgatum]
Length=361

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 112/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  L+ Y GFEGV  LVDVGG  G  L  I  ++P I +G+NFDLP V+ +AP  PG+ H
Sbjct  187  KKLLEFYAGFEGVGTLVDVGGGVGATLHAITSRYPGI-RGVNFDLPHVISEAPPFPGVEH  245

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMFK++P GDAI MKW+L  W D  C  I+ +CY ALP GGK++A E +LP+  + T
Sbjct  246  VGGDMFKAVPAGDAILMKWILHDWSDAHCAAILKNCYDALPAGGKVIAVECILPVNPEAT  305

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+ +L++  GF+ F+A Y+      +EF K
Sbjct  306  PKAQGVFHVDM-IMLAHNPGGKERYEREFEELAKGAGFTGFKATYIYANAWAIEFTK  361



>gb|AEW26209.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
caerulea]
Length=224

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  47   MKKILETYTGFEGLKSLVDVGGGTGAXINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  105

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  106  HVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  165

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RT++E+  L++  GF  F+     F   ++EF K
Sbjct  166  SLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLAKGAGFQGFKVHCNAFNTYIMEFLK  222



>ref|XP_006478222.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGG  G+ L+ I  K+P I +GINFDLP V+Q AP  PG+ 
Sbjct  177  IQKILEAYKGFEHIQQLVDVGGCLGNTLKAITSKYPQI-KGINFDLPHVIQHAPKYPGVE  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+++P GDAIFMKW+L  W DE C +++ +CY ++P+ GK++  E +LP   + 
Sbjct  236  HVGGDMFQNVPKGDAIFMKWILHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
            +  +++  +GD+ +MT     GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  296  STHSKINSQGDVLMMT-QNPGGKERTKHEFTTLATEAGFSGIR--FVCFFYNLWVMEFYK  352



>ref|XP_006478347.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=352

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 116/178 (65%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGG  G+ L+ I  K+P I +GINFDLP V+Q AP  PG+ 
Sbjct  177  IQKILEAYKGFEHIEQLVDVGGCLGNTLKAITSKYPHI-KGINFDLPHVIQHAPKYPGVE  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+++P GDAIFMKW+L  W DE C +++ +CY ++P+ GK++  E +LP   D 
Sbjct  236  HVGGDMFQNVPKGDAIFMKWILHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPDT  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  +++  +GD+ +MT     GK RT+ E   L+   GFS  R   + + Y V+EF K
Sbjct  296  STHSKINSQGDVLMMT-QNPGGKERTKHELTTLATEAGFSGIRFVCLFYNYWVMEFYK  352



>gb|AGS49214.1| O-methyltransferase [Zea mays]
Length=364

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 107/163 (66%), Gaps = 2/163 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y GFEGV+ LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKLLDFYTGFEGVSTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVSTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRA  223
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEREFRELAKGAGFSGFKA  350



>dbj|BAC78827.1| caffeic acid O-methyltransferase [Rosa chinensis var. spontanea]
Length=365

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+T +VDVGG  G  + MI+ K+PSI +GINFDLP V++ AP  PG+ 
Sbjct  188  MKKILETYKGFEGLTSIVDVGGGTGAVVNMIVSKYPSI-KGINFDLPHVIEDAPQYPGVQ  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYAALPDNGKVILGECILPVAPDT  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RT +E+  L++  GF   R     F   V+EF K
Sbjct  307  SLATKGVVHIDV-IMLAHNPGGKERTGQEFEALAKGSGFQGIRVACNAFNTYVIEFLK  363



>sp|Q42653.1|OMT2_CHRAE RecName: Full=Quercetin 3-O-methyltransferase 2; AltName: Full=Flavonol 
3-O-methyltransferase 2 [Chrysosplenium americanum]
 gb|AAA86982.1| caffeic acid O-methyl transferase [Chrysosplenium americanum]
Length=343

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK     Y GF+G+T LVDVGG  G  L MI+ K+P+I + INFDLP V++ AP  PGI 
Sbjct  164  MKKVFQTYQGFQGLTSLVDVGGGTGATLTMILSKYPTI-RCINFDLPHVIEDAPEYPGIE  222

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C +++ +CY ALP  GK++  E +LP   D 
Sbjct  223  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKLLKNCYDALPNNGKVILAECILPEVPDS  282

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+  +  +   GK RTE+E+  L+++ GF  F+ F   F   ++EF K
Sbjct  283  SLATKGVVHIDVITVA-HNPGGKERTEKEFEALAKAAGFQGFQVFCNAFNTYIIEFSK  339



>ref|XP_006478226.1| PREDICTED: anthranilate N-methyltransferase-like [Citrus sinensis]
Length=393

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 120/180 (67%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I  K+P I +GINFDLP V+Q +P  PG+ 
Sbjct  218  LQKILEAYKGFEHIKQLVDVGGSLGNTLKAITSKYPHI-KGINFDLPHVIQHSPEYPGVK  276

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +C+ ++P+GGK++  E VLP   ++
Sbjct  277  HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIPEGGKVIVVESVLPELPEN  336

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
               +++    D+ VMT Y   GK RT+ E+  L+   GFS  R  +V FF+   V+EF K
Sbjct  337  GTHSKINSLADVLVMTQYPG-GKERTKHEFTTLATEAGFSGIR--FVCFFHNLWVMEFYK  393



>gb|KJB52492.1| hypothetical protein B456_008G264900 [Gossypium raimondii]
Length=387

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GF+G+  LVDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  210  MKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLPHVIEDAPSCPGVE  268

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP   D 
Sbjct  269  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDNGKVIVAECILPDYPDP  328

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  VM  +   GK RT +E++ L+   GF  F+     F   ++EF K
Sbjct  329  SLATKLVVHIDC-VMLAHNPGGKERTAKEFKALATGAGFQGFQIKCSAFGTNIMEFLK  385



>ref|NP_001289246.1| caffeic acid 3-O-methyltransferase [Pyrus x bretschneideri]
 gb|AGS44640.1| caffeic acid-O-methyltransferase [Pyrus x bretschneideri]
Length=365

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+T +VDVGG  G  L MI+ K+PSI + INFDLP V++ AP  PG+ 
Sbjct  188  MKKLLEIYNGFEGLTSIVDVGGGTGAVLNMIVSKYPSI-KDINFDLPHVIEDAPQYPGVE  246

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E + P+  D 
Sbjct  247  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCLKFLKNCYVALPDNGKVIVAECIFPVAPDS  306

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D  +M  +   GK RTE+E+  L++  GF  FR     F    +EF K
Sbjct  307  SLATKGVVHIDA-IMLAHNPGGKERTEKEFEALAKGFGFQGFRVVCCAFNTYAIEFFK  363



>gb|KHG13754.1| Caffeic acid 3-O-methyltransferase [Gossypium arboreum]
Length=387

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  LD Y GF+G+  LVDVGG  G  L MI+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  210  MKKILDTYDGFQGLKTLVDVGGGTGATLSMIVSKYPTI-KGINFDLPHVIEDAPSCPGVE  268

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P GDAIFMKW+   W DE C + + +CY ALP  GK++  E +LP   D 
Sbjct  269  HVGGDMFVSVPKGDAIFMKWICHDWSDEHCAKFLKNCYEALPDNGKVIVAECILPDYPDP  328

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+L++  D  +M  +   GK RT +E+  L++  GF  F+     F   ++EF K
Sbjct  329  SLATKLVVHIDC-IMLAHNPGGKERTAKEFEALAKGAGFQGFQITCSAFGTNIMEFLK  385



>ref|XP_006441603.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
 gb|ESR54843.1| hypothetical protein CICLE_v10020875mg [Citrus clementina]
Length=352

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 119/180 (66%), Gaps = 6/180 (3%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGG  G+ L+ I  K+P I +GINFDLP V+Q AP  PG+ 
Sbjct  177  IQKILEAYKGFEHIQQLVDVGGCLGNTLKAITSKYPHI-KGINFDLPHVIQHAPKYPGVE  235

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+++P GDAIFMKW+L  W DE C +++ +CY ++P+ GK++  E +LP   + 
Sbjct  236  HVGGDMFQNVPKGDAIFMKWILHDWSDEHCLKLLKNCYKSIPEDGKVIVVEAILPELPET  295

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYT--VLEFQK  181
            +  +++  +GD+ +MT     GK RT+ E+  L+   GFS  R  +V FFY   V+EF K
Sbjct  296  STHSKINSQGDVLMMT-QNPGGKERTKHEFTTLATEAGFSGIR--FVCFFYNYWVIEFYK  352



>ref|XP_006478241.1| PREDICTED: caffeic acid 3-O-methyltransferase 1-like [Citrus 
sinensis]
Length=432

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 117/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            ++  L+ Y GFE + +LVDVGGS G+ L+ I+ K+P I +GINFDLP V+Q AP  PG+ 
Sbjct  257  IQKILEAYKGFEHIKQLVDVGGSLGNTLKAIISKYPHI-KGINFDLPHVIQHAPEYPGVK  315

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF+S+PNGDAI +KW+L  W DE C +++ +C+ ++ +GGKL+  E VLP   + 
Sbjct  316  HVGGDMFQSVPNGDAILIKWILHDWSDEHCLKLLKNCHKSIHEGGKLIVVESVLPELPET  375

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  +++   GD+ VMT Y   GK RT+ E+  L+   GFS  R     F   V+EF K
Sbjct  376  STHSKINFLGDVLVMTQYPG-GKERTKHEFMTLATGAGFSGVRFDCFFFNLWVMEFHK  432



>gb|AEW26163.1| caffeic acid-O-methyltransferase, partial [Medicago sativa subsp. 
x varia]
Length=224

 Score =   167 bits (424),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 112/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y GFEG+  LVDVGG  G  +  I+ K+P+I +GINFDLP V++ AP+ PG+ 
Sbjct  47   MKKILETYTGFEGLKSLVDVGGGTGAVINTIVSKYPTI-KGINFDLPHVIEDAPSYPGVE  105

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF SIP  DA+FMKW+   W DE C + + +CY ALP  GK++  E +LP+  D 
Sbjct  106  HVGGDMFVSIPKADAVFMKWICHDWSDEHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  165

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++  D+ +M  +   GK RT++E+  L +  GF  F+     F   ++EF K
Sbjct  166  SLATKGVVHIDV-IMLAHNPGGKERTQKEFEDLXKGAGFQGFKVHCNAFNTYIMEFLK  222



>ref|XP_006485822.1| PREDICTED: caffeic acid 3-O-methyltransferase-like [Citrus sinensis]
Length=274

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            M + LDGY+GF+GV RLV+VGGSAGDCLRMI++KH  I +G+NFDLPEVV +AP+IPG+T
Sbjct  148  MTSVLDGYNGFKGVKRLVEVGGSAGDCLRMILQKHRFICEGMNFDLPEVVGEAPSIPGVT  207

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLV  391
            H+GGDMFKSIP  DAIFMKW+LTTW D+ECK IM +CY AL  GG+L+
Sbjct  208  HIGGDMFKSIPATDAIFMKWVLTTWTDDECKLIMENCYKALLAGGELL  255



>ref|XP_009395003.1| PREDICTED: flavone O-methyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/177 (47%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K FL  Y G + V  LVDVGG  G  L MI   HP I  GIN+DLP V+  AP +PG+ H
Sbjct  234  KKFLQVYRGLDDVKVLVDVGGGIGATLHMITSTHPHI-HGINYDLPHVISDAPPLPGVDH  292

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            V GDMF+S+P GDAI MKW+L  W DE C +I+++C+ ALP+ GK++A E VLP+  + +
Sbjct  293  VSGDMFESVPGGDAILMKWILHDWSDESCAKILNNCWKALPENGKVIAVECVLPVVPEPS  352

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             RT+ +   D+ +M  +   GK RTE E+++L++  GFS F+  YV      LEF K
Sbjct  353  LRTQSVCHVDL-IMLAHNPGGKERTEMEFQELAKQAGFSGFKPTYVYANTWALEFTK  408



>ref|XP_006442372.1| hypothetical protein CICLE_v10020761mg [Citrus clementina]
 gb|ESR55612.1| hypothetical protein CICLE_v10020761mg [Citrus clementina]
Length=363

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 118/178 (66%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK FL+ Y GFEG+  +VDVGG  G  L +I+ K+PSI +GINFDLP V+Q AP  PGI 
Sbjct  186  MKKFLENYKGFEGLKSVVDVGGGIGASLNIIISKYPSI-KGINFDLPHVIQDAPAYPGIE  244

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HV GDMF SIP GDAIFMKW+   W +E C +I+ +CY ALP+ GK++  + +LP+  D 
Sbjct  245  HVAGDMFVSIPKGDAIFMKWICHNWSEEACVKILKNCYEALPEDGKVIVADCILPVLPDT  304

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  ++ +++ D  ++T   + G+  TE++++ L+++ GF  F+     F   ++EF K
Sbjct  305  SLASKHVIQLDCIMLTT-TSGGREMTEQDFKTLAKAAGFQGFKVVCSAFNTYIMEFLK  361



>gb|KHN19569.1| Caffeic acid 3-O-methyltransferase [Glycine soja]
Length=232

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+   GFE +  LVDVGG  G  + MI+ K+P+I +GINFDL  V++ AP+ PG+ 
Sbjct  55   MKKILETLSGFESLKSLVDVGGGTGAVINMIVSKYPTI-KGINFDLSHVIEDAPSYPGVE  113

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P  DAIFMKW+   W D+ C + + +CY ALP  GK++  E +LP+  D 
Sbjct  114  HVGGDMFVSVPKADAIFMKWICHDWSDDHCLKFLKNCYEALPDNGKVIVAECILPVAPDS  173

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            +  T+ ++ GD+ +M  +   GK RTEEE+  L++  GF  F      F   V+EF K
Sbjct  174  SLATKGVVHGDV-IMLAHHPGGKERTEEEFEALAKGSGFQGFLVLCCAFNTYVMEFLK  230



>gb|AFM73597.1| caffeate O-methyltransferase, partial [Populus simonii]
Length=284

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 113/178 (63%), Gaps = 2/178 (1%)
 Frame = -3

Query  714  MKAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGIT  535
            MK  L+ Y+GFEG+ ++VDVGG  G  L MI+ K+P I +G NFDLP VV   P+ PG+ 
Sbjct  107  MKKILETYNGFEGLKKVVDVGGGTGAILNMIISKYPHI-KGTNFDLPHVVADGPDYPGVN  165

Query  534  HVGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDD  355
            HVGGDMF S+P+GDAIFMKW+L  W DE C +I+ +CY ALP  GK++  E +LP+  + 
Sbjct  166  HVGGDMFVSVPSGDAIFMKWILHDWSDEHCAKILKNCYKALPDSGKVIIAESILPVAPET  225

Query  354  TQRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
            T     + + D  +M  +   GK R E+E+  L++  GF+ F+     +   V+EF K
Sbjct  226  TIGAHGVFQLD-NIMLAHNPGGKERMEKEFEALAKGAGFAGFKVVCCAYGCWVMEFLK  282



>gb|AGS49217.1| O-methyltransferase [Zea mays]
Length=364

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 111/177 (63%), Gaps = 2/177 (1%)
 Frame = -3

Query  711  KAFLDGYHGFEGVTRLVDVGGSAGDCLRMIMEKHPSITQGINFDLPEVVQKAPNIPGITH  532
            K  LD Y G EG + LVDVGG  G  L  I  +HP I+ G+NFDLP V+ +AP  PG+ H
Sbjct  190  KKPLDFYTGVEGASTLVDVGGGVGATLHAITSRHPHIS-GVNFDLPHVISEAPPFPGVRH  248

Query  531  VGGDMFKSIPNGDAIFMKWMLTTWMDEECKEIMSSCYGALPQGGKLVACEPVLPIQTDDT  352
            VGGDMF S+P GDAI MKW+L  W D  C  ++ +CY ALP+ GK++  E VLP+ T+ T
Sbjct  249  VGGDMFASVPAGDAILMKWILHDWSDAHCATLLKNCYDALPENGKVIVVECVLPVNTEAT  308

Query  351  QRTRLLLEGDIFVMTIYRAKGKHRTEEEYRQLSRSVGFSSFRAFYVDFFYTVLEFQK  181
             + + +   D+ +M  +   GK R E E+R+L++  GFS F+A Y+      +EF K
Sbjct  309  PKAQGVFHVDM-IMLAHNPGGKERYEHEFRELAKGAGFSGFKATYIYANAWAIEFIK  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1246782646395