BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031O07

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHG00684.1|  Glycine dehydrogenase [decarboxylating], mitochon...    363   2e-114   Gossypium arboreum [tree cotton]
gb|KJB65560.1|  hypothetical protein B456_010G101200                    363   3e-114   Gossypium raimondii
ref|XP_011081684.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    361   2e-113   Sesamum indicum [beniseed]
gb|KJB54687.1|  hypothetical protein B456_009G045100                    361   2e-113   Gossypium raimondii
ref|XP_007012280.1|  Glycine decarboxylase P-protein 1                  360   4e-113   
gb|KHG06307.1|  Glycine dehydrogenase [decarboxylating], mitochon...    359   5e-113   Gossypium arboreum [tree cotton]
ref|XP_010262151.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    359   8e-113   Nelumbo nucifera [Indian lotus]
ref|XP_009620998.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    358   1e-112   Nicotiana tomentosiformis
dbj|BAD81531.1|  P protein-like                                         333   3e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011097886.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    358   3e-112   Sesamum indicum [beniseed]
ref|XP_003544533.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    357   6e-112   Glycine max [soybeans]
ref|XP_009797115.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    357   7e-112   Nicotiana sylvestris
sp|O49954.1|GCSP_SOLTU  RecName: Full=Glycine dehydrogenase (deca...    357   7e-112   Solanum tuberosum [potatoes]
ref|XP_004245101.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    356   8e-112   Solanum lycopersicum
emb|CBI20667.3|  unnamed protein product                                348   9e-112   Vitis vinifera
gb|AEP95746.1|  glycine decarboxylase complex subunit P                 333   1e-111   Cicer arietinum [garbanzo]
ref|XP_006361002.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    356   2e-111   
gb|AEP95751.1|  glycine decarboxylase complex subunit P                 332   5e-111   Cicer arietinum [garbanzo]
dbj|BAD81530.1|  P protein-like                                         332   1e-110   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010047334.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    352   3e-110   Eucalyptus grandis [rose gum]
emb|CDP08258.1|  unnamed protein product                                352   3e-110   Coffea canephora [robusta coffee]
ref|XP_004159575.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    349   3e-110   
ref|XP_003550270.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    352   5e-110   Glycine max [soybeans]
gb|EYU29323.1|  hypothetical protein MIMGU_mgv1a000648mg                351   8e-110   Erythranthe guttata [common monkey flower]
ref|XP_008444466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    351   1e-109   Cucumis melo [Oriental melon]
ref|XP_004142925.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    350   3e-109   Cucumis sativus [cucumbers]
emb|CAN63089.1|  hypothetical protein VITISV_032016                     349   3e-109   Vitis vinifera
gb|EYU20359.1|  hypothetical protein MIMGU_mgv1a000655mg                349   5e-109   Erythranthe guttata [common monkey flower]
ref|XP_010648358.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    349   6e-109   Vitis vinifera
gb|AAL24244.1|  AT4g33010/F26P21_130                                    340   7e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KDP34101.1|  hypothetical protein JCGZ_07672                         349   8e-109   Jatropha curcas
dbj|BAD81529.1|  P protein-like                                         334   8e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004498895.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    349   1e-108   
ref|XP_002516446.1|  glycine dehydrogenase, putative                    348   2e-108   Ricinus communis
sp|P26969.1|GCSP_PEA  RecName: Full=Glycine dehydrogenase (decarb...    347   3e-108   Pisum sativum [garden pea]
ref|XP_008220472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    347   3e-108   Prunus mume [ume]
ref|XP_003589000.1|  Glycine dehydrogenase P protein                    347   4e-108   Medicago truncatula
gb|KHN29723.1|  Glycine dehydrogenase [decarboxylating], mitochon...    346   5e-108   Glycine soja [wild soybean]
ref|XP_008797766.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    346   5e-108   Phoenix dactylifera
ref|XP_003523643.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    346   5e-108   Glycine max [soybeans]
ref|XP_007161011.1|  hypothetical protein PHAVU_001G035500g             347   6e-108   Phaseolus vulgaris [French bean]
gb|ABO61734.1|  mitochondrial glycine decarboxylase complex P-pro...    346   6e-108   Populus tremuloides
ref|XP_002308562.1|  P-protein subunit of glycine decarboxylase e...    345   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_011019466.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    345   2e-107   Populus euphratica
ref|XP_008808050.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    345   2e-107   Phoenix dactylifera
ref|NP_195027.1|  glycine dehydrogenase [decarboxylating] 2             345   2e-107   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68740.1|  P-Protein - like protein                                345   2e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010519851.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    345   2e-107   Tarenaya hassleriana [spider flower]
ref|XP_002867212.1|  hypothetical protein ARALYDRAFT_491390             344   3e-107   
ref|XP_007227061.1|  hypothetical protein PRUPE_ppa000675mg             344   3e-107   
ref|XP_008393646.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    344   4e-107   Malus domestica [apple tree]
ref|XP_009361863.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    344   5e-107   Pyrus x bretschneideri [bai li]
ref|XP_009361869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    344   5e-107   Pyrus x bretschneideri [bai li]
gb|AFW56072.1|  hypothetical protein ZEAMMB73_271256                    329   1e-106   
ref|XP_010049196.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    343   1e-106   Eucalyptus grandis [rose gum]
ref|NP_001289247.1|  glycine dehydrogenase (decarboxylating), mit...    342   2e-106   Pyrus x bretschneideri [bai li]
gb|KHN32209.1|  Glycine dehydrogenase [decarboxylating], mitochon...    342   2e-106   Glycine soja [wild soybean]
ref|XP_003526001.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    342   2e-106   Glycine max [soybeans]
ref|XP_004291039.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    342   3e-106   Fragaria vesca subsp. vesca
ref|XP_009392931.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    341   3e-106   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAL57651.1|  AT4g33010/F26P21_130                                    341   4e-106   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29912.1|  hypothetical protein AALP_AA7G194500                    341   4e-106   Arabis alpina [alpine rockcress]
gb|EMS46370.1|  Glycine dehydrogenase [decarboxylating] B, mitoch...    336   5e-106   Triticum urartu
ref|NP_180178.1|  glycine decarboxylase P-protein 2                     341   7e-106   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98954.1|  putative glycine dehydrogenase                         341   7e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526062.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    341   7e-106   Tarenaya hassleriana [spider flower]
ref|XP_006412401.1|  hypothetical protein EUTSA_v10024257mg             342   1e-105   
gb|KFK32542.1|  hypothetical protein AALP_AA6G256500                    340   1e-105   Arabis alpina [alpine rockcress]
gb|KDO80088.1|  hypothetical protein CISIN_1g001531mg                   338   1e-105   Citrus sinensis [apfelsine]
gb|KHN37049.1|  Glycine dehydrogenase [decarboxylating], mitochon...    315   2e-105   Glycine soja [wild soybean]
ref|XP_006408846.1|  hypothetical protein EUTSA_v10001891mg             339   2e-105   Eutrema salsugineum [saltwater cress]
gb|AAA63798.1|  victorin binding protein                                339   3e-105   Avena sativa [cultivated oat]
ref|XP_010667776.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    339   3e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006601224.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    314   3e-105   
ref|XP_006644607.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    337   3e-105   Oryza brachyantha
ref|XP_006450834.1|  hypothetical protein CICLE_v10007310mg             338   5e-105   Citrus clementina [clementine]
ref|XP_002880741.1|  hypothetical protein ARALYDRAFT_481465             338   5e-105   
gb|ADM18296.1|  mitochondrial glycine decarboxylase complex P-pro...    320   6e-105   Nicotiana benthamiana
ref|XP_006475931.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    338   6e-105   Citrus sinensis [apfelsine]
emb|CDM83805.1|  unnamed protein product                                338   7e-105   Triticum aestivum [Canadian hard winter wheat]
gb|EAZ13293.1|  hypothetical protein OsJ_03218                          337   1e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044046.1|  Os01g0711400                                       337   1e-104   
gb|EAY75571.1|  hypothetical protein OsI_03474                          337   1e-104   Oryza sativa Indica Group [Indian rice]
emb|CBI27919.3|  unnamed protein product                                337   2e-104   Vitis vinifera
ref|XP_010942763.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    337   2e-104   Elaeis guineensis
gb|EMT12369.1|  Glycine dehydrogenase (decarboxylating), mitochon...    337   2e-104   
ref|XP_003569669.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    337   2e-104   Brachypodium distachyon [annual false brome]
ref|XP_002282271.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    337   2e-104   Vitis vinifera
gb|EAZ37623.1|  hypothetical protein OsJ_21958                          336   2e-104   Oryza sativa Japonica Group [Japonica rice]
gb|AAB82711.1|  glycine decarboxylase P subunit                         336   3e-104   x Tritordeum sp.
dbj|BAD35509.1|  putative glycine dehydrogenase                         335   5e-104   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008347531.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    313   5e-104   
ref|XP_002441849.1|  hypothetical protein SORBIDRAFT_08g003440          335   7e-104   Sorghum bicolor [broomcorn]
ref|XP_004969722.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    334   1e-103   
ref|XP_010097067.1|  Glycine cleavage system P protein 1                334   2e-103   
ref|XP_010925018.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    333   4e-103   Elaeis guineensis
ref|XP_008662474.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    332   1e-102   
ref|XP_008347532.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    310   2e-102   
ref|XP_010432628.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    331   2e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009401914.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    330   6e-102   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX75316.1|  BnaA01g03860D                                          330   7e-102   
emb|CDX68930.1|  BnaC01g05230D                                          330   7e-102   
ref|XP_009125119.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    330   8e-102   Brassica rapa
ref|XP_010437818.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    329   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006858311.1|  hypothetical protein AMTR_s00064p00096040          328   5e-101   Amborella trichopoda
ref|XP_010472637.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    327   9e-101   Camelina sativa [gold-of-pleasure]
emb|CAA81076.1|  P protein                                              327   1e-100   Flaveria pringlei
sp|P49361.1|GCSPA_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    327   1e-100   Flaveria pringlei
ref|XP_010429623.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    327   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_007136824.1|  hypothetical protein PHAVU_009G077400g             326   1e-100   Phaseolus vulgaris [French bean]
ref|XP_010417387.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    327   1e-100   Camelina sativa [gold-of-pleasure]
sp|O49852.1|GCSP_FLATR  RecName: Full=Glycine dehydrogenase (deca...    326   2e-100   Flaveria trinervia
sp|P49362.1|GCSPB_FLAPR  RecName: Full=Glycine dehydrogenase (dec...    326   2e-100   Flaveria pringlei
sp|O49850.1|GCSP_FLAAN  RecName: Full=Glycine dehydrogenase (deca...    326   2e-100   Flaveria anomala
ref|XP_006283054.1|  hypothetical protein CARUB_v10004049mg             324   1e-99    Capsella rubella
ref|XP_006296473.1|  hypothetical protein CARUB_v10025658mg             322   5e-99    Capsella rubella
gb|KJB54688.1|  hypothetical protein B456_009G045100                    311   6e-95    Gossypium raimondii
gb|ACN39938.1|  unknown                                                 304   5e-94    Picea sitchensis
emb|CAA38252.1|  P-protein subunit of glycine decarboxylase enzym...    278   2e-91    Pisum sativum [garden pea]
ref|XP_001755004.1|  predicted protein                                  300   2e-91    
ref|XP_001754864.1|  predicted protein                                  301   4e-91    
gb|KDO80089.1|  hypothetical protein CISIN_1g001531mg                   300   6e-91    Citrus sinensis [apfelsine]
ref|XP_001780310.1|  predicted protein                                  299   9e-91    
ref|XP_005850089.1|  hypothetical protein CHLNCDRAFT_34381              276   7e-90    Chlorella variabilis
ref|XP_002988429.1|  hypothetical protein SELMODRAFT_159459             282   1e-84    
ref|XP_002979861.1|  hypothetical protein SELMODRAFT_153563             282   2e-84    
ref|XP_001692993.1|  glycine cleavage system, P protein                 278   6e-83    Chlamydomonas reinhardtii
ref|XP_006371884.1|  hypothetical protein POPTR_0018s05150g             275   9e-83    
ref|WP_010472943.1|  glycine dehydrogenase                              275   9e-82    Acaryochloris sp. CCMEE 5410
ref|XP_002956892.1|  hypothetical protein VOLCADRAFT_107448             274   1e-81    Volvox carteri f. nagariensis
ref|XP_011398598.1|  Glycine dehydrogenase [decarboxylating], mit...    273   2e-80    Auxenochlorella protothecoides
ref|WP_012166094.1|  glycine dehydrogenase                              270   4e-80    Acaryochloris marina
gb|EMI20957.1|  glycine dehydrogenase                                   255   1e-79    Rhodopirellula maiorica SM1
ref|WP_040765024.1|  glycine dehydrogenase                              255   1e-79    Rhodopirellula maiorica
ref|WP_039128745.1|  glycine dehydrogenase                              266   1e-78    Flavihumibacter sp. ZG627
ref|XP_003055654.1|  glycine cleavage system p-protein                  266   2e-78    Micromonas pusilla CCMP1545
gb|AAM93931.1|  glycine decarboxylase p protein                         246   4e-78    Griffithsia japonica
ref|WP_017712703.1|  glycine dehydrogenase                              264   5e-78    Prochlorothrix hollandica
gb|KIY91355.1|  glycine dehydrogenase                                   244   1e-77    Monoraphidium neglectum
ref|WP_033110978.1|  hypothetical protein                               243   3e-77    
ref|XP_010304606.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    243   4e-77    Balearica regulorum gibbericeps
ref|WP_009094772.1|  glycine dehydrogenase                              261   5e-77    Rhodopirellula sp. SWK7
gb|EFA86802.1|  glycine dehydrogenase                                   261   5e-77    Heterostelium album PN500
ref|WP_016874717.1|  glycine dehydrogenase                              261   5e-77    Chlorogloeopsis fritschii
ref|WP_039142781.1|  glycine dehydrogenase                              261   6e-77    Flavihumibacter solisilvae
ref|WP_018342886.1|  glycine dehydrogenase                              261   6e-77    Cytophaga aurantiaca
ref|WP_022606719.1|  glycine dehydrogenase (decarboxylating)            261   8e-77    Rubidibacter lacunae
ref|WP_044197707.1|  glycine dehydrogenase                              260   1e-76    
emb|CCI29698.1|  Glycine cleavage system P-protein (glycine dehyd...    248   1e-76    Microcystis aeruginosa PCC 9809
ref|WP_041036217.1|  glycine dehydrogenase                              260   1e-76    Tolypothrix campylonemoides
ref|WP_008684764.1|  glycine dehydrogenase                              260   1e-76    Rhodopirellula sallentina
gb|AFY83915.1|  glycine dehydrogenase, decarboxylating                  260   1e-76    Oscillatoria acuminata PCC 6304
ref|XP_007112412.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    244   2e-76    
ref|WP_044035200.1|  glycine dehydrogenase                              248   2e-76    
dbj|BAB26854.1|  unnamed protein product                                241   2e-76    Mus musculus [mouse]
ref|WP_028981454.1|  glycine dehydrogenase                              259   2e-76    Sporocytophaga myxococcoides
ref|WP_011140250.1|  glycine dehydrogenase                              259   3e-76    Gloeobacter violaceus
ref|WP_044171749.1|  glycine dehydrogenase                              259   3e-76    
ref|WP_006631620.1|  glycine dehydrogenase                              259   3e-76    Microcoleus vaginatus
ref|WP_023065539.1|  glycine dehydrogenase                              259   3e-76    Lyngbya aestuarii
ref|WP_035999593.1|  glycine dehydrogenase                              259   4e-76    [Leptolyngbya] sp. JSC-1
ref|WP_012789622.1|  glycine dehydrogenase                              258   5e-76    Chitinophaga pinensis
ref|WP_015175278.1|  Glycine dehydrogenase (decarboxylating)            259   5e-76    Oscillatoria nigro-viridis
ref|WP_017320159.1|  glycine dehydrogenase                              258   7e-76    cyanobacterium PCC 7702
ref|XP_010129815.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    247   7e-76    Buceros rhinoceros silvestris
ref|XP_010074869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   7e-76    Pterocles gutturalis
ref|WP_039200768.1|  glycine dehydrogenase                              258   7e-76    Aphanizomenon flos-aquae
ref|WP_027401604.1|  glycine dehydrogenase                              258   7e-76    Aphanizomenon flos-aquae
gb|KIJ83529.1|  glycine dehydrogenase                                   258   9e-76    Scytonema tolypothrichoides VB-61278
ref|WP_015209784.1|  glycine dehydrogenase, decarboxylating             258   9e-76    Cylindrospermum stagnale
ref|WP_026752074.1|  glycine dehydrogenase                              258   1e-75    Sediminibacterium sp. C3
ref|XP_009490955.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   1e-75    Pelecanus crispus
dbj|GAL84002.1|  glycine dehydrogenase                                  258   1e-75    Sporocytophaga myxococcoides
ref|WP_016546738.1|  glycine dehydrogenase                              257   1e-75    Leptospira wolffii
ref|WP_016866657.1|  glycine dehydrogenase                              258   1e-75    Fischerella muscicola
ref|WP_016870901.1|  glycine dehydrogenase                              257   1e-75    Fischerella thermalis
ref|WP_009457628.1|  glycine dehydrogenase                              257   1e-75    Fischerella thermalis
ref|WP_027846740.1|  glycine dehydrogenase                              257   1e-75    Mastigocoleus testarum
ref|WP_015130859.1|  glycine dehydrogenase                              257   2e-75    Calothrix sp. PCC 7507
ref|WP_020769690.1|  glycine dehydrogenase                              257   2e-75    Leptospira sp. B5-022
gb|AFZ32122.1|  Glycine dehydrogenase (decarboxylating)                 257   2e-75    Gloeocapsa sp. PCC 7428
ref|XP_002503477.1|  glycine cleavage system p-protein                  257   2e-75    Micromonas commoda
ref|WP_017319421.1|  glycine dehydrogenase                              257   2e-75    
ref|WP_041919296.1|  glycine dehydrogenase                              257   2e-75    
ref|WP_021263190.1|  hypothetical protein                               239   3e-75    
ref|WP_016550019.1|  glycine dehydrogenase                              256   3e-75    Leptospira fainei
ref|WP_026795376.1|  MULTISPECIES: glycine dehydrogenase                256   3e-75    Planktothrix
ref|XP_009955956.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    244   3e-75    Leptosomus discolor
ref|WP_027255179.1|  glycine dehydrogenase                              256   3e-75    Planktothrix agardhii
ref|WP_015163334.1|  glycine dehydrogenase                              257   3e-75    Pseudanabaena sp. PCC 7367
gb|AFZ12851.1|  Glycine dehydrogenase (decarboxylating)                 256   3e-75    Crinalium epipsammum PCC 9333
ref|WP_026796741.1|  glycine dehydrogenase                              256   4e-75    Planktothrix rubescens
ref|WP_043938103.1|  glycine dehydrogenase                              256   4e-75    
ref|WP_041226533.1|  glycine dehydrogenase                              256   4e-75    
ref|WP_042157536.1|  glycine dehydrogenase                              256   4e-75    
gb|AID49398.1|  mitochondrial glycine dehydrogenase                     235   4e-75    Panax ginseng [Asiatic ginseng]
ref|WP_043507924.1|  glycine dehydrogenase                              239   5e-75    
ref|WP_026721410.1|  glycine dehydrogenase                              256   5e-75    Fischerella sp. PCC 9431
ref|WP_026103942.1|  glycine dehydrogenase                              256   5e-75    Anabaena sp. PCC 7108
gb|AID49400.1|  mitochondrial glycine dehydrogenase                     235   5e-75    Panax ginseng [Asiatic ginseng]
ref|WP_015081132.1|  glycine dehydrogenase                              256   6e-75    Anabaena sp. 90
gb|KFF35033.1|  hypothetical protein G039_0311865                       238   6e-75    Pseudomonas aeruginosa VRFPA01
dbj|GAM17937.1|  hypothetical protein SAMD00019534_011120               256   6e-75    Acytostelium subglobosum LB1
ref|WP_012627655.1|  glycine dehydrogenase                              256   6e-75    Cyanothece sp. PCC 7425
ref|WP_006972317.1|  glycine dehydrogenase                              255   7e-75    Plesiocystis pacifica
ref|WP_019497275.1|  glycine dehydrogenase                              255   7e-75    Calothrix sp. PCC 7103
ref|WP_008590214.1|  glycine dehydrogenase                              255   7e-75    Leptospira licerasiae
ref|WP_017309685.1|  glycine dehydrogenase                              255   8e-75    Fischerella sp. PCC 9339
ref|WP_002155590.1|  glycine dehydrogenase-like protein                 247   8e-75    
ref|WP_010415806.1|  glycine dehydrogenase                              255   8e-75    Leptospira inadai
ref|WP_019487125.1|  glycine dehydrogenase                              255   8e-75    Kamptonema formosum
ref|WP_020531529.1|  glycine dehydrogenase                              255   8e-75    Flexithrix dorotheae
ref|WP_042991755.1|  hypothetical protein                               238   9e-75    
ref|WP_024124666.1|  glycine dehydrogenase [decarboxylating] GcvP       255   9e-75    Thermosynechococcus sp. NK55a
ref|WP_031770429.1|  glycine dehydrogenase                              239   1e-74    
ref|WP_033886039.1|  glycine dehydrogenase                              239   1e-74    
ref|WP_021833182.1|  Glycine dehydrogenase [decarboxylating] (gly...    237   1e-74    
ref|WP_011584413.1|  glycine dehydrogenase                              255   1e-74    Cytophaga hutchinsonii
ref|XP_009699383.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   1e-74    Cariama cristata
gb|KGB84088.1|  glycine dehydrogenase                                   238   1e-74    Pseudomonas aeruginosa
ref|WP_026763335.1|  glycine dehydrogenase                              254   1e-74    Sediminibacterium salmoneum
ref|WP_011057442.1|  glycine dehydrogenase                              254   1e-74    Thermosynechococcus elongatus
ref|WP_015182831.1|  glycine dehydrogenase, decarboxylating             255   1e-74    Microcoleus sp. PCC 7113
ref|WP_041430269.1|  glycine dehydrogenase                              254   1e-74    
ref|WP_015198875.1|  glycine dehydrogenase                              254   2e-74    Calothrix parietina
ref|WP_015171139.1|  glycine dehydrogenase subunit alpha/beta           254   2e-74    Geitlerinema sp. PCC 7407
ref|WP_012410110.1|  glycine dehydrogenase                              254   2e-74    Nostoc punctiforme
gb|AFY75171.1|  glycine dehydrogenase, decarboxylating                  254   2e-74    Synechococcus sp. PCC 7502
ref|WP_015212883.1|  Glycine dehydrogenase (decarboxylating)            254   2e-74    Anabaena cylindrica
ref|WP_033335677.1|  glycine dehydrogenase                              254   2e-74    
ref|WP_039895601.1|  glycine dehydrogenase                              254   2e-74    
ref|WP_032826728.1|  glycine dehydrogenase                              238   2e-74    
gb|EAW38056.1|  glycine dehydrogenase                                   254   2e-74    Lyngbya sp. PCC 8106
gb|KIE11464.1|  glycine dehydrogenase                                   254   3e-74    Tolypothrix bouteillei VB521301
ref|WP_011319516.1|  glycine dehydrogenase                              254   3e-74    Trichormus variabilis
ref|WP_039743276.1|  glycine dehydrogenase                              254   3e-74    
ref|WP_027250002.1|  glycine dehydrogenase                              254   3e-74    
ref|WP_013193021.1|  glycine dehydrogenase                              254   3e-74    Trichormus azollae
ref|WP_009149788.1|  glycine dehydrogenase                              253   4e-74    Moorea producens
ref|WP_028088591.1|  glycine dehydrogenase                              253   4e-74    Dolichospermum circinale
ref|WP_010571257.1|  glycine dehydrogenase                              253   5e-74    Leptospira broomii
ref|WP_022960455.1|  glycine dehydrogenase                              253   5e-74    Spongiibacter tropicus
ref|WP_015119530.1|  glycine dehydrogenase, decarboxylating             253   5e-74    Rivularia sp. PCC 7116
ref|WP_026736448.1|  glycine dehydrogenase                              253   6e-74    Fischerella sp. PCC 9605
ref|WP_019017579.1|  glycine dehydrogenase                              253   7e-74    Halomonas lutea
ref|XP_007510359.1|  glycine dehydrogenase                              253   7e-74    Bathycoccus prasinos
ref|WP_016861897.1|  glycine dehydrogenase                              252   1e-73    Fischerella muscicola
ref|WP_029637128.1|  glycine dehydrogenase [                            252   1e-73    
ref|XP_008944450.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    243   1e-73    Merops nubicus
ref|WP_015349077.1|  glycine dehydrogenase                              252   1e-73    Myxococcus stipitatus
ref|XP_009575710.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   1e-73    Fulmarus glacialis
ref|WP_002627258.1|  Glycine dehydrogenase [decarboxylating] (gly...    252   1e-73    Cystobacter fuscus
ref|XP_001420206.1|  predicted protein                                  252   2e-73    Ostreococcus lucimarinus CCE9901
ref|WP_015115551.1|  glycine dehydrogenase (decarboxylating) beta...    252   2e-73    Nostoc sp. PCC 7107
ref|WP_043391215.1|  glycine dehydrogenase                              251   2e-73    Archangium violaceum
ref|WP_044874555.1|  hypothetical protein                               235   2e-73    
ref|XP_637330.1|  glycine dehydrogenase                                 251   3e-73    Dictyostelium discoideum AX4
ref|XP_008334138.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   3e-73    
ref|WP_035563762.1|  glycine dehydrogenase                              251   3e-73    Hymenobacter sp. IS2118
ref|XP_010723944.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    249   3e-73    
gb|KIG16915.1|  Glycine dehydrogenase                                   251   3e-73    Enhygromyxa salina
ref|XP_004359501.1|  glycine dehydrogenase                              251   3e-73    Cavenderia fasciculata
ref|WP_017289075.1|  glycine dehydrogenase                              251   4e-73    Leptolyngbya boryana
ref|XP_010204576.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   4e-73    Colius striatus
gb|EOQ89615.1|  glycine dehydrogenase                                   250   4e-73    Leptospira yanagawae serovar Saopaulo str. Sao Paulo = ATCC 700523
gb|AID49408.1|  mitochondrial glycine dehydrogenase                     230   5e-73    Panax ginseng [Asiatic ginseng]
ref|WP_008055246.1|  hypothetical protein                               233   5e-73    
ref|WP_039928551.1|  glycine dehydrogenase                              250   5e-73    
ref|WP_039713483.1|  glycine dehydrogenase                              250   5e-73    
ref|WP_027284971.1|  glycine dehydrogenase                              250   5e-73    Rubritepida flocculans
ref|WP_028083847.1|  glycine dehydrogenase                              250   6e-73    Dolichospermum circinale
gb|AID49409.1|  mitochondrial glycine dehydrogenase                     230   6e-73    Panax ginseng [Asiatic ginseng]
gb|AFY60495.1|  glycine dehydrogenase, decarboxylating                  250   6e-73    Synechococcus sp. PCC 6312
ref|WP_010572852.1|  glycine dehydrogenase                              250   6e-73    Leptospira kmetyi
ref|WP_027001579.1|  glycine dehydrogenase                              250   6e-73    Hugenholtzia roseola
ref|WP_041431238.1|  glycine dehydrogenase                              250   6e-73    
ref|WP_015145532.1|  glycine dehydrogenase, decarboxylating             250   6e-73    Pleurocapsa minor
ref|WP_044206069.1|  glycine dehydrogenase                              250   6e-73    Coleofasciculus chthonoplastes
emb|CCH65953.1|  Glycine dehydrogenase [decarboxylating] (glycine...    249   7e-73    Richelia intracellularis HM01
ref|WP_044260453.1|  glycine dehydrogenase                              250   7e-73    
gb|EDX77003.1|  glycine dehydrogenase                                   250   7e-73    
ref|WP_043225771.1|  glycine dehydrogenase                              232   7e-73    
ref|XP_007902171.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    249   8e-73    
ref|XP_001507722.2|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   8e-73    
emb|CCH66233.1|  Glycine dehydrogenase [decarboxylating] (glycine...    250   8e-73    
ref|WP_044304265.1|  glycine dehydrogenase                              250   8e-73    
ref|WP_010323338.1|  glycine dehydrogenase                              250   8e-73    
ref|WP_011614237.1|  glycine dehydrogenase                              249   9e-73    
ref|WP_015227846.1|  glycine dehydrogenase, decarboxylating             249   1e-72    
ref|WP_015225454.1|  glycine dehydrogenase (decarboxylating) beta...    249   1e-72    
ref|XP_005702688.1|  glycine dehydrogenase                              247   1e-72    
ref|WP_003001920.1|  glycine dehydrogenase                              249   1e-72    
ref|XP_007440133.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   1e-72    
ref|WP_033044682.1|  glycine dehydrogenase                              232   1e-72    
ref|WP_043999766.1|  glycine dehydrogenase                              249   1e-72    
ref|WP_019596339.1|  glycine dehydrogenase                              249   1e-72    
emb|CCI15528.1|  Glycine cleavage system P-protein (glycine dehyd...    249   1e-72    
ref|WP_024546130.1|  glycine dehydrogenase                              249   2e-72    
ref|WP_004439320.1|  glycine dehydrogenase                              249   2e-72    
ref|XP_011175829.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    249   2e-72    
gb|EFZ21248.1|  hypothetical protein SINV_03018                         248   2e-72    
ref|WP_010628682.1|  glycine dehydrogenase                              248   2e-72    
ref|WP_004501078.1|  glycine dehydrogenase                              248   2e-72    
ref|WP_004499426.1|  glycine dehydrogenase                              248   2e-72    
ref|XP_009934335.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   2e-72    
ref|WP_013939616.1|  glycine dehydrogenase                              248   2e-72    
ref|WP_001089334.1|  glycine dehydrogenase                              248   2e-72    
ref|WP_004497226.1|  glycine dehydrogenase                              248   2e-72    
ref|XP_006018433.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    248   2e-72    
ref|WP_020782916.1|  glycine dehydrogenase                              248   2e-72    
ref|XP_009816061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   2e-72    
ref|XP_005015417.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    248   2e-72    
ref|WP_002616019.1|  glycine dehydrogenase                              248   2e-72    
ref|WP_015813524.1|  glycine dehydrogenase                              248   2e-72    
ref|XP_009869926.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   2e-72    
ref|WP_015220113.1|  glycine dehydrogenase (decarboxylating) beta...    248   3e-72    
ref|XP_006268968.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    248   3e-72    
ref|WP_014397794.1|  glycine dehydrogenase                              248   3e-72    
ref|WP_004503349.1|  glycine dehydrogenase                              248   3e-72    
ref|WP_016415071.1|  glycine dehydrogenase                              248   3e-72    
sp|Q8YNF9.1|GCSP_NOSS1  RecName: Full=Glycine dehydrogenase (deca...    248   3e-72    
dbj|BAK62095.1|  glycine dehydrogenase [decarboxylating], mitocho...    238   3e-72    
ref|XP_009502061.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   3e-72    
ref|XP_009869925.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   3e-72    
ref|WP_036795682.1|  glycine dehydrogenase                              248   3e-72    
emb|CDQ32736.1|  Glycine dehydrogenase [decarboxylating]                248   3e-72    
ref|WP_044523300.1|  glycine dehydrogenase                              248   3e-72    
ref|XP_009924265.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   3e-72    
gb|KFP90011.1|  hypothetical protein N311_05525                         248   3e-72    
ref|XP_003390802.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   3e-72    
gb|EVT85785.1|  glycine dehydrogenase                                   239   3e-72    
dbj|GAL03187.1|  glycine dehydrogenase                                  230   3e-72    
ref|WP_036401293.1|  glycine dehydrogenase                              248   4e-72    
gb|ELS47332.1|  glycine dehydrogenase                                   248   4e-72    
emb|CCI02130.1|  Glycine cleavage system P-protein (glycine dehyd...    248   4e-72    
ref|WP_020402760.1|  glycine dehydrogenase                              248   4e-72    
ref|XP_005425638.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   4e-72    
ref|WP_043996308.1|  glycine dehydrogenase                              248   4e-72    
ref|XP_005425639.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   4e-72    
ref|WP_029313377.1|  glycine dehydrogenase                              248   4e-72    
ref|WP_007003188.1|  glycine dehydrogenase                              248   4e-72    
ref|WP_002179931.1|  glycine dehydrogenase                              248   4e-72    
ref|WP_028022040.1|  glycine dehydrogenase                              248   4e-72    
ref|WP_017213857.1|  glycine dehydrogenase                              248   4e-72    
ref|XP_006117910.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   5e-72    
ref|WP_041770080.1|  glycine dehydrogenase                              248   5e-72    
ref|WP_038029267.1|  glycine dehydrogenase                              248   5e-72    
ref|XP_003510272.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    243   5e-72    
gb|ABZ95547.1|  Glycine dehydrogenase (decarboxylating), protein P      248   5e-72    
ref|XP_010391188.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    247   5e-72    
ref|XP_009901190.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    247   6e-72    
ref|WP_026638871.1|  glycine dehydrogenase                              247   6e-72    
ref|XP_011068230.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    248   6e-72    
ref|XP_008539869.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    241   6e-72    
ref|XP_005352188.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    248   6e-72    
ref|WP_030008151.1|  glycine dehydrogenase                              247   6e-72    
gb|EGI69417.1|  Glycine dehydrogenase [decarboxylating], mitochon...    247   6e-72    
ref|XP_010286979.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   6e-72    
ref|WP_004161677.1|  glycine dehydrogenase                              247   6e-72    
ref|WP_008545393.1|  glycine dehydrogenase                              247   6e-72    
ref|WP_011553098.1|  glycine dehydrogenase                              247   6e-72    
ref|XP_005060945.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   6e-72    
ref|XP_009636514.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   6e-72    
ref|XP_009998946.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   6e-72    
ref|WP_017008390.1|  glycine dehydrogenase                              247   6e-72    
gb|AAD56281.1|AF137264_1  glycine decarboxylase p protein               247   7e-72    
ref|XP_009326324.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   7e-72    
ref|XP_010286980.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   7e-72    
ref|WP_006980349.1|  glycine dehydrogenase                              247   7e-72    
ref|WP_031772836.1|  glycine dehydrogenase                              241   8e-72    
ref|WP_014217230.1|  glycine dehydrogenase                              247   8e-72    
ref|XP_009272544.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   8e-72    
ref|WP_002538646.1|  Glycine dehydrogenase                              247   8e-72    
ref|XP_009888966.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   8e-72    
ref|XP_008539867.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   9e-72    
ref|WP_004419733.1|  glycine dehydrogenase                              247   9e-72    
ref|WP_036859587.1|  glycine dehydrogenase                              246   9e-72    
ref|WP_017652835.1|  glycine dehydrogenase                              247   9e-72    
ref|XP_009097243.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   9e-72    
ref|XP_011251794.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    247   9e-72    
ref|WP_004451582.1|  glycine dehydrogenase                              247   9e-72    
gb|EFN74714.1|  Glycine dehydrogenase [decarboxylating], mitochon...    247   9e-72    
ref|XP_010118639.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   9e-72    
ref|WP_004447455.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_008539868.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    242   1e-71    
ref|WP_002988516.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_003762187.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    247   1e-71    
ref|XP_005443683.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   1e-71    
ref|WP_019941473.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_004452658.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_009473192.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|XP_009097244.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|XP_010584356.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|XP_007062689.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|XP_005443682.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   1e-71    
ref|WP_035151567.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_009187084.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_005716298.1|  glycine dehydrogenase (decarboxylating), mit...    247   1e-71    
ref|WP_024285047.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_010157866.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|WP_029456180.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_028260881.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_005241664.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   1e-71    
ref|WP_006226197.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_023854948.1|  glycine dehydrogenase, decarboxylating             246   1e-71    
ref|XP_006609844.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    245   1e-71    
ref|WP_039900125.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_025621559.1|  hypothetical protein                               230   1e-71    
ref|WP_038446405.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_008630804.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|WP_029811212.1|  glycine dehydrogenase                              231   1e-71    
ref|WP_031528933.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_026945428.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_008494472.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   1e-71    
ref|WP_017015362.1|  glycine dehydrogenase                              246   1e-71    
ref|XP_009077461.1|  PREDICTED: LOW QUALITY PROTEIN: glycine dehy...    245   1e-71    
ref|WP_006385868.1|  glycine dehydrogenase                              246   1e-71    
ref|WP_012266651.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_009965224.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   2e-71    
ref|XP_005241663.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    245   2e-71    
ref|WP_043997862.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_025553731.1|  hypothetical protein                               230   2e-71    
ref|WP_026987739.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_008919878.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   2e-71    
ref|WP_020775241.1|  glycine dehydrogenase                              246   2e-71    
emb|CCI35850.1|  Glycine cleavage system P-protein (glycine dehyd...    246   2e-71    
emb|CCI32913.1|  Glycine cleavage system P-protein (glycine dehyd...    246   2e-71    
ref|WP_020926286.1|  Glycine dehydrogenase [decarboxylating] (gly...    246   2e-71    
gb|AHI04993.1|  glycine dehydrogenase                                   246   2e-71    
ref|WP_026850038.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_000663146.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_009569917.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   2e-71    
ref|WP_001089341.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_005499825.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_002777354.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_043998344.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_003701250.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_007659102.1|  glycine dehydrogenase                              244   2e-71    
emb|CCH95022.1|  Glycine cleavage system P-protein (glycine dehyd...    246   2e-71    
ref|WP_002121772.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_005488208.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_006221736.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_002106132.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_002194693.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_036093294.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_005522738.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
gb|EMF81634.1|  glycine dehydrogenase                                   246   2e-71    
ref|WP_001089346.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089345.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089356.1|  glycine dehydrogenase                              246   2e-71    
gb|AJR12912.1|  glycine dehydrogenase                                   246   2e-71    
ref|WP_001089352.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_017853790.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089357.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089355.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089350.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_002101413.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089340.1|  glycine dehydrogenase                              246   2e-71    
ref|XP_003401892.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_001089339.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089351.1|  glycine dehydrogenase                              246   2e-71    
ref|NP_989653.1|  glycine dehydrogenase (decarboxylating), mitoch...    246   2e-71    
ref|XP_005522737.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_001089338.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_038015182.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_006527089.1|  glycine dehydrogenase, decarboxylating             246   2e-71    
gb|KEF58987.1|  glycine dehydrogenase                                   246   2e-71    
ref|XP_005488209.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    246   2e-71    
ref|WP_001089349.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089359.1|  glycine dehydrogenase                              246   2e-71    
ref|WP_001089335.1|  glycine dehydrogenase                              245   2e-71    
ref|WP_001089354.1|  glycine dehydrogenase                              245   2e-71    
ref|WP_001089336.1|  glycine dehydrogenase                              245   2e-71    
ref|WP_001089347.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_001089342.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_033563801.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_017852063.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_020776421.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_001089343.1|  glycine dehydrogenase                              245   3e-71    
gb|EPR71506.1|  Glycine dehydrogenase [decarboxylating] (glycine ...    245   3e-71    
ref|WP_043836637.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_004784745.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_022729384.1|  glycine dehydrogenase                              245   3e-71    
ref|XP_008167542.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    246   3e-71    
ref|WP_008198699.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_040243438.1|  glycine dehydrogenase                              245   3e-71    
emb|CEF99477.1|  Pyridoxal phosphate-dependent transferase, major...    245   3e-71    
gb|KFC49342.1|  hypothetical protein GY12_08995                         228   3e-71    
gb|ACA99540.1|  glycine dehydrogenase                                   245   3e-71    
ref|XP_006627116.1|  PREDICTED: glycine dehydrogenase [decarboxyl...    245   3e-71    
ref|WP_040939416.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_008624248.1|  Glycine dehydrogenase                              245   3e-71    
ref|WP_041443860.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_044106198.1|  glycine dehydrogenase                              245   3e-71    
ref|XP_011308791.1|  PREDICTED: glycine dehydrogenase (decarboxyl...    245   3e-71    
dbj|GAL92044.1|  glycine dehydrogenase [decarboxylating] (glycine...    245   3e-71    
ref|WP_044171929.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_040944225.1|  glycine dehydrogenase                              245   3e-71    
ref|WP_009579218.1|  Glycine dehydrogenase                              245   3e-71    
ref|WP_019989155.1|  glycine dehydrogenase                              245   4e-71    



>gb|KHG00684.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1047

 Score =   363 bits (932),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IE GK DI+NNV K A
Sbjct  920   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIENGKADIHNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPVSQMV
Sbjct  980   PHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVSQMV  1039

Query  191   ED  186
             E+
Sbjct  1040  EE  1041



>gb|KJB65560.1| hypothetical protein B456_010G101200 [Gossypium raimondii]
Length=1047

 Score =   363 bits (932),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IE GK DI+NNV K A
Sbjct  920   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIENGKADIHNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPVSQMV
Sbjct  980   PHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVSQMV  1039

Query  191   ED  186
             E+
Sbjct  1040  EE  1041



>ref|XP_011081684.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1037

 Score =   361 bits (926),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 169/179 (94%), Positives = 171/179 (96%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  850   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  909

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA IEKGK DI+NNV K A
Sbjct  910   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIALIEKGKADIHNNVLKGA  969

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPSLLMAD WTKPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  970   PHPPSLLMADVWTKPYSREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  1028



>gb|KJB54687.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1050

 Score =   361 bits (926),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  863   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  922

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNV K A
Sbjct  923   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGA  982

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLPVSQMV
Sbjct  983   PHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  1042

Query  191   EDE  183
             E+E
Sbjct  1043  EEE  1045



>ref|XP_007012280.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
 gb|EOY29899.1| Glycine decarboxylase P-protein 1 [Theobroma cacao]
Length=1050

 Score =   360 bits (924),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFI+DLR FKNTAGIE EDVAKRLMDY
Sbjct  863   ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVAKRLMDY  922

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNV K A
Sbjct  923   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGA  982

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRN+ICTLLPV+QMV
Sbjct  983   PHPPSLLMGDAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNVICTLLPVTQMV  1042

Query  191   EDE  183
             E+E
Sbjct  1043  EEE  1045



>gb|KHG06307.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Gossypium 
arboreum]
Length=1028

 Score =   359 bits (922),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  841   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  900

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNV K A
Sbjct  901   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGA  960

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLPVSQMV
Sbjct  961   PHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  1020

Query  191   EDE  183
             E+E
Sbjct  1021  EEE  1023



>ref|XP_010262151.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nelumbo nucifera]
Length=1043

 Score =   359 bits (921),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  856   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  915

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA IE GK DINNNV K A
Sbjct  916   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIALIENGKADINNNVLKGA  975

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLP SQ+V
Sbjct  976   PHPPSLLMADAWTKPYSREYAAFPASWLRTAKFWPTTGRVDNVYGDRNLICTLLPASQVV  1035

Query  191   EDE  183
             E++
Sbjct  1036  EEQ  1038



>ref|XP_009620998.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana tomentosiformis]
Length=1043

 Score =   358 bits (920),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DY
Sbjct  856   ASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDY  915

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNV K A
Sbjct  916   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADINNNVLKGA  975

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMADAW KPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLLPVSQMV
Sbjct  976   PHPPSMLMADAWVKPYSREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLLPVSQMV  1035

Query  191   EDE  183
             E+E
Sbjct  1036  EEE  1038



>dbj|BAD81531.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82266.1| P protein-like [Oryza sativa Japonica Group]
Length=197

 Score =   333 bits (853),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  10   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  69

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  70   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  129

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  130  PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  188



>ref|XP_011097886.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Sesamum indicum]
Length=1071

 Score =   358 bits (919),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDR+CD LISIREEIA IEKGK DI+NNV K+A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRYCDALISIREEIAMIEKGKADIHNNVLKSA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W+KPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM 
Sbjct  972   PHPPSLLMADVWSKPYSREYAAYPAPWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMA  1031

Query  191   E  189
             E
Sbjct  1032  E  1032



>ref|XP_003544533.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1059

 Score =   357 bits (916),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  872   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  931

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNV K A
Sbjct  932   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKVDINNNVLKGA  991

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+TAKFWPTTGRVDNVYGDRNLICTLLP SQ V
Sbjct  992   PHPPSLLMADAWTKPYSREYAAFPAPWLRTAKFWPTTGRVDNVYGDRNLICTLLPASQAV  1051

Query  191   EDE  183
             E++
Sbjct  1052  EEQ  1054



>ref|XP_009797115.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Nicotiana sylvestris]
Length=1046

 Score =   357 bits (915),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 166/183 (91%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFK+TAGIE EDVAKRL+DY
Sbjct  859   ASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKSTAGIEPEDVAKRLIDY  918

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNV K A
Sbjct  919   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADINNNVLKGA  978

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMADAW KPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTLLPVSQMV
Sbjct  979   PHPPSMLMADAWVKPYSREYAAFPAPWLRNAKFWPTTARVDNVYGDRNLICTLLPVSQMV  1038

Query  191   EDE  183
             E+E
Sbjct  1039  EEE  1041



>sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Solanum 
tuberosum]
 emb|CAB16918.1| P-Protein precursor [Solanum tuberosum]
Length=1035

 Score =   357 bits (915),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAIL+ANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DY
Sbjct  849   ASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDY  908

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNV K A
Sbjct  909   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGA  968

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M 
Sbjct  969   PHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMA  1028

Query  191   EDE  183
             E++
Sbjct  1029  EEK  1031



>ref|XP_004245101.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Solanum lycopersicum]
Length=1036

 Score =   356 bits (914),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAIL+ANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DY
Sbjct  850   ASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDY  909

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNV K A
Sbjct  910   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGA  969

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M 
Sbjct  970   PHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMA  1029

Query  191   EDE  183
             E++
Sbjct  1030  EEK  1032



>emb|CBI20667.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   348 bits (893),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDY
Sbjct  509  ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDY  568

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNV K A
Sbjct  569  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGA  628

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ+ 
Sbjct  629  PHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQIE  688

Query  191  ED  186
            E 
Sbjct  689  EQ  690



>gb|AEP95746.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=264

 Score =   333 bits (855),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 164/174 (94%), Gaps = 0/174 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  91   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  150

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+NNV K A
Sbjct  151  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHNNVLKGA  210

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
            PHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLL
Sbjct  211  PHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTLL  264



>ref|XP_006361002.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Solanum tuberosum]
Length=1092

 Score =   356 bits (913),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/183 (90%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAIL+ANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DY
Sbjct  849   ASKIAILSANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDY  908

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  DINNNV K A
Sbjct  909   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNVDINNNVLKGA  968

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMADAWTKPYSREYAA+PA WL++AKFWPTTGRVDNVYGDRNLICTLLPVS+M 
Sbjct  969   PHPPSMLMADAWTKPYSREYAAYPAPWLRSAKFWPTTGRVDNVYGDRNLICTLLPVSEMA  1028

Query  191   EDE  183
             E++
Sbjct  1029  EEK  1031



>gb|AEP95751.1| glycine decarboxylase complex subunit P [Cicer arietinum]
Length=274

 Score =   332 bits (852),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 163/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  102  ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  161

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+NNV K A
Sbjct  162  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHNNVLKGA  221

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  213
            PHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL
Sbjct  222  PHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTL  274



>dbj|BAD81530.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82265.1| P protein-like [Oryza sativa Japonica Group]
Length=294

 Score =   332 bits (851),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  107  ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  166

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  167  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  226

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  227  PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  285



>ref|XP_010047334.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Eucalyptus grandis]
 gb|KCW79221.1| hypothetical protein EUGRSUZ_C00646 [Eucalyptus grandis]
Length=1053

 Score =   352 bits (904),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 173/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLR FKNTAGIE EDVAKRLMDY
Sbjct  866   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRAFKNTAGIEPEDVAKRLMDY  925

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGK DI+NNV K+A
Sbjct  926   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKADIHNNVLKSA  985

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D+WTKPYSREYAAFPA WL+TAKFWP+TGR+DNVYGDRNL+CTL P SQ+V
Sbjct  986   PHPPSLLMGDSWTKPYSREYAAFPASWLRTAKFWPSTGRIDNVYGDRNLVCTLQPTSQVV  1045

Query  191   EDE  183
             E++
Sbjct  1046  EEQ  1048



>emb|CDP08258.1| unnamed protein product [Coffea canephora]
Length=1031

 Score =   352 bits (903),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 174/183 (95%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFK+TAGIE EDVAKRLMDY
Sbjct  844   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKHTAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLM+EPTESESKAELDRFCD LISIREEIAQIEKGKFD++NNV K+A
Sbjct  904   GFHGPTMSWPVPGTLMVEPTESESKAELDRFCDALISIREEIAQIEKGKFDLHNNVLKSA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMA+ WTKPYSREYAAFPA WL+TAKFWPTT RVDNVYGDRNL+CTLLP +Q+V
Sbjct  964   PHPPSLLMANVWTKPYSREYAAFPAPWLRTAKFWPTTERVDNVYGDRNLVCTLLPAAQVV  1023

Query  191   EDE  183
             E+E
Sbjct  1024  EEE  1026



>ref|XP_004159575.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Cucumis sativus]
Length=880

 Score =   349 bits (895),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  693  ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVAKRLMDY  752

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINNNV K A
Sbjct  753  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINNNVLKGA  812

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGRVDNVYGDRNLICTL P +Q+V
Sbjct  813  PHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPSTGRVDNVYGDRNLICTLQPANQVV  872

Query  191  ED  186
            E+
Sbjct  873  EE  874



>ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
 gb|KHN37032.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1056

 Score =   352 bits (903),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/183 (89%), Positives = 171/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  869   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  928

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNV K+A
Sbjct  929   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKSA  988

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ V
Sbjct  989   PHPPSLLMADAWTKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAV  1048

Query  191   EDE  183
             E++
Sbjct  1049  EEQ  1051



>gb|EYU29323.1| hypothetical protein MIMGU_mgv1a000648mg [Erythranthe guttata]
Length=1032

 Score =   351 bits (900),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV F GVNGT AHEFIIDLRGFK TAGIEAEDVAKRLMDY
Sbjct  845   ASKIAILNANYMAKRLEKHYPVLFWGVNGTCAHEFIIDLRGFKTTAGIEAEDVAKRLMDY  904

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+ IE GK DINNNV K A
Sbjct  905   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISLIENGKADINNNVLKGA  964

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPSLLMADAWTKPYSREYAA+PA WLKTAKFWPTTGRVDNVYGDRNLICTLL VSQM
Sbjct  965   PHPPSLLMADAWTKPYSREYAAYPAAWLKTAKFWPTTGRVDNVYGDRNLICTLLSVSQM  1023



>ref|XP_008444466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Cucumis melo]
Length=1047

 Score =   351 bits (900),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINNNV K A
Sbjct  920   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL P +Q+V
Sbjct  980   PHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPTTGRVDNVYGDRNLICTLQPANQVV  1039

Query  191   ED  186
             E+
Sbjct  1040  EE  1041



>ref|XP_004142925.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Cucumis sativus]
 gb|KGN62389.1| hypothetical protein Csa_2G351700 [Cucumis sativus]
Length=1046

 Score =   350 bits (897),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  859   ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKQTAGIEPEDVAKRLMDY  918

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DINNNV K A
Sbjct  919   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADINNNVLKGA  978

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGRVDNVYGDRNLICTL P +Q+V
Sbjct  979   PHPPSLLMGDAWTKPYSREYAAFPASWLRASKFWPSTGRVDNVYGDRNLICTLQPANQVV  1038

Query  191   ED  186
             E+
Sbjct  1039  EE  1040



>emb|CAN63089.1| hypothetical protein VITISV_032016 [Vitis vinifera]
Length=1036

 Score =   349 bits (896),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDY
Sbjct  850   ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDY  909

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNV K A
Sbjct  910   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGA  969

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ+ 
Sbjct  970   PHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQIE  1029

Query  191   ED  186
             E 
Sbjct  1030  EQ  1031



>gb|EYU20359.1| hypothetical protein MIMGU_mgv1a000655mg [Erythranthe guttata]
Length=1030

 Score =   349 bits (895),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  843   ASKIAILNANYMAKRLEDHYPILFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  902

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLI IREEI+ IEKGK DI+NNV K A
Sbjct  903   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLILIREEISLIEKGKADIHNNVLKGA  962

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPSLLMAD WTKPYSREYAA+PA WL+TAKFWPTTGRVDNVYGDRNL+CTLL VSQM
Sbjct  963   PHPPSLLMADEWTKPYSREYAAYPAAWLRTAKFWPTTGRVDNVYGDRNLVCTLLSVSQM  1021



>ref|XP_010648358.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1053

 Score =   349 bits (895),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRGFKNTAGIE ED+AKRLMDY
Sbjct  867   ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDIAKRLMDY  926

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIAQIE GK D++NNV K A
Sbjct  927   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAQIENGKADVHNNVLKGA  986

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ+ 
Sbjct  987   PHPPSLLMGDTWTKPYSREYAAFPAPWLRVAKFWPTTGRVDNVYGDRNLICTLLPASQIE  1046

Query  191   ED  186
             E 
Sbjct  1047  EQ  1048



>gb|AAL24244.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
Length=694

 Score =   340 bits (873),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAK LEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  509  ASKIAILNANYMAKCLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  568

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  569  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  628

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  629  PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  688



>gb|KDP34101.1| hypothetical protein JCGZ_07672 [Jatropha curcas]
Length=1059

 Score =   349 bits (895),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  872   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  931

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNV K A
Sbjct  932   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKGA  991

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D WTKPY+REYAAFPA WL+T+KFWPTTGRVDNVYGDRNLICTLLP SQ V
Sbjct  992   PHPPSLLMGDTWTKPYTREYAAFPASWLRTSKFWPTTGRVDNVYGDRNLICTLLPASQYV  1051

Query  191   EDE  183
             E++
Sbjct  1052  EEQ  1054



>dbj|BAD81529.1| P protein-like [Oryza sativa Japonica Group]
 dbj|BAD82264.1| P protein-like [Oryza sativa Japonica Group]
Length=493

 Score =   334 bits (857),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  306  ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  365

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  366  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  425

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  426  PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  484



>ref|XP_004498895.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X1 [Cicer arietinum]
 ref|XP_004498896.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
isoform X2 [Cicer arietinum]
Length=1114

 Score =   349 bits (896),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 162/183 (89%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  927   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  986

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  DI+NNV K A
Sbjct  987   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADIHNNVLKGA  1046

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL P SQ V
Sbjct  1047  PHPPSLLMADAWTKPYSREYAAFPAAWLRVAKFWPTTGRVDNVYGDRNLICTLQPASQGV  1106

Query  191   EDE  183
             E++
Sbjct  1107  EEQ  1109



>ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis]
 gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis]
Length=1057

 Score =   348 bits (892),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  870   ASKIAILNANYMAKRLENYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  929

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D++NNV K A
Sbjct  930   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVHNNVLKGA  989

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLP SQ V
Sbjct  990   PHPPSLLMGDAWTKPYSREYAAFPASWLRGAKFWPTTGRVDNVYGDRNLICTLLPASQYV  1049

Query  191   EDE  183
             E++
Sbjct  1050  EEQ  1052



>sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Pisum 
sativum]
 emb|CAA42443.1| P protein [Pisum sativum]
Length=1057

 Score =   347 bits (890),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  870   ASKIAILNANYMAKRLESYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  929

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPV GTLMIEPTESESKAELDRFCD LISIR+EIA++EKG  D++NNV K A
Sbjct  930   GFHGPTMSWPVAGTLMIEPTESESKAELDRFCDALISIRKEIAEVEKGNADVHNNVLKGA  989

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNL+CTLLP SQ V
Sbjct  990   PHPPSLLMADAWTKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLVCTLLPASQAV  1049

Query  191   EDE  183
             E++
Sbjct  1050  EEQ  1052



>ref|XP_008220472.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Prunus mume]
Length=1054

 Score =   347 bits (890),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDY
Sbjct  867   ASKIAILNANYMAKRLEDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVAKRLMDY  926

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK D++NNV K A
Sbjct  927   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADLHNNVLKGA  986

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D WTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL P SQ V
Sbjct  987   PHPPSLLMGDTWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLICTLQPASQAV  1046

Query  191   EDE  183
             E++
Sbjct  1047  EEQ  1049



>ref|XP_003589000.1| Glycine dehydrogenase P protein [Medicago truncatula]
 gb|AES59251.1| glycine dehydrogenase [decarboxylating] protein [Medicago truncatula]
Length=1056

 Score =   347 bits (889),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  869   ASKIAILNANYMAKRLESYYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  928

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D++NNV K A
Sbjct  929   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRKEIAEIEKGNADVHNNVLKGA  988

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWPT GRVDNVYGDRNLICTLLP SQ V
Sbjct  989   PHPPSLLMADAWTKPYSREYAAFPAPWLRVAKFWPTNGRVDNVYGDRNLICTLLPASQAV  1048

Query  191   ED  186
             E+
Sbjct  1049  EE  1050



>gb|KHN29723.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1031

 Score =   346 bits (888),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  844   ASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNV K A
Sbjct  904   GFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKADINNNVLKCA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ+V
Sbjct  964   PHPPSVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQVV  1023

Query  191   EDE  183
             E++
Sbjct  1024  EEQ  1026



>ref|XP_008797766.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   346 bits (888),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ F GVNGTVAHEFI+DLRGFK TAGIE+EDVAKRL+DY
Sbjct  853   ASKIAILNANYMAKRLENHYPILFCGVNGTVAHEFIVDLRGFKATAGIESEDVAKRLIDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K A
Sbjct  913   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLPVSQM 
Sbjct  973   PHPPSLLMGDAWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPVSQMA  1032

Query  191   ED  186
             E+
Sbjct  1033  EE  1034



>ref|XP_003523643.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1031

 Score =   346 bits (888),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  844   ASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKGK DINNNV K A
Sbjct  904   GFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGKADINNNVLKCA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ+V
Sbjct  964   PHPPSVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQVV  1023

Query  191   EDE  183
             E++
Sbjct  1024  EEQ  1026



>ref|XP_007161011.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
 gb|ESW33005.1| hypothetical protein PHAVU_001G035500g [Phaseolus vulgaris]
Length=1062

 Score =   347 bits (889),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  875   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  934

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             G+H PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIR+EIA+IEKGK DINNNV K A
Sbjct  935   GYHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIRQEIAEIEKGKVDINNNVLKGA  994

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLMADAWTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP
Sbjct  995   PHPPSLLMADAWTKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLP  1049



>gb|ABO61734.1| mitochondrial glycine decarboxylase complex P-protein [Populus 
tremuloides]
Length=1060

 Score =   346 bits (888),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 160/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  873   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDY  932

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIA+IEKGK DI+NNV K A
Sbjct  933   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAEIEKGKADIHNNVLKGA  992

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ V
Sbjct  993   PHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQTV  1052

Query  191   EDE  183
             E++
Sbjct  1053  EEQ  1055



>ref|XP_002308562.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
 gb|EEE92085.1| P-protein subunit of glycine decarboxylase enzyme complex [Populus 
trichocarpa]
Length=1060

 Score =   345 bits (885),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  873   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDY  932

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK DI+NNV K A
Sbjct  933   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADIHNNVLKGA  992

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ+V
Sbjct  993   PHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQVV  1052

Query  191   EDE  183
             E++
Sbjct  1053  EEQ  1055



>ref|XP_011019466.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Populus euphratica]
Length=1060

 Score =   345 bits (885),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  873   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGVKNTAGIEPEDVAKRLMDY  932

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK DI+NNV K A
Sbjct  933   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADIHNNVLKGA  992

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ+V
Sbjct  993   PHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQVV  1052

Query  191   EDE  183
             E++
Sbjct  1053  EEQ  1055



>ref|XP_008808050.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Phoenix dactylifera]
Length=1040

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/179 (89%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ F GVNGTVAHEFI+DLRGFK TAGIE EDVAKRLMDY
Sbjct  853   ASKIAILNANYMAKRLEKHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLMDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK DINNNV K A
Sbjct  913   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADINNNVMKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPS+LM D WTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQM
Sbjct  973   PHPPSMLMGDTWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPASQM  1031



>ref|NP_195027.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
 sp|Q94B78.2|GCSP1_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 1, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 1; 
AltName: Full=Glycine decarboxylase 1; AltName: Full=Glycine 
decarboxylase P-protein 1; Short=AtGLDP1; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 1; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA21210.1| P-Protein-like protein [Arabidopsis thaliana]
 emb|CAB80018.1| P-Protein-like protein [Arabidopsis thaliana]
 gb|AAL36259.1| putative P-Protein [Arabidopsis thaliana]
 gb|AAM14125.1| putative P-protein [Arabidopsis thaliana]
 gb|AEE86159.1| glycine dehydrogenase [decarboxylating] 2 [Arabidopsis thaliana]
Length=1037

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  972   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1031



>gb|AAK68740.1| P-Protein - like protein [Arabidopsis thaliana]
 gb|AAM91322.1| P-protein-like protein [Arabidopsis thaliana]
Length=1037

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  972   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1031



>ref|XP_010519851.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Tarenaya hassleriana]
Length=1054

 Score =   345 bits (884),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/183 (87%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYM KRLEKH+PV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  867   ASKIAILNANYMVKRLEKHFPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  926

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  DI+NNV K A
Sbjct  927   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADIHNNVLKGA  986

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D+W+KPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTL P +Q  
Sbjct  987   PHPPSLLMGDSWSKPYSREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLQPAAQNG  1046

Query  191   EDE  183
             E++
Sbjct  1047  EEQ  1049



>ref|XP_002867212.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43471.1| hypothetical protein ARALYDRAFT_491390 [Arabidopsis lyrata subsp. 
lyrata]
Length=1037

 Score =   344 bits (883),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/180 (88%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  972   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1031



>ref|XP_007227061.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
 gb|EMJ28260.1| hypothetical protein PRUPE_ppa000675mg [Prunus persica]
Length=1039

 Score =   344 bits (883),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 169/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEDYYPILFRGVNGTVAHEFIVDLRGFKHTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IEKGK D++NNV K A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIEKGKADLHNNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM D WTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNLICTL P  Q V
Sbjct  972   PHPPSLLMGDTWTKPYSREYAAFPALWLRSAKFWPTTGRVDNVYGDRNLICTLQPAPQAV  1031

Query  191   EDE  183
             E++
Sbjct  1032  EEQ  1034



>ref|XP_008393646.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Malus domestica]
Length=1049

 Score =   344 bits (882),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 2/183 (1%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDY
Sbjct  864   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDY  923

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNV K A
Sbjct  924   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGA  983

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + V
Sbjct  984   PHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAV  1041

Query  191   EDE  183
             E++
Sbjct  1042  EEQ  1044



>ref|XP_009361863.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009361876.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X3 [Pyrus x bretschneideri]
Length=1049

 Score =   344 bits (882),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 2/183 (1%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDY
Sbjct  864   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDY  923

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNV K A
Sbjct  924   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGA  983

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + V
Sbjct  984   PHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAV  1041

Query  191   EDE  183
             E++
Sbjct  1042  EEQ  1044



>ref|XP_009361869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
isoform X2 [Pyrus x bretschneideri]
Length=1049

 Score =   344 bits (882),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 2/183 (1%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFKNTAG+E EDVAKRLMDY
Sbjct  864   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGVEPEDVAKRLMDY  923

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNV K A
Sbjct  924   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGA  983

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + V
Sbjct  984   PHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAV  1041

Query  191   EDE  183
             E++
Sbjct  1042  EEQ  1044



>gb|AFW56072.1| hypothetical protein ZEAMMB73_271256 [Zea mays]
Length=495

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLR FK TAGIE EDVAKRLMDY
Sbjct  306  ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVAKRLMDY  365

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNV K A
Sbjct  366  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVLNNVLKGA  425

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   +Q+
Sbjct  426  PHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQATQV  484



>ref|XP_010049196.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Eucalyptus grandis]
 gb|KCW81692.1| hypothetical protein EUGRSUZ_C03047 [Eucalyptus grandis]
Length=1053

 Score =   343 bits (879),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE ++PV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  866   ASKIAILNANYMAKRLESYFPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  925

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAE+DRFCD +ISIREEIA+IEKGK DI+NNV K A
Sbjct  926   GFHAPTMSWPVPGTLMIEPTESESKAEMDRFCDAMISIREEIAEIEKGKADIHNNVLKGA  985

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSR+YAAFPA WL+T+KFWP+TGRVDNVYGDRNL CTLLP SQ  
Sbjct  986   PHPPSLLMGDAWTKPYSRDYAAFPASWLRTSKFWPSTGRVDNVYGDRNLTCTLLPASQYT  1045

Query  191   ED  186
             E+
Sbjct  1046  EE  1047



>ref|NP_001289247.1| glycine dehydrogenase (decarboxylating), mitochondrial [Pyrus 
x bretschneideri]
 gb|AHM26626.1| glycine dehydrogenase decarboxylating protein [Pyrus x bretschneideri]
Length=1049

 Score =   342 bits (878),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 170/183 (93%), Gaps = 2/183 (1%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFK+TAGIE EDVAKRLMDY
Sbjct  864   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKSTAGIEPEDVAKRLMDY  923

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D++NNV K A
Sbjct  924   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADLHNNVLKGA  983

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLM DAWTKPYSREYAAFPA WL++AKFWPTTGRVDNVYGDRNL+CTL P  + V
Sbjct  984   PHPPSLLMGDAWTKPYSREYAAFPASWLRSAKFWPTTGRVDNVYGDRNLVCTLQP--EAV  1041

Query  191   EDE  183
             E++
Sbjct  1042  EEQ  1044



>gb|KHN32209.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=1023

 Score =   342 bits (876),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  836   ASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  895

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINNNV K A
Sbjct  896   GFHSPTMSFPVPGTLMIEPTESESKSELDRFCDALISIRQEIAEIEKGKADINNNVLKCA  955

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPP +LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ V
Sbjct  956   PHPPPVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQAV  1015

Query  191   EDE  183
             E++
Sbjct  1016  EEQ  1018



>ref|XP_003526001.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Glycine max]
Length=1023

 Score =   342 bits (876),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/183 (85%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  836   ASKTAILNANYMAKRLENHYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  895

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESK+ELDRFCD LISIR+EIA+IEKGK DINNNV K A
Sbjct  896   GFHSPTMSFPVPGTLMIEPTESESKSELDRFCDALISIRQEIAEIEKGKADINNNVLKCA  955

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPP +LM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTLLP SQ V
Sbjct  956   PHPPPVLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLLPTSQAV  1015

Query  191   EDE  183
             E++
Sbjct  1016  EEQ  1018



>ref|XP_004291039.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Fragaria vesca subsp. vesca]
Length=1048

 Score =   342 bits (877),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFKNTAGIEAED+AKRLMDY
Sbjct  863   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKNTAGIEAEDIAKRLMDY  922

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI QIEKGK DI+NNV K A
Sbjct  923   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIGQIEKGKADIHNNVLKGA  982

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLM D W+KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P
Sbjct  983   PHPPSLLMGDTWSKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP  1037



>ref|XP_009392931.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1038

 Score =   341 bits (875),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 165/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFK TAG+EAEDVAKRL+DY
Sbjct  851   ASKIAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKATAGLEAEDVAKRLIDY  910

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DIN NV K A
Sbjct  911   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADININVLKGA  970

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPSL+M D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  971   PHPPSLIMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLLPVSQM  1029



>gb|AAL57651.1| AT4g33010/F26P21_130 [Arabidopsis thaliana]
 gb|AAN64523.1| At4g33010/F26P21_130 [Arabidopsis thaliana]
Length=1037

 Score =   341 bits (875),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVA EFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  852   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAREFIIDLRGFKNTAGIEPEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  912   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  972   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1031



>gb|KFK29912.1| hypothetical protein AALP_AA7G194500 [Arabis alpina]
Length=1042

 Score =   341 bits (875),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAG+E EDVAKRLMDY
Sbjct  857   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGVEPEDVAKRLMDY  916

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  917   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  976

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD+W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  977   PHPPSLLMADSWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPDEEQV  1036



>gb|EMS46370.1| Glycine dehydrogenase [decarboxylating] B, mitochondrial [Triticum 
urartu]
Length=796

 Score =   336 bits (861),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  609  ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  668

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +NNV K A
Sbjct  669  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGA  728

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  729  PHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  787



>ref|NP_180178.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
 sp|O80988.1|GCSP2_ARATH RecName: Full=Glycine dehydrogenase (decarboxylating) 2, mitochondrial; 
AltName: Full=Glycine cleavage system P protein 2; 
AltName: Full=Glycine decarboxylase 2; AltName: Full=Glycine 
decarboxylase P-protein 2; Short=AtGLDP2; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAC31228.1| putative glycine dehydrogenase [Arabidopsis thaliana]
 gb|AEC07793.1| glycine decarboxylase P-protein 2 [Arabidopsis thaliana]
Length=1044

 Score =   341 bits (874),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  858   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  917

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNV K A
Sbjct  918   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGA  977

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P ++
Sbjct  978   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPANE  1035



>dbj|BAE98954.1| putative glycine dehydrogenase [Arabidopsis thaliana]
Length=1044

 Score =   341 bits (874),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  858   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  917

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNV K A
Sbjct  918   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGA  977

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P ++
Sbjct  978   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPANE  1035



>ref|XP_010526062.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Tarenaya hassleriana]
Length=1051

 Score =   341 bits (874),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/183 (86%), Positives = 168/183 (92%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  864   ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  923

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+ IEKG  DI+NNV K A
Sbjct  924   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISLIEKGNADIHNNVLKGA  983

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMADAW KPYSRE AAFPA WL+++KFWP+TGRVDNVYGDRNL+CTLL VSQ+ 
Sbjct  984   PHPPSLLMADAWKKPYSRECAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLLSVSQVA  1043

Query  191   EDE  183
             E++
Sbjct  1044  EEQ  1046



>ref|XP_006412401.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
 gb|ESQ53854.1| hypothetical protein EUTSA_v10024257mg [Eutrema salsugineum]
Length=1146

 Score =   342 bits (876),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/180 (87%), Positives = 165/180 (92%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFKNTAG+E EDVAKRLMDY
Sbjct  961   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKNTAGVEPEDVAKRLMDY  1020

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ +NV K A
Sbjct  1021  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQDNVLKGA  1080

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  1081  PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1140



>gb|KFK32542.1| hypothetical protein AALP_AA6G256500 [Arabis alpina]
Length=1041

 Score =   340 bits (872),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  855   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  914

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNV K A
Sbjct  915   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGA  974

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHPPSLLMADAW KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P ++
Sbjct  975   PHPPSLLMADAWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQPANE  1032



>gb|KDO80088.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=946

 Score =   338 bits (866),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  759  ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDY  818

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNV K A
Sbjct  819  GFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGA  878

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
            PHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  879  PHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  933



>gb|KHN37049.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Glycine 
soja]
Length=195

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/167 (87%), Positives = 155/167 (93%), Gaps = 0/167 (0%)
 Frame = -2

Query  683  EKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLM  504
            + +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLM
Sbjct  24   KNYYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLM  83

Query  503  IEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADAWTKPY  324
            IEPTESESKAELDRFCD LISIR+EIA+IEKG  DINNNV K+APHPPSLLMADAWTKPY
Sbjct  84   IEPTESESKAELDRFCDALISIRQEIAEIEKGNADINNNVLKSAPHPPSLLMADAWTKPY  143

Query  323  SREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  183
            SREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ VE++
Sbjct  144  SREYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQ  190



>ref|XP_006408846.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
 gb|ESQ50299.1| hypothetical protein EUTSA_v10001891mg [Eutrema salsugineum]
Length=1041

 Score =   339 bits (870),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/175 (90%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  853   ASKIAILNANYMAKRLENHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D NNNV K A
Sbjct  913   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPNNNVLKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNL+CTL P
Sbjct  973   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRNLVCTLQP  1027



>gb|AAA63798.1| victorin binding protein [Avena sativa]
Length=1032

 Score =   339 bits (869),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  845   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  904

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQ+E G  D+NNNV K A
Sbjct  905   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQVENGIADVNNNVLKGA  964

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  965   PHPPQLLMSDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1023



>ref|XP_010667776.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=1042

 Score =   339 bits (869),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/183 (85%), Positives = 165/183 (90%), Gaps = 0/183 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV FRGVNGT AHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  856   ASKQAILNANYMAKRLEDHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  915

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAE+DRFCD LISIREEIA+IE GK D NNNV K A
Sbjct  916   GFHGPTMSWPVPGTLMIEPTESESKAEMDRFCDALISIREEIAEIENGKADANNNVLKGA  975

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LMAD+W KPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTLLP +   
Sbjct  976   PHPPSMLMADSWNKPYSREYAAYPADWLRAAKFWPTTARVDNVYGDRNLICTLLPANHYE  1035

Query  191   EDE  183
             E++
Sbjct  1036  EEK  1038



>ref|XP_006601224.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like, 
partial [Glycine max]
Length=170

 Score =   314 bits (804),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 153/165 (93%), Gaps = 0/165 (0%)
 Frame = -2

Query  677  HYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIE  498
            +YPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDYGFH PTMSWPVPGTLMIE
Sbjct  1    YYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDYGFHAPTMSWPVPGTLMIE  60

Query  497  PTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADAWTKPYSR  318
            PTESESKAELDRFCD LISIR EIA+IEKG  DINNNV K+APHPPSLLMADAWTKPYSR
Sbjct  61   PTESESKAELDRFCDALISIRHEIAEIEKGNADINNNVLKSAPHPPSLLMADAWTKPYSR  120

Query  317  EYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMVEDE  183
            EYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQ VE++
Sbjct  121  EYAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLPASQAVEEQ  165



>ref|XP_006644607.1| PREDICTED: glycine dehydrogenase [decarboxylating] 2, mitochondrial-like 
[Oryza brachyantha]
Length=946

 Score =   337 bits (864),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  760  ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  819

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  820  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVNNNVLKSA  879

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPP LLM D WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+ 
Sbjct  880  PHPPQLLMGDTWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQVE  939

Query  191  E  189
            E
Sbjct  940  E  940



>ref|XP_006450834.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
 gb|ESR64074.1| hypothetical protein CICLE_v10007310mg [Citrus clementina]
Length=1058

 Score =   338 bits (868),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  871   ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDY  930

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNV K A
Sbjct  931   GFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGA  990

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  991   PHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  1045



>ref|XP_002880741.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57000.1| hypothetical protein ARALYDRAFT_481465 [Arabidopsis lyrata subsp. 
lyrata]
Length=1043

 Score =   338 bits (867),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  857   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  916

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EI+QIEKG  D NNNV K A
Sbjct  917   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRDEISQIEKGNADPNNNVLKGA  976

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHPPSLLMAD W KPYSREYAAFPA WL+++KFWP+TGRVDNVYGDRNL+CTL P ++
Sbjct  977   PHPPSLLMADTWKKPYSREYAAFPAPWLRSSKFWPSTGRVDNVYGDRNLVCTLQPANE  1034



>gb|ADM18296.1| mitochondrial glycine decarboxylase complex P-protein-like protein 
[Nicotiana benthamiana]
Length=350

 Score =   320 bits (819),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 154/183 (84%), Positives = 161/183 (88%), Gaps = 10/183 (5%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYMAKRLEKHYPV FRGVNGT AHEFIIDLRGFKNTAGIE EDVAKRL+DY
Sbjct  173  ASKIAILNANYMAKRLEKHYPVLFRGVNGTCAHEFIIDLRGFKNTAGIEPEDVAKRLIDY  232

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESE          TLISIREEIA+IEKGK DI+NNV K A
Sbjct  233  GFHGPTMSWPVPGTLMIEPTESE----------TLISIREEIAEIEKGKADIHNNVLKGA  282

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPPSLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL VSQ V
Sbjct  283  PHPPSLLMGDAWTKPYSREYAAFPASWLRVAKFWPSTGRVDNVYGDRNLTCTLLSVSQTV  342

Query  191  EDE  183
            E++
Sbjct  343  EEQ  345



>ref|XP_006475931.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like 
[Citrus sinensis]
 gb|KDO80086.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
 gb|KDO80087.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1058

 Score =   338 bits (868),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  871   ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDY  930

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNV K A
Sbjct  931   GFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGA  990

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TGRVDNVYGDRNLICTLLP
Sbjct  991   PHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATGRVDNVYGDRNLICTLLP  1045



>emb|CDM83805.1| unnamed protein product [Triticum aestivum]
Length=1031

 Score =   338 bits (866),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 158/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  844   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQ+E GK D +NNV K A
Sbjct  904   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQVENGKADAHNNVLKGA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  964   PHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>gb|EAZ13293.1| hypothetical protein OsJ_03218 [Oryza sativa Japonica Group]
Length=1035

 Score =   337 bits (865),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  848   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  907

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  908   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  967

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  968   PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1026



>ref|NP_001044046.1| Os01g0711400 [Oryza sativa Japonica Group]
 gb|AAQ24377.1| glycine dehydrogenase P protein [Oryza sativa Japonica Group]
 dbj|BAF05960.1| Os01g0711400 [Oryza sativa Japonica Group]
Length=1033

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  846   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  905

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  906   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  965

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  966   PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1024



>gb|EAY75571.1| hypothetical protein OsI_03474 [Oryza sativa Indica Group]
Length=1033

 Score =   337 bits (864),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 164/179 (92%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  846   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  905

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  906   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  965

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  966   PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1024



>emb|CBI27919.3| unnamed protein product [Vitis vinifera]
Length=1024

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAIL ANYMAKRLE HYP+ FRG+NGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  836   ASKIAILKANYMAKRLEDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  895

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D NNNV K A
Sbjct  896   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADPNNNVLKGA  955

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
             PHP SLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  956   PHPQSLLMQDAWTKPYSREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1009



>ref|XP_010942763.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Elaeis guineensis]
Length=1042

 Score =   337 bits (864),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYM KRLE HYP+ F GVNGTVAHEFI+DLRG+K TAGIE EDVAKRLMDY
Sbjct  855   ASKIAILNANYMVKRLENHYPILFCGVNGTVAHEFIVDLRGYKATAGIEPEDVAKRLMDY  914

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE G+ DI+NNV K A
Sbjct  915   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGRADISNNVLKGA  974

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPPSLLM D WTKPYSREYAAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLPVSQM
Sbjct  975   PHPPSLLMGDTWTKPYSREYAAFPASWLRGSKFWPTTGRVDNVYGDRNLICTLLPVSQM  1033



>gb|EMT12369.1| Glycine dehydrogenase (decarboxylating), mitochondrial [Aegilops 
tauschii]
Length=1027

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  840   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  899

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +NNV K A
Sbjct  900   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGA  959

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  960   PHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1018



>ref|XP_003569669.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Brachypodium distachyon]
Length=1033

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  844   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +NNV K A
Sbjct  904   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  964   PHPPQLLMSDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>ref|XP_002282271.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Vitis vinifera]
Length=1046

 Score =   337 bits (863),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 160/174 (92%), Gaps = 0/174 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAIL ANYMAKRLE HYP+ FRG+NGTVAHEFIIDLRGFKNTAGIE EDVAKRLMDY
Sbjct  858   ASKIAILKANYMAKRLEDHYPILFRGINGTVAHEFIIDLRGFKNTAGIEPEDVAKRLMDY  917

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK D NNNV K A
Sbjct  918   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADPNNNVLKGA  977

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
             PHP SLLM DAWTKPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL CTLL
Sbjct  978   PHPQSLLMQDAWTKPYSREYAAFPASWLRAAKFWPSTGRVDNVYGDRNLTCTLL  1031



>gb|EAZ37623.1| hypothetical protein OsJ_21958 [Oryza sativa Japonica Group]
Length=1005

 Score =   336 bits (861),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYM KRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  818  ASKIAILNANYMTKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  877

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  878  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  937

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
            PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  938  PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  996



>gb|AAB82711.1| glycine decarboxylase P subunit [x Tritordeum sp.]
Length=1031

 Score =   336 bits (861),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 157/179 (88%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  844   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKATAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA++E GK D +NNV K A
Sbjct  904   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEVENGKADAHNNVLKGA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM DAWTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  964   PHPPQLLMGDAWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQASQV  1022



>dbj|BAD35509.1| putative glycine dehydrogenase [Oryza sativa Japonica Group]
 gb|EAZ01651.1| hypothetical protein OsI_23687 [Oryza sativa Indica Group]
Length=1031

 Score =   335 bits (860),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 163/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYM KRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  844   ASKIAILNANYMTKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  903

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+NNNV K+A
Sbjct  904   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVNNNVLKSA  963

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTT RVDNVYGDRNLICTL   SQ+
Sbjct  964   PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTCRVDNVYGDRNLICTLQQGSQV  1022



>ref|XP_008347531.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase (decarboxylating), 
mitochondrial-like [Malus domestica]
Length=235

 Score =   313 bits (802),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  722  IAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH  543
            IAILNAN MAKRLE +YP+ F GVNGTVAHEFI+DL+GFKNTAGIE EDV KRLMDYGFH
Sbjct  53   IAILNANCMAKRLENYYPILFXGVNGTVAHEFIVDLKGFKNTAGIEPEDVPKRLMDYGFH  112

Query  542  GPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHP  363
            GPTMSWPVPGT MI+PTESESKAELDRFCD LISIREEIA I+KGK DI NNV K APHP
Sbjct  113  GPTMSWPVPGTRMIDPTESESKAELDRFCDALISIREEIALIQKGKADILNNVLKGAPHP  172

Query  362  PSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
            PSLL+ DAWTKPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P
Sbjct  173  PSLLIGDAWTKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP  224



>ref|XP_002441849.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
 gb|EES15687.1| hypothetical protein SORBIDRAFT_08g003440 [Sorghum bicolor]
Length=1042

 Score =   335 bits (860),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  854   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  913

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNV K A
Sbjct  914   GFHSPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADVLNNVLKGA  973

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   SQ+
Sbjct  974   PHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQASQV  1032



>ref|XP_004969722.1| PREDICTED: LOW QUALITY PROTEIN: glycine dehydrogenase [decarboxylating], 
mitochondrial-like [Setaria italica]
Length=1033

 Score =   334 bits (857),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLRGFK TAGIE EDVAKRLMDY
Sbjct  846   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRGFKTTAGIEPEDVAKRLMDY  905

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D  NNV K A
Sbjct  906   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIENGKADALNNVLKGA  965

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM+D+WTKPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL    Q+
Sbjct  966   PHPPQLLMSDSWTKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQAGQV  1024



>ref|XP_010097067.1| Glycine cleavage system P protein 1 [Morus notabilis]
 gb|EXB66868.1| Glycine cleavage system P protein 1 [Morus notabilis]
Length=1059

 Score =   334 bits (857),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 164/180 (91%), Gaps = 5/180 (3%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFK-----NTAGIEAEDVAK  567
             ASKIAILNANYMAKRLE +YPV FRGVNGT AHEFI+DLRGFK     NTAGIE EDVAK
Sbjct  867   ASKIAILNANYMAKRLENYYPVLFRGVNGTCAHEFIVDLRGFKAGFLFNTAGIEPEDVAK  926

Query  566   RLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNN  387
             RLMDYGFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKGK DI+NN
Sbjct  927   RLMDYGFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGKADIHNN  986

Query  386   VXKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             V K+APHPPSLLMADAWTKPYSRE AAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP
Sbjct  987   VLKSAPHPPSLLMADAWTKPYSRESAAFPAPWLRASKFWPTTGRVDNVYGDRNLICTLLP  1046



>ref|XP_010925018.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Elaeis guineensis]
Length=1040

 Score =   333 bits (855),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYM KRLE HYP+ F GVNGTVAHEFI+DLRGFK TAGIE EDVAKRL+DY
Sbjct  853   ASKIAILNANYMVKRLENHYPILFCGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLIDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK DINNNV K A
Sbjct  913   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADINNNVLKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LM D W KPYSR+ AAFPA WL+ +KFWPTTGRVDNVYGDRNLICTLLP SQM 
Sbjct  973   PHPPSMLMGDTWIKPYSRDIAAFPASWLQGSKFWPTTGRVDNVYGDRNLICTLLPASQMA  1032

Query  191   ED  186
             E+
Sbjct  1033  EE  1034



>ref|XP_008662474.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Zea mays]
 gb|AFW56070.1| glycine cleavage complex P-protein [Zea mays]
Length=1042

 Score =   332 bits (850),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/179 (86%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRGVNGTVAHEFIIDLR FK TAGIE EDVAKRLMDY
Sbjct  853   ASKIAILNANYMAKRLEKHYPVLFRGVNGTVAHEFIIDLRAFKTTAGIEPEDVAKRLMDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIA+IE GK D+ NNV K A
Sbjct  913   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAEIESGKADVLNNVLKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHPP LLM D W+KPYSREYAAFPA WL+ AKFWPTTGRVDNVYGDRNLICTL   +Q+
Sbjct  973   PHPPQLLMGDTWSKPYSREYAAFPAAWLRGAKFWPTTGRVDNVYGDRNLICTLQQATQV  1031



>ref|XP_008347532.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Malus domestica]
Length=253

 Score =   310 bits (793),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = -2

Query  716  ILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGP  537
            ILNAN MAKRLE +YP+ FRGVNGTVAHEFI+DL+GFKNTAGIE EDV KRLMDYGFHGP
Sbjct  73   ILNANCMAKRLENYYPILFRGVNGTVAHEFIVDLKGFKNTAGIEPEDVPKRLMDYGFHGP  132

Query  536  TMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHPPS  357
            TMSWPVPGT MI+PTESESKAELDRFCD LISIREEIAQI+KGK DI NNV K APHPPS
Sbjct  133  TMSWPVPGTRMIDPTESESKAELDRFCDALISIREEIAQIQKGKADILNNVLKGAPHPPS  192

Query  356  LLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
            LL+  AWTKPYSREYAAFPA WL+++KFWPTTGRVDNVYGDRNLICTL P
Sbjct  193  LLIGYAWTKPYSREYAAFPASWLRSSKFWPTTGRVDNVYGDRNLICTLQP  242



>ref|XP_010432628.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial-like 
[Camelina sativa]
Length=1045

 Score =   331 bits (849),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRG NGTVAHEFIIDLRGFKNTAG+EAEDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PV GTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  920   GFHAPTMSFPVSGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPS+LM+D W KPYSREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLLP  + V
Sbjct  980   PHPPSMLMSDTWKKPYSREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLLPEEEQV  1039



>ref|XP_009401914.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=1033

 Score =   330 bits (846),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 159/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE +YP+ FRGVNGTVAHEFI+DLRGFK TAGIE EDVAKRLMDY
Sbjct  846   ASKTAILNANYMAKRLENYYPILFRGVNGTVAHEFIVDLRGFKATAGIEPEDVAKRLMDY  905

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEI QIE GK DINNNV K A
Sbjct  906   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEITQIESGKADINNNVLKGA  965

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PHP S+LM D+W KPYSRE AAFP  WL+ AKFWPT GR+DNVYGDRNLICTL PVSQM
Sbjct  966   PHPLSMLMGDSWNKPYSRECAAFPVSWLRDAKFWPTAGRIDNVYGDRNLICTLPPVSQM  1024



>emb|CDX75316.1| BnaA01g03860D [Brassica napus]
Length=1044

 Score =   330 bits (846),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKH+PV FRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  859   ASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  918

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNV K A
Sbjct  919   GFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGA  978

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  979   PHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1038



>emb|CDX68930.1| BnaC01g05230D [Brassica napus]
Length=1045

 Score =   330 bits (846),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKH+PV FRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNV K A
Sbjct  920   GFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  980   PHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1039



>ref|XP_009125119.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Brassica rapa]
Length=1045

 Score =   330 bits (845),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/180 (84%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKH+PV FRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLEKHFPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PV GTLMIEPTESESKAELDRFCDTLISIREEIAQIEKG  D+ NNV K A
Sbjct  920   GFHAPTMSFPVSGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGNADVQNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PH P++LM+D W KPYSREYAAFP  WL++AKFWPTTGRVDNVYGDR L+CTLLP  + V
Sbjct  980   PHSPAMLMSDTWKKPYSREYAAFPTPWLRSAKFWPTTGRVDNVYGDRKLVCTLLPEEEQV  1039



>ref|XP_010437818.1| PREDICTED: glycine dehydrogenase (decarboxylating) 1, mitochondrial 
[Camelina sativa]
Length=1040

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRG NGTVAHEFIIDLRGFKNTAG+EAEDVAKRLMDY
Sbjct  855   ASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRGFKNTAGLEAEDVAKRLMDY  914

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PV GTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D+ NNV K A
Sbjct  915   GFHAPTMSFPVSGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADVQNNVLKGA  974

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPP LLM+D W KPYSREYAAFPA WL++AKFWP+T RVDNVYGDR L+CTLLP  + V
Sbjct  975   PHPPQLLMSDTWKKPYSREYAAFPAPWLRSAKFWPSTSRVDNVYGDRKLVCTLLPEEEQV  1034



>ref|XP_006858311.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
 gb|ERN19778.1| hypothetical protein AMTR_s00064p00096040 [Amborella trichopoda]
Length=1044

 Score =   328 bits (840),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKI+ILNANYMAKRLE HYPV FRGVNGT AHEFIIDLRGFK +AGIE EDVAKRLMDY
Sbjct  857   ASKISILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRGFKGSAGIEPEDVAKRLMDY  916

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESE+KAELDRFCD LISIR+EIAQIE GK D+  NV K A
Sbjct  917   GFHAPTMSWPVPGTLMIEPTESETKAELDRFCDALISIRKEIAQIESGKADVLVNVLKGA  976

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHPPSL+MAD W KPYSREYAAFPA WL+ AKFWP+TGRVDNVYGDRNL+CTLLPV+  V
Sbjct  977   PHPPSLIMADEWKKPYSREYAAFPASWLRGAKFWPSTGRVDNVYGDRNLVCTLLPVTNGV  1036



>ref|XP_010472637.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1046

 Score =   327 bits (838),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  860   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNV K A
Sbjct  920   GFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHP S LMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P ++
Sbjct  980   PHPLSSLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPANE  1037



>emb|CAA81076.1| P protein [Flaveria pringlei]
Length=1037

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DY
Sbjct  851   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDY  910

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NNNV K A
Sbjct  911   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNNNVIKGA  970

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P
Sbjct  971   PHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP  1025



>sp|P49361.1|GCSPA_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) A, mitochondrial; 
AltName: Full=Glycine cleavage system P protein A; 
AltName: Full=Glycine decarboxylase A; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) A; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA85353.1| P-protein of the glycine cleavage system [Flaveria pringlei]
Length=1037

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DY
Sbjct  851   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDY  910

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D+NNNV K A
Sbjct  911   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDLNNNVIKGA  970

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P
Sbjct  971   PHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP  1025



>ref|XP_010429623.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial 
[Camelina sativa]
Length=1044

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRG NGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  858   ASKIAILNANYMAKRLESHYPVLFRGANGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  917

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNV K A
Sbjct  918   GFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGA  977

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHP S LMADAW KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P ++
Sbjct  978   PHPLSSLMADAWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPANE  1035



>ref|XP_007136824.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
 gb|ESW08818.1| hypothetical protein PHAVU_009G077400g [Phaseolus vulgaris]
Length=1018

 Score =   326 bits (836),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AIL ANYMAKRLE HYPV FRG NGTVAHEFIIDLRGFKN+ GIE EDVAKRL+DY
Sbjct  843   ASKTAILKANYMAKRLETHYPVLFRGANGTVAHEFIIDLRGFKNSTGIEPEDVAKRLIDY  902

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMS+PVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IE GK DINNNV K A
Sbjct  903   GFHGPTMSFPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIENGKADINNNVLKGA  962

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPPSLLM DAWTKPYSREYAAFPA WL+ +KFWP+TGR+DNVYGDRNL+CTL P
Sbjct  963   PHPPSLLMGDAWTKPYSREYAAFPASWLRVSKFWPSTGRIDNVYGDRNLVCTLPP  1017



>ref|XP_010417387.1| PREDICTED: glycine dehydrogenase (decarboxylating) 2, mitochondrial-like 
[Camelina sativa]
Length=1041

 Score =   327 bits (837),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV FRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  855   ASKIAILNANYMAKRLESHYPVLFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  914

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNV K A
Sbjct  915   GFHAPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGA  974

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
             PHP S LMAD W KPYSREYAAFPA WL+++KFWPTTGRVDNVYGDR+L+CTL P ++
Sbjct  975   PHPLSSLMADTWKKPYSREYAAFPAPWLRSSKFWPTTGRVDNVYGDRHLVCTLQPANE  1032



>sp|O49852.1|GCSP_FLATR RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
trinervia]
 emb|CAB16916.1| P-Protein precursor [Flaveria trinervia]
Length=1034

 Score =   326 bits (836),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DY
Sbjct  848   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDY  907

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV K A
Sbjct  908   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGTVDFNNNVIKGA  967

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P
Sbjct  968   PHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP  1022



>sp|P49362.1|GCSPB_FLAPR RecName: Full=Glycine dehydrogenase (decarboxylating) B, mitochondrial; 
AltName: Full=Glycine cleavage system P protein B; 
AltName: Full=Glycine decarboxylase B; AltName: Full=Glycine 
dehydrogenase (aminomethyl-transferring) B; Flags: Precursor 
[Flaveria pringlei]
 emb|CAA91000.1| P-protein precursor of glycine cleavage system [Flaveria pringlei]
Length=1034

 Score =   326 bits (836),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DY
Sbjct  848   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDY  907

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV K A
Sbjct  908   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNNNVIKGA  967

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P
Sbjct  968   PHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP  1022



>sp|O49850.1|GCSP_FLAAN RecName: Full=Glycine dehydrogenase (decarboxylating), mitochondrial; 
AltName: Full=Glycine cleavage system P protein; AltName: 
Full=Glycine decarboxylase; AltName: Full=Glycine dehydrogenase 
(aminomethyl-transferring); Flags: Precursor [Flaveria 
anomala]
 emb|CAB16911.1| P-protein [Flaveria anomala]
Length=1034

 Score =   326 bits (835),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYP+ FRGVNGTVAHEFI+DLR  K TAGIE EDVAKRL+DY
Sbjct  848   ASKIAILNANYMAKRLENHYPILFRGVNGTVAHEFIVDLRPLKTTAGIEPEDVAKRLIDY  907

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIR+EIA+IEKG  D NNNV K A
Sbjct  908   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIRQEIAEIEKGNVDFNNNVIKGA  967

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
             PHPP LLMAD WTKPYSREYAA+PA WL+ AKFWPTT RVDNVYGDRNLICTL P
Sbjct  968   PHPPQLLMADKWTKPYSREYAAYPAPWLRAAKFWPTTCRVDNVYGDRNLICTLQP  1022



>ref|XP_006283054.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
 gb|EOA15952.1| hypothetical protein CARUB_v10004049mg [Capsella rubella]
Length=1038

 Score =   324 bits (831),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYPV FRG NGTVAHEFIIDLR FKNTAGIEAEDVAKRLMDY
Sbjct  853   ASKIAILNANYMAKRLEKHYPVLFRGANGTVAHEFIIDLRAFKNTAGIEAEDVAKRLMDY  912

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIEKG  D+ NNV K A
Sbjct  913   GFHAPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIEKGNADVQNNVLKGA  972

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PHP S+LMAD W KPYSREYAAFPA WL+++KFWP T RVDNVYGDR L+ TLL   + V
Sbjct  973   PHPQSVLMADTWNKPYSREYAAFPAPWLRSSKFWPITSRVDNVYGDRKLVSTLLAEEEQV  1032



>ref|XP_006296473.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
 gb|EOA29371.1| hypothetical protein CARUB_v10025658mg [Capsella rubella]
Length=1040

 Score =   322 bits (826),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE HYPV +RGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY
Sbjct  854   ASKIAILNANYMAKRLESHYPVLYRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  913

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMS+PVPGTLMIEPTESESKAELDRFCD LISIREEI+QIEKG  D +NNV K A
Sbjct  914   GFHSPTMSFPVPGTLMIEPTESESKAELDRFCDALISIREEISQIEKGNADPHNNVLKGA  973

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  213
             PHP SLLM+D W KPYSREYAAFP  WL+ +KFWP TGRVDNVYGDRNL+CTL
Sbjct  974   PHPLSLLMSDTWKKPYSREYAAFPTPWLRASKFWPVTGRVDNVYGDRNLVCTL  1026



>gb|KJB54688.1| hypothetical protein B456_009G045100 [Gossypium raimondii]
Length=1053

 Score =   311 bits (798),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLE +YPV FRGVNGTVAHEFI+DLRGFKNTAGIE EDVAKRLMDY
Sbjct  863   ASKIAILNANYMAKRLENYYPVLFRGVNGTVAHEFIVDLRGFKNTAGIEPEDVAKRLMDY  922

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESKAELDRFCD LISIREEIAQIE GK DI+NNV K A
Sbjct  923   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDALISIREEIAQIENGKADIHNNVLKGA  982

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVY  240
             PHPPSLLM DAWTKPY+REYAAFPA WL+TAKFWPTTG V  +Y
Sbjct  983   PHPPSLLMGDAWTKPYTREYAAFPASWLRTAKFWPTTGDVLTMY  1026



>gb|ACN39938.1| unknown [Picea sitchensis]
Length=780

 Score =   304 bits (778),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE +YPV FRG NGT AHEFIIDLR FK +AGIE EDVAKRLMDY
Sbjct  592  ASKLAILNANYMAKRLEDYYPVLFRGENGTCAHEFIIDLRHFKVSAGIEPEDVAKRLMDY  651

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFC+ LISIR+EI  IE GK D ++NV K A
Sbjct  652  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCNALISIRKEIMAIETGKMDSHHNVLKGA  711

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHP S++MAD W +PYSRE AAFPA W++ +KFWP+TGRVDNVYGDRNL+CTLL    +V
Sbjct  712  PHPASVVMADEWNRPYSREVAAFPASWVRASKFWPSTGRVDNVYGDRNLVCTLLQAGDVV  771

Query  191  EDE  183
            E++
Sbjct  772  EEQ  774



>emb|CAA38252.1| P-protein subunit of glycine decarboxylase enzyme complex [Pisum 
sativum]
Length=153

 Score =   278 bits (712),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/148 (86%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -2

Query  626  IIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTL  447
            I DLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPV GTLMIEPTESESKAELDRFCD L
Sbjct  1    IYDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVAGTLMIEPTESESKAELDRFCDAL  60

Query  446  ISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWP  267
            ISIR+EIA++EKG  D++NNV K APHPPSLLMADAWTKPYSREYAAFPA WL+ AKFWP
Sbjct  61   ISIRKEIAEVEKGNADVHNNVLKGAPHPPSLLMADAWTKPYSREYAAFPAAWLRGAKFWP  120

Query  266  TTGRVDNVYGDRNLICTLLPVSQMVEDE  183
            TTGRVDNVYGDRNL+CTLLP SQ VE++
Sbjct  121  TTGRVDNVYGDRNLVCTLLPASQAVEEQ  148



>ref|XP_001755004.1| predicted protein [Physcomitrella patens]
 gb|EDQ80458.1| predicted protein [Physcomitrella patens]
Length=946

 Score =   300 bits (769),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE HYPV FRGVNGT AHEFIIDLR FK TAGIEAEDVAKRLMDY
Sbjct  760  ASKLAILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVAKRLMDY  819

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIREEIA IE G+    +NV K A
Sbjct  820  GYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIREEIAAIENGEASREDNVLKGA  879

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT
Sbjct  880  PHPASVVMADDWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT  931



>ref|XP_001754864.1| predicted protein [Physcomitrella patens]
 gb|EDQ80318.1| predicted protein [Physcomitrella patens]
Length=1038

 Score =   301 bits (770),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/172 (81%), Positives = 149/172 (87%), Gaps = 0/172 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK+AILNANYMAKRLE HYPV FRGVNGT AHEFIIDLR FK TAGIEAEDVAKRLMDY
Sbjct  852   ASKLAILNANYMAKRLENHYPVLFRGVNGTCAHEFIIDLRKFKETAGIEAEDVAKRLMDY  911

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             G+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIREEIA IE G+    +NV K A
Sbjct  912   GYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIREEIAAIENGEASREDNVLKGA  971

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
             PHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT
Sbjct  972   PHPASVVMADDWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLMCT  1023



>gb|KDO80089.1| hypothetical protein CISIN_1g001531mg [Citrus sinensis]
Length=1050

 Score =   300 bits (769),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASKIAILNANYMAKRLEKHYP+ FRGVNGTVAHEFI+DLRG KNTAGIE EDVAKRLMDY
Sbjct  871   ASKIAILNANYMAKRLEKHYPILFRGVNGTVAHEFIVDLRGLKNTAGIEPEDVAKRLMDY  930

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVPGTLMIEPTESESK ELDR+CD LISIREEIAQIE GK DI+NNV K A
Sbjct  931   GFHGPTMSWPVPGTLMIEPTESESKEELDRYCDALISIREEIAQIENGKADIHNNVLKGA  990

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTG  258
             PHPPSLLM D WTKPYSREYAA+PA WL+ AKFWP TG
Sbjct  991   PHPPSLLMGDTWTKPYSREYAAYPASWLRFAKFWPATG  1028



>ref|XP_001780310.1| predicted protein [Physcomitrella patens]
 gb|EDQ54869.1| predicted protein [Physcomitrella patens]
Length=995

 Score =   299 bits (766),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 157/183 (86%), Gaps = 1/183 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE HYP+ FRGVNGT AHEFIIDLR FK+TAGIEAEDVAKRLMDY
Sbjct  809  ASKLAILNANYMAKRLENHYPILFRGVNGTCAHEFIIDLRKFKDTAGIEAEDVAKRLMDY  868

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PTMSWPV GTLMIEPTESESKAELDRFCD LISIR EIA IE G+    +NV K +
Sbjct  869  GYHAPTMSWPVSGTLMIEPTESESKAELDRFCDALISIRGEIAAIENGEASREDNVLKGS  928

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHP S++MAD WTK YSRE AAFPA W++ +KFWPTT RVDNVYGDRNL+CT  P +++V
Sbjct  929  PHPASVVMADNWTKSYSREVAAFPASWVRASKFWPTTSRVDNVYGDRNLVCT-NPPAELV  987

Query  191  EDE  183
            E++
Sbjct  988  EEK  990



>ref|XP_005850089.1| hypothetical protein CHLNCDRAFT_34381 [Chlorella variabilis]
 gb|EFN57987.1| hypothetical protein CHLNCDRAFT_34381 [Chlorella variabilis]
Length=201

 Score =   276 bits (705),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE+HYPV FRG NGT AHEFI+D+R   +  G+EAED+AKRLMDY
Sbjct  9    ASKLAILNANYMAKRLEQHYPVLFRGANGTCAHEFILDIRPITDATGVEAEDIAKRLMDY  68

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESESKAELDRFC+ +ISIR EIA +E GK D  NNV K+A
Sbjct  69   GFHAPTMSWPVAGTLMIEPTESESKAELDRFCEAMISIRHEIAAVEAGKADPKNNVLKHA  128

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  213
            PH P +++AD W +PY+RE AA+PA W++ AKFWPTT RVDNVYGDR+L+  L
Sbjct  129  PHSPDVVLADTWDRPYTRELAAYPAPWVRQAKFWPTTSRVDNVYGDRHLVLRL  181



>ref|XP_002988429.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
 gb|EFJ10519.1| hypothetical protein SELMODRAFT_159459 [Selaginella moellendorffii]
Length=946

 Score =   282 bits (721),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE HY + FRG NGT AHEFI+DLR FK TA IE EDVAKRL+DY
Sbjct  759  ASKLAILNANYMAKRLEDHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDY  818

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESESKAELDRFCD +ISIREEI  IE G  +  +NV K A
Sbjct  819  GFHAPTMSWPVHGTLMIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAADNVLKGA  878

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
            PH  S++++D W KPYSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+
Sbjct  879  PHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLI  932



>ref|XP_002979861.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
 gb|EFJ19263.1| hypothetical protein SELMODRAFT_153563 [Selaginella moellendorffii]
Length=946

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 147/174 (84%), Gaps = 0/174 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AILNANYMAKRLE HY + FRG NGT AHEFI+DLR FK TA IE EDVAKRL+DY
Sbjct  759  ASKLAILNANYMAKRLENHYRILFRGKNGTCAHEFIVDLRAFKATANIEPEDVAKRLIDY  818

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESESKAELDRFCD +ISIREEI  IE G  +  +NV K A
Sbjct  819  GFHAPTMSWPVHGTLMIEPTESESKAELDRFCDAMISIREEIRAIENGTCNAADNVLKGA  878

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
            PH  S++++D W KPYSR+ AA+PA W++++KFWP+TGRVDNVYGDRNL+CTL+
Sbjct  879  PHSASMVLSDKWNKPYSRKLAAYPATWVESSKFWPSTGRVDNVYGDRNLVCTLI  932



>ref|XP_001692993.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
 gb|EDP03562.1| glycine cleavage system, P protein [Chlamydomonas reinhardtii]
Length=1039

 Score =   278 bits (712),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK+AIL ANYMAKRL  HYPV F G NGT AHEFI+DLR  K TAGIEAEDVAKRLMDY
Sbjct  854   ASKLAILKANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDY  913

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PTMSWPVPGTLMIEPTESESK ELDRFC+ +ISIREEI +IE GK D  NN+ K+A
Sbjct  914   GFHAPTMSWPVPGTLMIEPTESESKEELDRFCEAMISIREEIREIESGKADKANNILKHA  973

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  222
             PH P +++AD W +PYSRE AAFPA W++ AKFWPT  RVDNVYGDR+LI
Sbjct  974   PHAPGVVLADKWERPYSRERAAFPAPWVRQAKFWPTVSRVDNVYGDRHLI  1023



>ref|XP_006371884.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
 gb|ERP49681.1| hypothetical protein POPTR_0018s05150g [Populus trichocarpa]
Length=804

 Score =   275 bits (702),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 150/183 (82%), Gaps = 17/183 (9%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASKIAILNANYM KRLE +YP+ FRGVNGTVAHEFI+DLRGFK                 
Sbjct  634  ASKIAILNANYMVKRLENYYPILFRGVNGTVAHEFIVDLRGFK-----------------  676

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESKAELDRFC  LISIREEIA+IEK K DI+NNV K A
Sbjct  677  GFHAPTMSWPVPGTLMIEPTESESKAELDRFCVALISIREEIAEIEKEKADIHNNVLKGA  736

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHPPSL+M DAWTKPYSREYAAF A WL+ AKFWP++GRVDNVYGDRNLICTLL  SQ+V
Sbjct  737  PHPPSLVMGDAWTKPYSREYAAFSASWLRVAKFWPSSGRVDNVYGDRNLICTLLSASQVV  796

Query  191  EDE  183
            E++
Sbjct  797  EEQ  799



>ref|WP_010472943.1| glycine dehydrogenase [Acaryochloris sp. CCMEE 5410]
Length=984

 Score =   275 bits (702),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G +G VAHE I+DLRG K TAGIE ED+AKRLMDY
Sbjct  803  ATKVAILNANYIAKRLEAYYPVLYKGKSGLVAHECILDLRGVKKTAGIEVEDIAKRLMDY  862

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  NNV KNA
Sbjct  863  GYHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQNNVLKNA  922

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHP  +++AD+W +PYSRE AA+PA W + +KFWP   R++N YGDRNL+C+  P+S   
Sbjct  923  PHPADVVIADSWDRPYSREKAAYPAPWTRESKFWPAVSRINNAYGDRNLVCSCAPLSDYA  982

Query  191  E  189
            E
Sbjct  983  E  983



>ref|XP_002956892.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
 gb|EFJ42017.1| hypothetical protein VOLCADRAFT_107448 [Volvox carteri f. nagariensis]
Length=978

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK+AIL ANYMAKRL  HYPV F G NGT AHEFI+DLR  K TAGIEAEDVAKRLMDY
Sbjct  793  ASKLAILKANYMAKRLAGHYPVLFTGPNGTCAHEFILDLRPLKETAGIEAEDVAKRLMDY  852

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPVPGTLMIEPTESESK ELDRFC+ +ISIREEI +IE+G+ D  NNV K+A
Sbjct  853  GFHAPTMSWPVPGTLMIEPTESESKDELDRFCEAMISIREEIREIEQGRADRENNVLKHA  912

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLI  222
            PH PS+++ D W +PY+RE AA+PA W+  AKFWPT  RVDNVYGDRNL+
Sbjct  913  PHAPSVVLVDTWDRPYTRERAAYPAPWVWQAKFWPTVSRVDNVYGDRNLV  962



>ref|XP_011398598.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
 gb|KFM25702.1| Glycine dehydrogenase [decarboxylating], mitochondrial [Auxenochlorella 
protothecoides]
Length=1211

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK+AILNANYMAKRLEKHY V F G NGT AHEFI+D+R   +++GIEAED+AKRL+DY
Sbjct  1021  ASKLAILNANYMAKRLEKHYNVLFHGPNGTCAHEFILDIRPLTSSSGIEAEDIAKRLIDY  1080

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPV GTLMIEPTESESKAELDRF + +I IREEIA+IE GK D  NNV K+A
Sbjct  1081  GFHGPTMSWPVSGTLMIEPTESESKAELDRFVEAMIGIREEIAEIESGKADRANNVLKHA  1140

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  213
             PHP  ++MAD W +PYSR+ AA+PA W++ +KFWPTT RVDNVYGDRNL+  +
Sbjct  1141  PHPAHVVMADEWDRPYSRDKAAYPAPWVRQSKFWPTTCRVDNVYGDRNLVVRM  1193



>ref|WP_012166094.1| glycine dehydrogenase [Acaryochloris marina]
 gb|ABW30892.1| glycine dehydrogenase [Acaryochloris marina MBIC11017]
Length=984

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G +G VAHE I+DLRG K TA IE ED+AKRLMDY
Sbjct  803  ATKVAILNANYIAKRLEAYYPVLYKGKSGLVAHECILDLRGVKKTAEIEVEDIAKRLMDY  862

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIA+IE G+ D  NNV KNA
Sbjct  863  GYHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAEIEAGQADAQNNVLKNA  922

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHP  +++AD+W +PYSRE AA+PA W +  KFWP   R++N YGDRNL+C+  P+S   
Sbjct  923  PHPADVVIADSWDRPYSREKAAYPAPWTREFKFWPAVSRINNAYGDRNLVCSCAPLSDYA  982

Query  191  E  189
            E
Sbjct  983  E  983



>gb|EMI20957.1| glycine dehydrogenase [Rhodopirellula maiorica SM1]
Length=345

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMAKRL  HY + +   +G VAHEFI+D R F+ +AG++ ED+AKRLMDY
Sbjct  166  ATQVAILNANYMAKRLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIAKRLMDY  225

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESK ELDRFCD LISIR EI  IE GK D N+N  K+A
Sbjct  226  GFHGPTMSWPVPGTLMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDANDNPLKHA  285

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    + +D W  PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  P+
Sbjct  286  PHTMGAIGSDDWQHPYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCPPM  341



>ref|WP_040765024.1| glycine dehydrogenase, partial [Rhodopirellula maiorica]
Length=347

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMAKRL  HY + +   +G VAHEFI+D R F+ +AG++ ED+AKRLMDY
Sbjct  168  ATQVAILNANYMAKRLSDHYDILYTDSDGFVAHEFIVDCRKFEKSAGVKIEDIAKRLMDY  227

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESK ELDRFCD LISIR EI  IE GK D N+N  K+A
Sbjct  228  GFHGPTMSWPVPGTLMIEPTESESKDELDRFCDALISIRAEIQSIEDGKMDANDNPLKHA  287

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    + +D W  PY+RE AA+P  WL+ AKFWPT GR+D+ YGDRNL+C+  P+
Sbjct  288  PHTMGAIGSDDWQHPYTREQAAWPMAWLRDAKFWPTVGRIDSAYGDRNLVCSCPPM  343



>ref|WP_039128745.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
 gb|KIC91589.1| glycine dehydrogenase [Flavihumibacter sp. ZG627]
Length=960

 Score =   266 bits (680),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/183 (68%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++ AILNANYM  RL+K Y V + G NGT AHEFI+DLR FK +AGIEAEDVAKRLMDY
Sbjct  777  ATEYAILNANYMKSRLDKAYSVLYNGRNGTCAHEFIVDLRPFKTSAGIEAEDVAKRLMDY  836

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGT+MIEPTESE KAELDRFCD ++SIREEIA IE G  D  NN  KNA
Sbjct  837  GFHAPTMSFPVPGTIMIEPTESEDKAELDRFCDAMLSIREEIAAIENGLADKGNNALKNA  896

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   L+ AD W KPYSR+ AAFP  ++K  KFWP+  RV+N +GDRNLICT  PVS   
Sbjct  897  PHTQFLITADQWDKPYSRQKAAFPLPYVKENKFWPSVSRVNNTFGDRNLICTCEPVSSYA  956

Query  191  EDE  183
            E+E
Sbjct  957  EEE  959



>ref|XP_003055654.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
 gb|EEH60906.1| glycine cleavage system p-protein [Micromonas pusilla CCMP1545]
Length=1045

 Score =   266 bits (680),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 142/182 (78%), Gaps = 0/182 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             ASK AILNANYMAKRLE HYPV F+G NGT AHEFI+DLR   +++G+  EDVAKRLMDY
Sbjct  862   ASKRAILNANYMAKRLEDHYPVLFKGKNGTCAHEFILDLRPLGDSSGVVVEDVAKRLMDY  921

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             G+H PTMSWPV GTLMIEPTESESKAELDRFC+ +I+IREEI  IE G  D  NN  K+A
Sbjct  922   GYHSPTMSWPVSGTLMIEPTESESKAELDRFCNAMIAIREEIRDIENGAMDRENNPLKHA  981

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PH  S++M D W +PYSRE AAFPA W++ +KFWPT  RVDNVYGDRNL+ T   V    
Sbjct  982   PHTASVVMGDEWDRPYSRETAAFPAPWVRASKFWPTNSRVDNVYGDRNLVTTHASVEVSA  1041

Query  191   ED  186
             E+
Sbjct  1042  EE  1043



>gb|AAM93931.1| glycine decarboxylase p protein [Griffithsia japonica]
Length=215

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 141/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++ AILNANYMA RL+  + + FRG  G  AHEFI+DLR FK + GI   DVAKRL DY
Sbjct  26   ATEQAILNANYMATRLKGSFNILFRGSQGRCAHEFILDLRPFKASCGISETDVAKRLQDY  85

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLM+EPTESESKAELDRFCD +I IREEI  +E+G+ D  +N  K+A
Sbjct  86   GFHAPTMSWPVAGTLMVEPTESESKAELDRFCDAMIMIREEIRAVEEGRMDKEDNPLKHA  145

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++ AD WT+ YSRE  A+PA W++ +KFWPTT RVD+V+GDRNL+CT  P+S  +
Sbjct  146  PHTAAIVTADEWTRGYSREAGAYPASWVQGSKFWPTTSRVDDVFGDRNLVCTCPPLSAYL  205

Query  191  EDE  183
            +++
Sbjct  206  DED  208



>ref|WP_017712703.1| glycine dehydrogenase [Prochlorothrix hollandica]
Length=970

 Score =   264 bits (675),  Expect = 5e-78, Method: Composition-based stats.
 Identities = 113/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMA RL  HYP+ ++G+ G VAHE I+DLR  K TAGIE EDVAKRLMDY
Sbjct  789  ATQLAILNANYMAHRLAPHYPILYKGIGGLVAHECILDLRDLKRTAGIEVEDVAKRLMDY  848

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+E+  IE+G+ D  NN  K+A
Sbjct  849  GFHAPTVSWPVAGTMMVEPTESESKEELDRFCDAMIAIRQEVRAIEQGQIDPLNNPLKHA  908

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH   +L+AD W +PYSRE AA+P  WL+  KFWP  GRVDN YGDRNL+C+  P+
Sbjct  909  PHTAEVLLADDWDRPYSREQAAYPLPWLRQFKFWPVVGRVDNAYGDRNLVCSCAPM  964



>gb|KIY91355.1| glycine dehydrogenase [Monoraphidium neglectum]
Length=178

 Score =   244 bits (622),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = -2

Query  698  MAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPV  519
            MAKRL  +Y V F G  GT AHEFI+D+R FK+TAG+EAED+AKRLMDYGFH PTMSWPV
Sbjct  1    MAKRLSPYYKVLFTGRAGTCAHEFILDVRPFKDTAGVEAEDIAKRLMDYGFHAPTMSWPV  60

Query  518  PGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADA  339
            PGTLMIEPTESE KAELDRF D ++SIR EIA++E GK   +NNV  +APH   +++A++
Sbjct  61   PGTLMIEPTESEPKAELDRFIDAMVSIRHEIAEVEAGKAPRDNNVLVHAPHTAQVVLAES  120

Query  338  WTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTL  213
            W++PYSRE AAFPA W+K AKFWPTT RVDNVYGDR+LI  L
Sbjct  121  WSRPYSREQAAFPAPWVKGAKFWPTTSRVDNVYGDRHLITRL  162



>ref|WP_033110978.1| hypothetical protein [Leptospira interrogans]
Length=188

 Score =   243 bits (621),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++ +ILNANY+AKRLEK YPV ++G NG VAHE I+DLR FK +AGIE EDVAKRL+DY
Sbjct  9    ATRNSILNANYIAKRLEKVYPVLYKGKNGFVAHECILDLRPFKKSAGIEVEDVAKRLIDY  68

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +N  KN+
Sbjct  69   GFHAPTMSFPVPGTLMIEPTESESLEELDRFCEAMLLIYQEILDVQSGTLDKTDNPLKNS  128

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  +++ +D W   Y RE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ LP+
Sbjct  129  PHTAAMVTSDRWDHLYPRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCLPI  184



>ref|XP_010304606.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like, 
partial [Balearica regulorum gibbericeps]
Length=201

 Score =   243 bits (621),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY + FRG  G VAHEFI+D R FK +A IEA D+AKRL DY
Sbjct  10   ASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKSANIEAVDLAKRLQDY  69

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N  K +
Sbjct  70   GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMS  129

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K   KFWPT  R+D++YGD++L+CT  P+
Sbjct  130  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPM  186



>ref|WP_009094772.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
 gb|EMI46247.1| glycine dehydrogenase [Rhodopirellula sp. SWK7]
Length=990

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMAKRL  HY + +   NG VAHEFI+D RGF+ +AG++ ED+AKRLMDY
Sbjct  811  ATQVAILNANYMAKRLSDHYDILYTDANGYVAHEFIVDCRGFEKSAGVQIEDIAKRLMDY  870

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESK ELDRFCD +ISIR EI  I+ G  D  +N  KNA
Sbjct  871  GFHGPTMSWPVPGTLMIEPTESESKDELDRFCDAMISIRAEIQSIQDGTLDAKDNPLKNA  930

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    + +D W+ PY+RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  P+
Sbjct  931  PHTVGAIGSDNWSHPYTREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCPPM  986



>gb|EFA86802.1| glycine dehydrogenase [Polysphondylium pallidum PN500]
Length=1014

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A+++AILNANYMA RL+ HY + + G +G VAHEFIIDLR FK T GI+AEDVAKRL DY
Sbjct  835   ATQVAILNANYMASRLKDHYKILYTGSHGLVAHEFIIDLRDFKETTGIQAEDVAKRLQDY  894

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPVP TLMIEPTESESK ELDR CD LISIR EIA+IE+GK D NNN+  N+
Sbjct  895   GFHGPTMSWPVPNTLMIEPTESESKYELDRLCDALISIRAEIAEIEQGKADRNNNLLVNS  954

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  201
             PH  +++ AD W +PY+R  AA+P+   + +KFWP+ GRVDNV+GDRNL+C+  P++
Sbjct  955   PHTEAVITADTWDRPYTRARAAYPSPSTRESKFWPSVGRVDNVFGDRNLVCSCPPLT  1011



>ref|WP_016874717.1| glycine dehydrogenase [Chlorogloeopsis fritschii]
Length=987

 Score =   261 bits (668),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +AGIE +DVAKRLMDY
Sbjct  807  ATKVAILNANYIAKRLETYYPVLYKGKNGFVAHECILDLRSLKKSAGIEIDDVAKRLMDY  866

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK DI +NV KNA
Sbjct  867  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKADIQDNVLKNA  926

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+ D W  PYSR+ AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  927  PHTAESLIVDEWNHPYSRQQAAYPASWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  982



>ref|WP_039142781.1| glycine dehydrogenase [Flavihumibacter solisilvae]
 gb|KIC93072.1| glycine dehydrogenase [Flavihumibacter solisilvae]
Length=956

 Score =   261 bits (667),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANYM  RLE  YP+ +   NGT AHEFI+DLR FK +AGIEAED+AKRLMDY
Sbjct  773  STEYAILNANYMKARLESAYPILYTSHNGTCAHEFIVDLRPFKTSAGIEAEDIAKRLMDY  832

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGT+MIEPTESE KAELDRFCD L++IREEIA +E G  D  NNV KNA
Sbjct  833  GFHAPTMSFPVPGTIMIEPTESEDKAELDRFCDALLAIREEIAAVENGTADKTNNVLKNA  892

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++ AD W +PYSR+ AAFP  ++K  KFWP+ GRV+N  GDRNLICT  PVS   
Sbjct  893  PHTQFVITADEWQRPYSRQQAAFPLDYVKENKFWPSVGRVNNTVGDRNLICTCEPVSAYE  952

Query  191  E  189
            E
Sbjct  953  E  953



>ref|WP_018342886.1| glycine dehydrogenase [Cytophaga aurantiaca]
Length=966

 Score =   261 bits (667),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 141/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+  RLEKHYP+ + G NG  AHEFI+D R FK T GIE ED+AKRLMDY
Sbjct  781  ATKNAILNANYIKARLEKHYPILYTGTNGHCAHEFILDCRAFKTTIGIEVEDIAKRLMDY  840

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PV GTLMIEPTESES  ELDRFCD +ISIR EIA+IE GK D  +NV K+A
Sbjct  841  GFHAPTVSFPVAGTLMIEPTESESMHELDRFCDAMISIRAEIAEIENGKADKLDNVLKHA  900

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  S++ ADAWT+ YSR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +P  +  
Sbjct  901  PHTASVITADAWTRSYSRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCIPTEEFA  960

Query  191  EDE  183
            E E
Sbjct  961  EAE  963



>ref|WP_022606719.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae]
 gb|ERN41620.1| glycine dehydrogenase (decarboxylating) [Rubidibacter lacunae 
KORDI 51-2]
Length=978

 Score =   261 bits (667),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AIL+ANY+A+RL+ +YPV FRG  G VAHE ++DLR  K  AGIE +DVAKRLMD+
Sbjct  797  ATKVAILSANYVARRLDTYYPVLFRGDKGLVAHECVVDLRPLKKRAGIEVDDVAKRLMDF  856

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPVPGT+M+EPTESE+KAELDRFC+ +I+IR+E+  IE G+ D N+NV K+A
Sbjct  857  GYHAPTVSWPVPGTMMVEPTESETKAELDRFCEAMIAIRKEVEAIENGRADPNDNVLKHA  916

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PHP ++++ADAW +PY+RE AA+PA+W++  KFWP+ GRVDN YGDRNLIC+ + +    
Sbjct  917  PHPAAVVVADAWERPYTREQAAYPAEWVRDRKFWPSVGRVDNAYGDRNLICSCIGMDAYK  976

Query  191  ED  186
            +D
Sbjct  977  DD  978



>ref|WP_044197707.1| glycine dehydrogenase [Oscillatoria acuminata]
Length=952

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE +YPV ++G  G VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  771  ATQVAILNANYIAKRLEPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKRLMDY  830

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+ KNA
Sbjct  831  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNLLKNA  890

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PHP ++ +A  W +PYSRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  891  PHPATVAIASEWNRPYSREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  946



>emb|CCI29698.1| Glycine cleavage system P-protein (glycine dehydrogenase) (fragment) 
[Microcystis aeruginosa PCC 9809]
Length=387

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMA RLE  YPV F+G  GTVAHE +IDLR  K  AGIE EDVAKRLMD+
Sbjct  208  ATEVAILNANYMAFRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVAKRLMDF  267

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++N  KNA
Sbjct  268  GFHAPTVSWPVAGTMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHDNPLKNA  327

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PH  ++L AD W++PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  328  PHTAAVLTADDWSRPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  379



>ref|WP_041036217.1| glycine dehydrogenase [Tolypothrix campylonemoides]
 gb|KIJ75906.1| glycine dehydrogenase [Tolypothrix campylonemoides VB511288]
Length=990

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  812  ATKVAILNANYIAKRLEPYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDVAKRLMDY  871

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NV KNA
Sbjct  872  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNA  931

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+DN YGDRN +C+ LP+
Sbjct  932  PHTAQSLIVGEWNHPYSREQAAYPAPWTREHKFWPVVGRIDNAYGDRNFVCSCLPM  987



>ref|WP_008684764.1| glycine dehydrogenase [Rhodopirellula sallentina]
 gb|EMI53503.1| glycine dehydrogenase [Rhodopirellula sallentina SM41]
Length=990

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMAKRL +H+ + +   NG VAHEFI+D RGF+ +AG++ +D+AKRLMDY
Sbjct  811  ATQVAILNANYMAKRLSEHFNILYTDSNGYVAHEFIVDCRGFEKSAGVQIDDIAKRLMDY  870

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFHGPTMSWPVPGTLMIEPTESESK ELDRFCD +I+IREEI  I+ GK D  +N  KNA
Sbjct  871  GFHGPTMSWPVPGTLMIEPTESESKDELDRFCDAMIAIREEIQSIQDGKLDAKDNPLKNA  930

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    + +D W+ PY+RE AA+P  WL+ AKFWPT GR+DN YGDRNL+C+  P+
Sbjct  931  PHTVGEIGSDDWSHPYTREQAAWPKAWLRDAKFWPTVGRIDNTYGDRNLVCSCPPM  986



>gb|AFY83915.1| glycine dehydrogenase, decarboxylating [Oscillatoria acuminata 
PCC 6304]
Length=978

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE +YPV ++G  G VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  797  ATQVAILNANYIAKRLEPYYPVLYKGKTGLVAHECILDLRSLKKSAGIEVEDIAKRLMDY  856

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IREEI  IE G  D  NN+ KNA
Sbjct  857  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCEAMIAIREEIRAIEAGTMDGENNLLKNA  916

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PHP ++ +A  W +PYSRE A FPA W +  KFWP+ GR+DN YGDRNL+C  LP+
Sbjct  917  PHPATVAIASEWNRPYSREQAVFPAPWTREHKFWPSVGRIDNAYGDRNLVCACLPM  972



>ref|XP_007112412.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Physeter catodon]
Length=254

 Score =   244 bits (622),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++IAILNANYMAKRLEKHY V FRG  G VAHEFI+D R FK +A IEA DVAKRL DY
Sbjct  63   ATEIAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANIEAVDVAKRLQDY  122

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N  K +
Sbjct  123  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMS  182

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K   KFWPTT R+D++YGD++L+CT  P+
Sbjct  183  PHSLTCVTSSHWDRPYSREVAAFPLPFVKPENKFWPTTARIDDIYGDQHLVCTCPPM  239



>ref|WP_044035200.1| glycine dehydrogenase, partial [Microcystis aeruginosa]
Length=400

 Score =   248 bits (634),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 134/172 (78%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMA RLE  YPV F+G  GTVAHE +IDLR  K  AGIE EDVAKRLMD+
Sbjct  221  ATEVAILNANYMAFRLESAYPVLFKGSAGTVAHECVIDLRPLKKQAGIEVEDVAKRLMDF  280

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESES  ELDRFC+ L++I +E+  I  G  DI++N  KNA
Sbjct  281  GFHAPTVSWPVAGTMMVEPTESESLGELDRFCEALLTIYQEVQAIANGSMDIHDNPLKNA  340

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PH  ++L AD W++PYSR+ AA+P  WLK  KFWP  GRVDN YGDRNL+C+
Sbjct  341  PHTAAVLTADDWSRPYSRQQAAYPLSWLKDYKFWPVVGRVDNAYGDRNLVCS  392



>dbj|BAB26854.1| unnamed protein product [Mus musculus]
Length=189

 Score =   241 bits (615),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/178 (64%), Positives = 135/178 (76%), Gaps = 1/178 (1%)
 Frame = -2

Query  722  IAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDYGFH  543
            IAILNANYMAKRLEKHY V FRG  G VAHEFI+D R FK +A +EA DVAKRL DYGFH
Sbjct  1    IAILNANYMAKRLEKHYRVLFRGARGYVAHEFILDTRPFKKSANVEAVDVAKRLQDYGFH  60

Query  542  GPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNAPHP  363
             PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N  K +PH 
Sbjct  61   APTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHS  120

Query  362  PSLLMADAWTKPYSREYAAFPAQWLKTA-KFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             + + +  W +PYSRE AAFP  ++K   KFWPT  R+D++YGD++L+CT  P+   V
Sbjct  121  LTCVTSSCWDRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYV  178



>ref|WP_028981454.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   259 bits (663),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANY+  RLEK +P+ +    G  AHEFI+D R FK+T G+E ED+AKRLMDY
Sbjct  779  STQHAILNANYIKARLEKFFPILYTNTKGRCAHEFILDCREFKHTVGVEVEDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PVPGTLMIEPTESESK ELDRFC+ +I IREEI +IE GK D  NNV K+A
Sbjct  839  GFHAPTVSFPVPGTLMIEPTESESKEELDRFCEAMIQIREEIREIENGKADKANNVLKHA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++MAD WT+PYSRE AAFP +W++  KFWP+  RVDN YGDRNL+CT LPV    
Sbjct  899  PHTAEVIMADNWTRPYSREKAAFPIEWIRLRKFWPSVSRVDNAYGDRNLVCTCLPVEDYA  958

Query  191  EDE  183
              E
Sbjct  959  SHE  961



>ref|WP_011140250.1| glycine dehydrogenase [Gloeobacter violaceus]
 ref|NP_923192.1| glycine dehydrogenase [Gloeobacter violaceus PCC 7421]
 dbj|BAC88187.1| glycine cleavage system protein P [Gloeobacter violaceus PCC 
7421]
Length=998

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL  HYPV ++G  G VAHE I+DLR  K TAGIE +DVAKRLMDY
Sbjct  815  ATKVAILNANYIAHRLAPHYPVLYKGAGGLVAHECILDLRKLKTTAGIEVDDVAKRLMDY  874

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+MIEPTESES  ELDRFC+ LI+IR EIA IE+G+ D  +N  KNA
Sbjct  875  GFHAPTVSWPVAGTIMIEPTESESLEELDRFCEALIAIRHEIAAIERGEADRADNPLKNA  934

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  ++L+AD+W  PYSR  AA+PA WL   KFWP   R+DNVYGDRNLIC+ LP+    
Sbjct  935  PHTAAVLLADSWEHPYSRAQAAYPAPWLYQHKFWPVVSRIDNVYGDRNLICSCLPMEAYA  994

Query  191  ED  186
            +D
Sbjct  995  QD  996



>ref|WP_044171749.1| glycine dehydrogenase [Oscillatoria sp. PCC 10802]
Length=977

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 143/176 (81%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RLE +YPV ++G +G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  796  ATKVAILNANYIARRLEPYYPVLYKGKDGFVAHECILDLRGLKKSAGIEVDDIAKRLMDY  855

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EI +IE GK D +NNV KNA
Sbjct  856  GFHAPTVSWPVAGTVMVEPTESESKQELDRFCDAMIAIRKEIEEIELGKADPSNNVLKNA  915

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+A  W +PYSRE AA+PA W + +KFWP  GR+DN YGDR+ +C+ LPV
Sbjct  916  PHTAESLIAGEWDRPYSRERAAYPAPWTRESKFWPAVGRIDNAYGDRHFVCSCLPV  971



>ref|WP_006631620.1| glycine dehydrogenase [Microcoleus vaginatus]
 gb|EGK90642.1| Glycine dehydrogenase (decarboxylating) [Microcoleus vaginatus 
FGP-2]
Length=990

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMAKRLE +YPV ++G  G VAHE I+DLR  K +A IE ED+AKRLMDY
Sbjct  809  ATKVAILNANYMAKRLESYYPVLYKGKAGLVAHECILDLRSLKKSAAIEVEDIAKRLMDY  868

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR EIA+IEKG  D  NNV KNA
Sbjct  869  GYHAPTVSWPVAGTVMVEPTESESKQELDRFCEAMIAIRSEIAEIEKGNVDAQNNVLKNA  928

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    LM D W +PY+R  AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  929  PHTAESLMVDEWNRPYTRAQAAYPAPWTREHKFWPAVGRIDNAFGDRNFVCSCLPM  984



>ref|WP_023065539.1| glycine dehydrogenase [Lyngbya aestuarii]
 gb|ERT08292.1| glycine dehydrogenase [Lyngbya aestuarii BL J]
Length=992

 Score =   259 bits (662),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMA RL++ YP+ ++G NG +AHE I+DLRG K +A IE +D+AKRLMDY
Sbjct  811  ATKVAILNANYMAHRLKESYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDY  870

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGT+M+EPTESESKAELDRFCD +I+IR EI+ IE G  D  NN  KNA
Sbjct  871  GFHAPTVSWPVPGTVMVEPTESESKAELDRFCDAMIAIRREISAIESGDIDGENNPLKNA  930

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+    
Sbjct  931  PHTAESLIVGEWNHPYSREQAAYPAPWLRDHKFWPSVGRIDNAYGDRNFVCSCLPMEAYS  990

Query  191  ED  186
            E+
Sbjct  991  EN  992



>ref|WP_035999593.1| glycine dehydrogenase [Leptolyngbya sp. JSC-1]
Length=1011

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A+KIAILNANY+AKRLE HYPV ++G NG VAHE I+DLR FK TA IE +D+AKRL+DY
Sbjct  831   ATKIAILNANYIAKRLEGHYPVLYKGKNGLVAHECILDLRQFKKTAAIEVDDIAKRLIDY  890

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR EI +IE  + D  NN+ KNA
Sbjct  891   GFHPPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRAEIREIEADQVDRQNNLLKNA  950

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
             PH  + L++D W +PYSRE AA+P QW + +KFW    R+DN YGDRNL+C  LP+
Sbjct  951   PHSAASLLSDQWDRPYSRERAAYPTQWTRDSKFWAAVDRIDNAYGDRNLVCACLPM  1006



>ref|WP_012789622.1| glycine dehydrogenase [Chitinophaga pinensis]
 gb|ACU59446.1| glycine dehydrogenase [Chitinophaga pinensis DSM 2588]
Length=956

 Score =   258 bits (660),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+ AILNANYM  RLEK Y + + GVNGT AHEFI+DLR FK +AGIEAEDVAKRLMDY
Sbjct  773  ASQFAILNANYMKARLEKAYDILYNGVNGTCAHEFIVDLRPFKASAGIEAEDVAKRLMDY  832

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PV GT+MIEPTESE K ELDRFCD ++SIREEIA +E G  D  NNV K+A
Sbjct  833  GFHAPTLSFPVAGTIMIEPTESEDKDELDRFCDAMLSIREEIAAVENGAADKLNNVLKHA  892

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++ AD WT+PY+R+ AA+P  ++K  KFWP+  RV+N +GDRNLICT  PVS   
Sbjct  893  PHTQFVITADDWTRPYTRQQAAYPLDYVKLNKFWPSISRVNNTHGDRNLICTCEPVSSYA  952

Query  191  EDE  183
            E E
Sbjct  953  EAE  955



>ref|WP_015175278.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis]
 gb|AFZ05957.1| Glycine dehydrogenase (decarboxylating) [Oscillatoria nigro-viridis 
PCC 7112]
Length=990

 Score =   259 bits (661),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMAKRLE +YPV ++G  G VAHE I+DLR  K +A IE ED+AKRLMDY
Sbjct  809  ATKVAILNANYMAKRLESYYPVLYKGKAGLVAHECILDLRSLKKSAAIEVEDIAKRLMDY  868

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR EIA+IEKG  D  NNV KNA
Sbjct  869  GYHAPTVSWPVAGTVMVEPTESESKQELDRFCEAMIAIRGEIAEIEKGNVDAQNNVLKNA  928

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    LM D W +PY+R  AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  929  PHTAESLMVDEWNRPYTRAQAAYPAPWTREHKFWPAVGRIDNAFGDRNFVCSCLPM  984



>ref|WP_017320159.1| glycine dehydrogenase [cyanobacterium PCC 7702]
Length=970

 Score =   258 bits (660),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV +RG NG VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  791  ATKVAILNANYIAKRLEAYYPVLYRGKNGFVAHECILDLRSLKKSAGIEVDDIAKRLMDY  850

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EIA+IE GK D+ +NV KNA
Sbjct  851  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMIAIRQEIAEIESGKADLQDNVLKNA  910

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  911  PHTAESLIVGEWNHPYSREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCLPM  966



>ref|XP_010129815.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial-like 
[Buceros rhinoceros silvestris]
Length=405

 Score =   247 bits (630),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY + FRG  G VAHEFI+D R FK TA IEA D+AKRL DY
Sbjct  214  ASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDY  273

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N  K +
Sbjct  274  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMS  333

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  PV
Sbjct  334  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPV  390



>ref|XP_010074869.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pterocles gutturalis]
Length=361

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY V FRG  G VAHEFI+D R FK TA IEA D+AKRL DY
Sbjct  170  ASEIAILNANYMAKRLEKHYKVLFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDY  229

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA +E+G+ D   N  K +
Sbjct  230  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADVEEGRMDPQINPLKMS  289

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  PV
Sbjct  290  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPV  346



>ref|WP_039200768.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
 gb|KHG42226.1| glycine dehydrogenase [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=967

 Score =   258 bits (659),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANYMAK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  788  ATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDY  847

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++N+ KNA
Sbjct  848  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHDNLLKNA  907

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  908  PHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  963



>ref|WP_027401604.1| glycine dehydrogenase [Aphanizomenon flos-aquae]
Length=967

 Score =   258 bits (659),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANYMAK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  788  ATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDY  847

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++N+ KNA
Sbjct  848  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHDNLLKNA  907

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  908  PHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  963



>gb|KIJ83529.1| glycine dehydrogenase [Scytonema tolypothrichoides VB-61278]
Length=967

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  789  ATKVAILNANYIAKRLESYYPVLYKGKNGLVAHECILDLRSLKKSANIEIDDIAKRLMDY  848

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NV KNA
Sbjct  849  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNA  908

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP+ GR+D  YGDRN +C+ LP+
Sbjct  909  PHTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPSVGRIDAAYGDRNFVCSCLPM  964



>ref|WP_015209784.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale]
 gb|AFZ26542.1| glycine dehydrogenase, decarboxylating [Cylindrospermum stagnale 
PCC 7417]
Length=966

 Score =   258 bits (659),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRL+DY
Sbjct  786  ATKVAILNANYIAKRLESYYPVLYQGKNGLVAHECILDLRDLKKSASIEIDDVAKRLIDY  845

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA IE GK DI +N+ KNA
Sbjct  846  GFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIRQEIAAIESGKADIQDNLLKNA  905

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  201
            PH    L+A  W  PYSRE AA+PA W + +KFWP  GR+D  +GDRN +C+ LP++
Sbjct  906  PHTAESLIAGEWLHPYSREQAAYPASWTRESKFWPNVGRIDAAFGDRNFVCSCLPMA  962



>ref|WP_026752074.1| glycine dehydrogenase [Sediminibacterium sp. C3]
Length=957

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANYM  RLEKHYP+ + G NGT AHEFI+DLR FK +AG+EAEDVAKRL+DY
Sbjct  774  STEYAILNANYMKARLEKHYPILYTGKNGTCAHEFIVDLRPFKQSAGVEAEDVAKRLIDY  833

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GT+MIEPTESE KAELDRFCD LI+I  EI  IE GK D  NN  KNA
Sbjct  834  GFHAPTMSFPVAGTIMIEPTESEDKAELDRFCDALIAIHGEIKDIESGKADKANNPLKNA  893

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++ AD WT+PY+R+ AAFP  ++   KFWP+  RV+N +GDRNLICT  PVS   
Sbjct  894  PHTQAVVCADEWTRPYTRQEAAFPLYYVTLNKFWPSVARVNNTHGDRNLICTCEPVSSYA  953

Query  191  ED  186
            E+
Sbjct  954  EE  955



>ref|XP_009490955.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Pelecanus crispus]
Length=361

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY + FRG  G VAHEFI+D R FK TA IEA D+AKRL DY
Sbjct  170  ASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDY  229

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N  K +
Sbjct  230  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMS  289

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+
Sbjct  290  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPM  346



>dbj|GAL84002.1| glycine dehydrogenase [Sporocytophaga myxococcoides]
Length=965

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANY+  RLEK YP+ +    G  AHEFI+D R FK++ G+E ED+AKRLMDY
Sbjct  779  STQHAILNANYIKARLEKFYPILYTNTKGRCAHEFILDCREFKHSVGVEVEDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PVPGTLMIEPTESESK ELDRFC+ +I IREEI +IE GK D  NNV K+A
Sbjct  839  GFHAPTVSFPVPGTLMIEPTESESKEELDRFCEAMIQIREEIREIENGKADKVNNVLKHA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++MAD WT+PY+RE AAFP +W++  KFWP+  R+DN YGDRNL+CT LPV    
Sbjct  899  PHTAEVIMADNWTRPYTREKAAFPIEWIRQRKFWPSVSRIDNAYGDRNLVCTCLPVEDYA  958

Query  191  EDE  183
              E
Sbjct  959  SHE  961



>ref|WP_016546738.1| glycine dehydrogenase [Leptospira wolffii]
 gb|EPG65452.1| glycine dehydrogenase [Leptospira wolffii Serovar Khorat Str. 
Khorat-H2]
Length=962

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 142/178 (80%), Gaps = 0/178 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANY+AKRLE +YPV ++G NG VAHE I+D+R FK  +G+E EDVAKRLMDY
Sbjct  783  STEAAILNANYIAKRLENYYPVLYKGKNGLVAHECILDVRPFKKASGVEVEDVAKRLMDY  842

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESESK ELDRFC+ +I I  EI +IE GK D  +NV KN+
Sbjct  843  GFHAPTMSFPVPGTLMIEPTESESKEELDRFCEAMIRIHGEIQEIENGKADAKDNVLKNS  902

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQ  198
            PH  ++++ D+W+  YSRE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ LP+ +
Sbjct  903  PHTAAMVIGDSWSHAYSREKAAYPAPWTKEHKFWPYVGRIDNVYGDRNLVCSCLPIEE  960



>ref|WP_016866657.1| glycine dehydrogenase [Fischerella muscicola]
Length=979

 Score =   258 bits (658),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  800  ATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDY  859

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NV KNA
Sbjct  860  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNA  919

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  920  PHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  975



>ref|WP_016870901.1| glycine dehydrogenase [Fischerella thermalis]
Length=965

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  786  ATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDY  845

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NV KNA
Sbjct  846  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNA  905

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  906  PHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  961



>ref|WP_009457628.1| glycine dehydrogenase [Fischerella sp. JSC-11]
 gb|EHC12211.1| Glycine dehydrogenase (decarboxylating) [Fischerella sp. JSC-11]
Length=965

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  786  ATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSANIEIDDIAKRLMDY  845

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+E+A+IE GK D+ +NV KNA
Sbjct  846  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDAMISIRQEVAEIEAGKADVQDNVLKNA  905

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  906  PHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  961



>ref|WP_027846740.1| glycine dehydrogenase [Mastigocoleus testarum]
Length=977

 Score =   257 bits (657),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AK+L++HYPV ++G NG VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  797  ATKVAILNANYIAKKLQEHYPVLYKGKNGLVAHECILDLRSLKKSAGIEIDDIAKRLMDY  856

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK E+DRFCD +I+IR+E+A+IE GK D  NNV KNA
Sbjct  857  GFHAPTVSWPVAGTIMVEPTESESKQEIDRFCDAMIAIRQEVAEIEAGKVDTENNVLKNA  916

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+  R+D  +GDRN +C+ LP+
Sbjct  917  PHTAESLIIGEWNHPYSREQAAYPAPWTKDNKFWPSVSRIDAAFGDRNFVCSCLPM  972



>ref|WP_015130859.1| glycine dehydrogenase [Calothrix sp. PCC 7507]
 gb|AFY35062.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 7507]
Length=980

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +D+AKRL+DY
Sbjct  800  ATKVAILNANYIAKRLESYYPVLYKGKNGLVAHECILDLRSLKKSASIEIDDIAKRLIDY  859

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD LI+IR+EIA+IE GK DI +N+ KN+
Sbjct  860  GFHAPTVSWPVAGTIMVEPTESESKAELDRFCDALIAIRQEIAEIESGKVDIQDNLLKNS  919

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + L+   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  920  PHTAASLITGDWQHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  975



>ref|WP_020769690.1| glycine dehydrogenase [Leptospira sp. B5-022]
 gb|EMJ99913.1| glycine dehydrogenase [Leptospira sp. B5-022]
Length=962

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+AKRLE ++PV ++G NG VAHE I+D+R FK T+G+E ED+AKRLMDY
Sbjct  783  ATKAAILNANYIAKRLENYFPVLYKGKNGFVAHECILDVRPFKKTSGVEVEDIAKRLMDY  842

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +ISI  EI +IE+GK D+ +N  KNA
Sbjct  843  GFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMISIHAEIQEIEQGKADLKDNPLKNA  902

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
            PH  +++++D W   YSRE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ LP
Sbjct  903  PHTSAMVISDNWNHAYSREQAAYPAPWTKEHKFWPYVGRIDNVYGDRNLVCSCLP  957



>gb|AFZ32122.1| Glycine dehydrogenase (decarboxylating) [Gloeocapsa sp. PCC 7428]
Length=979

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL  +YPV +RG +G VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  799  ATKVAILNANYIAHRLAPYYPVLYRGKSGLVAHECILDLRFLKKSAGIEVDDIAKRLMDY  858

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFC+ +I IR+EIA+IE GK D+++NV KNA
Sbjct  859  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCEAMIQIRQEIAEIEAGKVDMHDNVLKNA  918

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L++  W  PYSRE AA+P  W +  KFW T GR+DN YGDRN +C+ LP+    
Sbjct  919  PHTADALISSDWQHPYSREQAAYPTSWTREHKFWTTVGRIDNAYGDRNFVCSCLPMEAYS  978

Query  191  E  189
            E
Sbjct  979  E  979



>ref|XP_002503477.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
 gb|ACO64735.1| glycine cleavage system p-protein [Micromonas sp. RCC299]
Length=988

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            ASK AILNANYM KRLE H+P+ F G NGT AHEFIIDLR   +  GI  EDVAKRL DY
Sbjct  805  ASKRAILNANYMKKRLEDHFPILFTGKNGTCAHEFIIDLRPMTDKTGIGPEDVAKRLQDY  864

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PTMSWPV GTLMIEPTESESK ELDRFC+ +I+IREEI  IE G  D  NN  K+A
Sbjct  865  GYHAPTMSWPVSGTLMIEPTESESKQELDRFCNAMIAIREEIRDIENGAIDKENNPLKHA  924

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++++D W +PYSRE AAFPA+W++ +KFWPTT R+DNVYGDRNL+ T   V    
Sbjct  925  PHTAAVVLSDKWDRPYSRETAAFPAEWVRQSKFWPTTSRIDNVYGDRNLVTTHAQVEVAA  984

Query  191  ED  186
            E+
Sbjct  985  EE  986



>ref|WP_017319421.1| glycine dehydrogenase [Mastigocladopsis repens]
Length=981

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  803  ATKVAILNANYIAKKLEPYYPVLYKGKNGLVAHECILDLRSLKKSALIEIDDVAKRLMDY  862

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NV KNA
Sbjct  863  GFHAPTVSWPVSGTIMVEPTESESKEELDRFCDAMIAIRQEIAEIESGKMDAQDNVLKNA  922

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+DN YGDRN +C+ LP+
Sbjct  923  PHTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDNAYGDRNFVCSCLPM  978



>ref|WP_041919296.1| glycine dehydrogenase [Gloeocapsa sp. PCC 7428]
Length=969

 Score =   257 bits (656),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL  +YPV +RG +G VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  789  ATKVAILNANYIAHRLAPYYPVLYRGKSGLVAHECILDLRFLKKSAGIEVDDIAKRLMDY  848

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFC+ +I IR+EIA+IE GK D+++NV KNA
Sbjct  849  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCEAMIQIRQEIAEIEAGKVDMHDNVLKNA  908

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L++  W  PYSRE AA+P  W +  KFW T GR+DN YGDRN +C+ LP+    
Sbjct  909  PHTADALISSDWQHPYSREQAAYPTSWTREHKFWTTVGRIDNAYGDRNFVCSCLPMEAYS  968

Query  191  E  189
            E
Sbjct  969  E  969



>ref|WP_021263190.1| hypothetical protein [Pseudomonas aeruginosa]
 gb|EQL44233.1| hypothetical protein M770_29135 [Pseudomonas aeruginosa VRFPA03]
Length=210

 Score =   239 bits (609),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  30   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  89

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N  KNA
Sbjct  90   GFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDNPLKNA  149

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P+    
Sbjct  150  PHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYS  208

Query  191  ED  186
            E+
Sbjct  209  EE  210



>ref|WP_016550019.1| glycine dehydrogenase [Leptospira fainei]
 gb|EPG73540.1| glycine dehydrogenase [Leptospira fainei serovar Hurstbridge 
str. BUT 6]
Length=963

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G  G VAHE I+D+R FK T+GIE EDVAKRLMDY
Sbjct  782  ATKVAILNANYIAKRLENYYPVLYKGKQGFVAHECILDVRPFKKTSGIEVEDVAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +I  GK D  +N  KNA
Sbjct  842  GFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIADGKADPKDNPLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++++D+W   Y+RE AA+PA W K  KFWP  GR+DNVYGDRNL+C+ LP+   +
Sbjct  902  PHTAAMVISDSWKHAYTREKAAYPASWTKEHKFWPYVGRIDNVYGDRNLVCSCLPIEDYL  961

Query  191  ED  186
            E+
Sbjct  962  EN  963



>ref|WP_026795376.1| MULTISPECIES: glycine dehydrogenase [Planktothrix]
Length=958

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL+K+YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  779  ATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+I +EI+QIE G  D  NN+ KNA
Sbjct  839  GFHAPTVSWPVAGTMMVEPTESESKPELDRFCDAMIAIYQEISQIESGAMDATNNMLKNA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W +PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  899  PHTAISLLCGEWNRPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>ref|XP_009955956.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial 
[Leptosomus discolor]
Length=361

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/177 (64%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY + FRG  G VAHEFI+D R FK TA IE  D+AKRL DY
Sbjct  170  ASEIAILNANYMAKRLEKHYKILFRGTRGYVAHEFILDTRPFKKTANIEVVDLAKRLQDY  229

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N  K +
Sbjct  230  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMS  289

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+
Sbjct  290  PHTLNCVTSSKWDRPYSRELAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPM  346



>ref|WP_027255179.1| glycine dehydrogenase [Planktothrix agardhii]
Length=958

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL+K+YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  779  ATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+ KNA
Sbjct  839  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  899  PHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>ref|WP_015163334.1| glycine dehydrogenase [Pseudanabaena sp. PCC 7367]
 gb|AFY68360.1| Glycine dehydrogenase (decarboxylating) [Pseudanabaena sp. PCC 
7367]
Length=1028

 Score =   257 bits (656),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A++ AILNANY+A RL+ HYPV +RG NG VAHE IIDLR  K +A IE +D+AKRLMDY
Sbjct  848   ATEAAILNANYIAHRLQPHYPVLYRGKNGLVAHECIIDLRQLKTSAAIEVDDIAKRLMDY  907

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+IREEI  IE G  D  +N  KNA
Sbjct  908   GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIREEIRAIEAGTMDRTDNPLKNA  967

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
             PH    LMA  W  PYSR  AA+PA WLK  KFWP  GR+DN +GDRN +C+ LP+    
Sbjct  968   PHTAESLMATEWQHPYSRAQAAYPAAWLKEHKFWPVVGRIDNAFGDRNFVCSCLPLEAYA  1027

Query  191   E  189
             E
Sbjct  1028  E  1028



>gb|AFZ12851.1| Glycine dehydrogenase (decarboxylating) [Crinalium epipsammum 
PCC 9333]
Length=1015

 Score =   256 bits (655),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A+++AILNANY+AKRLE +YPV ++G NG VAHE I+DLR FK TA IE +D+AKRL+DY
Sbjct  835   ATEVAILNANYIAKRLEAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIAKRLIDY  894

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PT+SWPVPGT+M+EPTESESK ELDRFCD +I+IREEIA+IE GK +  NNV KNA
Sbjct  895   GFHPPTVSWPVPGTIMVEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKNNVLKNA  954

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
             PH  + L A  W +PYSRE A +P   ++  KFWP  GR+D  YGDRNL+C+ LP+
Sbjct  955   PHTAADLTASEWNRPYSREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCLPM  1010



>ref|WP_026796741.1| glycine dehydrogenase [Planktothrix prolifica]
Length=958

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL+K+YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  779  ATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+ KNA
Sbjct  839  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  899  PHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>ref|WP_043938103.1| glycine dehydrogenase [Planktothrix rubescens]
Length=961

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL+K+YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  782  ATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+ KNA
Sbjct  842  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  902  PHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  957



>ref|WP_041226533.1| glycine dehydrogenase [Crinalium epipsammum]
Length=969

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE +YPV ++G NG VAHE I+DLR FK TA IE +D+AKRL+DY
Sbjct  789  ATEVAILNANYIAKRLEAYYPVLYQGKNGLVAHECILDLRQFKKTAEIEVDDIAKRLIDY  848

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGT+M+EPTESESK ELDRFCD +I+IREEIA+IE GK +  NNV KNA
Sbjct  849  GFHPPTVSWPVPGTIMVEPTESESKQELDRFCDAMIAIREEIAEIESGKVERKNNVLKNA  908

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + L A  W +PYSRE A +P   ++  KFWP  GR+D  YGDRNL+C+ LP+
Sbjct  909  PHTAADLTASEWNRPYSREQAVYPVNGVREHKFWPAVGRIDQAYGDRNLVCSCLPM  964



>ref|WP_042157536.1| glycine dehydrogenase [Planktothrix agardhii]
 gb|KEI67393.1| GcvP [Planktothrix agardhii NIVA-CYA 126/8]
Length=961

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL+K+YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  782  ATKLAILNANYIASRLDKYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+I +EI+QIE G  D  NN+ KNA
Sbjct  842  GFHAPTVSWPVAGTMMVEPTESESKPELDRFCDAMIAIYQEISQIESGAMDATNNMLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W +PYSRE AA+PA W K  KFWP+ GR+DN +GDRN +C+ LP+
Sbjct  902  PHTAISLLCGEWNRPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFVCSCLPM  957



>gb|AID49398.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49399.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49401.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49402.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49403.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49404.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49405.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49406.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
 gb|AID49407.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
Length=123

 Score =   235 bits (600),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  629  FIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDT  450
            FI+DLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD 
Sbjct  1    FIVDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDA  60

Query  449  LISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFW  270
            LISIREEIAQIEKGK D +NNV K APHPPSLLMAD WT+PYSREYAAFPA WL++AKFW
Sbjct  61   LISIREEIAQIEKGKVDTHNNVLKGAPHPPSLLMADKWTQPYSREYAAFPASWLRSAKFW  120

Query  269  PTT  261
            P+T
Sbjct  121  PST  123



>ref|WP_043507924.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=238

 Score =   239 bits (610),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  58   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  117

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N  KNA
Sbjct  118  GFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDNPLKNA  177

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  PV    
Sbjct  178  PHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPVEAYS  236

Query  191  ED  186
            E+
Sbjct  237  EE  238



>ref|WP_026721410.1| glycine dehydrogenase [Fischerella sp. PCC 9431]
Length=971

 Score =   256 bits (653),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  792  ATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKRLMDY  851

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +ISIR E+A+IE GK D+ +NV KNA
Sbjct  852  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMISIRREVAEIEAGKADLQDNVLKNA  911

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  912  PHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPI  967



>ref|WP_026103942.1| glycine dehydrogenase [Anabaena sp. PCC 7108]
Length=974

 Score =   256 bits (653),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANY+AK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  795  ATKIAILNANYIAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDY  854

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE GK DI++N+ KNA
Sbjct  855  GFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGKMDIHDNLLKNA  914

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  915  PHTAESLIVGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  970



>gb|AID49400.1| mitochondrial glycine dehydrogenase, partial [Panax ginseng]
Length=123

 Score =   235 bits (599),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = -2

Query  629  FIIDLRGFKNTAGIEAEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDT  450
            FI+DLRGFKNTAGIE EDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCD 
Sbjct  1    FIVDLRGFKNTAGIEPEDVAKRLMDYGFHGPTMSWPVPGTLMIEPTESESKAELDRFCDA  60

Query  449  LISIREEIAQIEKGKFDINNNVXKNAPHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFW  270
            LISIREEIAQIEKGK D +NNV K APHPPSLLMAD WT+PYSREYAAFPA WL++AKFW
Sbjct  61   LISIREEIAQIEKGKVDAHNNVLKGAPHPPSLLMADKWTQPYSREYAAFPASWLRSAKFW  120

Query  269  PTT  261
            P+T
Sbjct  121  PST  123



>ref|WP_015081132.1| glycine dehydrogenase [Anabaena sp. 90]
 gb|AFW95989.1| glycine dehydrogenase (decarboxylating) [Anabaena sp. 90]
Length=961

 Score =   256 bits (653),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANYMAK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  782  ATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE G  DI++N+ KNA
Sbjct  842  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDALIAIREEVAAIESGTMDIHDNLLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  902  PHTAESLIIGEWNHPYSREQAAYPALWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  957



>gb|KFF35033.1| hypothetical protein G039_0311865 [Pseudomonas aeruginosa VRFPA01]
Length=210

 Score =   238 bits (607),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  30   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  89

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESE KAELDRFCD +I IREEI  +E+G+ D ++N  KNA
Sbjct  90   GFHAPTMSFPVAGTLMIEPTESEPKAELDRFCDAMIRIREEIRAVERGELDKDDNPLKNA  149

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W+  YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P+    
Sbjct  150  PHTAAELLGE-WSHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYS  208

Query  191  ED  186
            E+
Sbjct  209  EE  210



>dbj|GAM17937.1| hypothetical protein SAMD00019534_011120, partial [Acytostelium 
subglobosum LB1]
Length=1024

 Score =   256 bits (654),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A+++AILNANYMA RL+ HY + + G +G VAHEFIIDLR FK T GIEAEDVAKRL DY
Sbjct  845   ATQVAILNANYMAARLKDHYKILYTGSHGLVAHEFIIDLRSFKETTGIEAEDVAKRLQDY  904

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFHGPTMSWPV  TLMIEPTESESK ELDR CD LISIR EIA+IE GK   +NN+  NA
Sbjct  905   GFHGPTMSWPVVNTLMIEPTESESKYELDRLCDALISIRGEIAEIESGKASRDNNLLVNA  964

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVS  201
             PH   ++ +D W +PY+RE AA+P+   + +KFWP+ GRVDNV+GDRNL+C   P+S
Sbjct  965   PHTEHVITSDKWDRPYTRERAAYPSVATRESKFWPSVGRVDNVFGDRNLVCACPPLS  1021



>ref|WP_012627655.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
 gb|ACL44578.1| glycine dehydrogenase [Cyanothece sp. PCC 7425]
Length=996

 Score =   256 bits (653),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 140/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++IAILNANY+AKRLE  YPV ++G NG VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  816  ATRIAILNANYIAKRLEPFYPVLYKGTNGWVAHECILDLRPLKKSAGIEVEDIAKRLMDY  875

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGT+MIEPTESESKAELDRFC+ +I+IR EIAQIE G  D  +N  K+A
Sbjct  876  GFHAPTVSWPVPGTIMIEPTESESKAELDRFCEAMIAIRAEIAQIETGASDPQDNPLKHA  935

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  +++ AD W   YSRE AA+PA W +  KFWP+  R+DN YGDR+L+CT LP+
Sbjct  936  PHTAAMVTADRWDHAYSREQAAYPAPWTQAFKFWPSVARIDNAYGDRHLVCTCLPM  991



>ref|WP_006972317.1| glycine dehydrogenase [Plesiocystis pacifica]
 gb|EDM78597.1| glycine dehydrogenase [Plesiocystis pacifica SIR-1]
Length=980

 Score =   255 bits (652),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMA RL +HYPV + G NG VAHEFIIDLR FK +AGIEAEDVAKRLMDY
Sbjct  797  ATQVAILNANYMAARLREHYPVLYSGANGRVAHEFIIDLRPFKQSAGIEAEDVAKRLMDY  856

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESES AELDRFC+ +I+IREEI Q+E G     +N   NA
Sbjct  857  GFHAPTMSFPVAGTLMIEPTESESMAELDRFCEAMIAIREEIRQVEDGALPREDNPLVNA  916

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    +  D WT+ Y RE AAFP  W++ +KFWP  GR+DN +GDRNL+CT  P+
Sbjct  917  PHTAEAVCGDEWTRAYPREQAAFPLSWVRESKFWPAVGRIDNAFGDRNLVCTCPPL  972



>ref|WP_019497275.1| glycine dehydrogenase [Calothrix sp. PCC 7103]
Length=959

 Score =   255 bits (652),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANY+AKRLE HYPV ++G NG VAHE I+DLR  K +A I+ +DVAKRLMDY
Sbjct  779  ATKIAILNANYIAKRLENHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            G+H PT+SWPV GT+M+EPTESESK ELDRFCD LISIR+EIA+IE GK DI +N+ KNA
Sbjct  839  GYHAPTVSWPVAGTIMVEPTESESKEELDRFCDALISIRQEIAEIESGKMDIQDNLLKNA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L+A  W  PY+RE AA+PA W +  KFW +  R+D  +GDRN +C+ LP+    
Sbjct  899  PHTAESLIAGDWKHPYTREQAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCLPMEAYS  958

Query  191  E  189
            E
Sbjct  959  E  959



>ref|WP_008590214.1| glycine dehydrogenase [Leptospira licerasiae]
 gb|EIE02495.1| glycine dehydrogenase [Leptospira licerasiae serovar Varillal 
str. VAR 010]
 gb|EJZ42800.1| glycine dehydrogenase [Leptospira licerasiae str. MMD4847]
Length=962

 Score =   255 bits (652),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+AKRLE ++PV ++G NG VAHE I+D+R FK T+G+E ED+AKRLMDY
Sbjct  783  ATKAAILNANYIAKRLENYFPVLYKGKNGFVAHECILDVRPFKKTSGVEVEDIAKRLMDY  842

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +ISI  EI +IE+GK D  +N  KNA
Sbjct  843  GFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMISIHSEIQEIEQGKADAKDNPLKNA  902

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLP  207
            PH  +++++D W   YSRE AA+P+ W K  KFWP  GR+DNVYGDRNL+C+ LP
Sbjct  903  PHTSAMVISDNWDHAYSREKAAYPSAWTKEHKFWPYVGRIDNVYGDRNLVCSCLP  957



>ref|WP_017309685.1| glycine dehydrogenase [Fischerella sp. PCC 9339]
Length=980

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  801  ATKVAILNANYIAKRLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKRLMDY  860

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +ISIR E+A+IE GK D+ +NV KNA
Sbjct  861  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCEAMISIRHEVAEIEAGKADLQDNVLKNA  920

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  921  PHTAESLIIGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  976



>ref|WP_002155590.1| glycine dehydrogenase-like protein [Leptospira interrogans]
 gb|EMO24999.1| glycine dehydrogenase-like protein [Leptospira interrogans serovar 
Bataviae str. HAI135]
Length=512

 Score =   247 bits (631),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 139/176 (79%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A++ +ILNANY+AKRLEK YPV ++G NG VAHE I+DLR FK +AGIE EDVAKRL+DY
Sbjct  333  ATRNSILNANYIAKRLEKVYPVLYKGKNGFVAHECILDLRPFKKSAGIEVEDVAKRLIDY  392

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES  ELDRFC+ ++ I +EI  ++ G  D  +N+ KN+
Sbjct  393  GFHAPTMSFPVPGTLMIEPTESESLEELDRFCEAMLLIFQEILDVQNGILDKTDNLLKNS  452

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  +++ +D W   YSRE AA+PA WLK  KFWP  GRVDNVYGDRNL+C+ LP+
Sbjct  453  PHTAAMVTSDRWDHLYSRERAAYPASWLKDHKFWPYVGRVDNVYGDRNLVCSCLPI  508



>ref|WP_010415806.1| glycine dehydrogenase [Leptospira inadai]
 gb|EQA34745.1| glycine dehydrogenase [Leptospira inadai serovar Lyme str. 10]
Length=963

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+AKRLE +YPV ++G +G VAHE I+D+R FK T+GIE EDVAKRLMDY
Sbjct  782  ATKAAILNANYVAKRLENYYPVLYKGKHGFVAHECILDVRPFKKTSGIEVEDVAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +IE GK D  +N  KNA
Sbjct  842  GFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIEDGKADPKDNPLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++ +D+W   Y+RE AA+P  W K  KFWP  GR+DNVYGDRNL+C+ LP+   +
Sbjct  902  PHTAAMVTSDSWRHAYTREKAAYPTNWTKEHKFWPYVGRIDNVYGDRNLVCSCLPIEDYL  961

Query  191  ED  186
            +D
Sbjct  962  QD  963



>ref|WP_019487125.1| glycine dehydrogenase [Kamptonema formosum]
Length=984

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RLE +YPV ++G  G VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  798  ATKVAILNANYIARRLESYYPVLYKGKAGLVAHECILDLRSLKKSAGIEVEDIAKRLMDY  857

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EI +IE GK D  NN+ KNA
Sbjct  858  GFHAPTVSWPVAGTVMVEPTESESKEELDRFCEAMIAIRKEIEEIENGKMDATNNLLKNA  917

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    LM   W  PYSRE AA+PA W +  KFWP  GR+DN +GDRN +C+ LP+
Sbjct  918  PHTAESLMVSEWNHPYSREAAAYPAPWTREYKFWPAVGRIDNAFGDRNFVCSCLPM  973



>ref|WP_020531529.1| glycine dehydrogenase [Flexithrix dorotheae]
Length=966

 Score =   255 bits (652),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 139/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANYM  RLE HYPV F G NG VAHE IID R FK   GIE ED+AKRLMDY
Sbjct  784  ATKHAILNANYMKSRLESHYPVLFTGKNGRVAHEMIIDCRAFK-AFGIEVEDIAKRLMDY  842

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PV GTLMIEPTESE+K+ELDRFCD +I+IREE+ ++E G  D   NV KNA
Sbjct  843  GFHAPTVSFPVAGTLMIEPTESETKSELDRFCDAMIAIREEVNEVENGTADKLENVLKNA  902

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++M+D W KPYSRE AAFP  +L   KFWP+  R+DN +GDRNLIC+ LPV   +
Sbjct  903  PHTANMVMSDNWEKPYSREKAAFPLPYLSQNKFWPSVRRIDNAFGDRNLICSCLPVEDFI  962

Query  191  ED  186
            E+
Sbjct  963  EE  964



>ref|WP_042991755.1| hypothetical protein [Bordetella holmesii]
Length=225

 Score =   238 bits (607),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+A RL +HYPV + G +G VAHE I+D+R  K+++G+ AED+AKRLMDY
Sbjct  46   ATEVAILNANYVATRLREHYPVLYAGRHGRVAHECILDVRPLKDSSGVSAEDIAKRLMDY  105

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLM+EPTESE  AEL+RF D +++IR EIAQIE+G+ D  +NV KNA
Sbjct  106  GFHAPTMSFPVAGTLMVEPTESEGLAELERFIDAMVAIRTEIAQIERGERDREDNVLKNA  165

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH   +L+AD W   Y R+ AA+P   L+ AK+WP   RVDN YGDRNL+C  LP+
Sbjct  166  PHTAQMLLADEWHHDYPRQQAAYPVATLREAKYWPPVARVDNAYGDRNLVCACLPI  221



>ref|WP_024124666.1| glycine dehydrogenase [decarboxylating] GcvP [Thermosynechococcus 
sp. NK55a]
 gb|AHB88264.1| glycine dehydrogenase [decarboxylating] GcvP [Thermosynechococcus 
sp. NK55a]
Length=957

 Score =   255 bits (651),  Expect = 9e-75, Method: Composition-based stats.
 Identities = 111/172 (65%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+ IAILNANY+AKRLE +YP+ ++G +G VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  776  ATAIAILNANYIAKRLEPYYPILYKGAHGLVAHECILDLRPLKKSAGIEVEDIAKRLMDY  835

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGTLMIEPTESE+KAELDRFC+ +I+IR EIA+IE G  D   N  KNA
Sbjct  836  GFHAPTVSWPVPGTLMIEPTESETKAELDRFCEAMIAIRAEIAEIEAGVSDRQQNPLKNA  895

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PHP  +L  + W  PYSR+ AA+PA WL+  KFWP   R+DN YGDR+L+C+
Sbjct  896  PHPALMLATEPWPYPYSRQAAAYPAPWLREYKFWPAVARIDNAYGDRHLVCS  947



>ref|WP_031770429.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=250

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  70   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  129

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N  KNA
Sbjct  130  GFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDNPLKNA  189

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P+    
Sbjct  190  PHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYS  248

Query  191  ED  186
            E+
Sbjct  249  EE  250



>ref|WP_033886039.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=250

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  70   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  129

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E+G+ D  +N  KNA
Sbjct  130  GFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVERGELDKEDNPLKNA  189

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P+    
Sbjct  190  PHTAAELLGE-WNHTYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYS  248

Query  191  ED  186
            E+
Sbjct  249  EE  250



>ref|WP_021833182.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii]
 emb|CCQ56428.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0005]
 emb|CCQ70812.1| Glycine dehydrogenase [decarboxylating] (glycine cleavage system 
P protein) [Crocosphaera watsonii WH 0402]
Length=196

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMA RL  +YP+ F+G +G VAHE IIDLR  KN A +  +D+AKRLMD+
Sbjct  15   ATKVAILNANYMASRLADYYPILFKGASGCVAHECIIDLRPLKNQAEVGVDDIAKRLMDF  74

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESE  AELDRFCD +I+I +E   I  G  D  NN  KNA
Sbjct  75   GFHAPTVSWPVGGTMMVEPTESEDLAELDRFCDAMITIHQEAQAIADGTIDPANNPLKNA  134

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   +++   W +PYSRE AA+PA W K  KFWPT GR+DN YGDRNL+C+   +    
Sbjct  135  PHTAEMVICQEWDRPYSREKAAYPASWSKEHKFWPTVGRIDNAYGDRNLVCSCEGMDAYK  194

Query  191  ED  186
            ED
Sbjct  195  ED  196



>ref|WP_011584413.1| glycine dehydrogenase [Cytophaga hutchinsonii]
 gb|ABG58298.1| glycine dehydrogenase (decarboxylating) alpha subunit / glycine 
dehydrogenase (decarboxylating) beta subunit [Cytophaga hutchinsonii 
ATCC 33406]
Length=966

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 140/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+  RLEK YP+ + G +G  AHEFI+D R FK T GIE ED+AKRLMDY
Sbjct  781  ATKNAILNANYIKSRLEKFYPILYTGTHGHCAHEFILDCRAFKTTIGIEVEDIAKRLMDY  840

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PV GTLMIEPTESESK ELDRFCD +I+IR EIA+IE G  D  +NV K+A
Sbjct  841  GFHAPTVSFPVAGTLMIEPTESESKHELDRFCDAMIAIRAEIAEIENGTADKLDNVLKHA  900

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  S++ ADAWT+ YSR+ AA+P  +LKT KFWP+  R+D+ YGDRNL C+ +P  +  
Sbjct  901  PHTASVITADAWTRSYSRQKAAYPLPYLKTTKFWPSVSRIDSAYGDRNLFCSCIPTEEFA  960

Query  191  EDE  183
            E E
Sbjct  961  EAE  963



>ref|XP_009699383.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Cariama cristata]
Length=451

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 139/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS+IAILNANYMAKRLEKHY + FRG  G VAHEFI+D R FK TA IEA D+AKRL DY
Sbjct  260  ASEIAILNANYMAKRLEKHYKILFRGARGYVAHEFILDTRPFKKTANIEAVDLAKRLQDY  319

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA+IE+G+ D   N  K +
Sbjct  320  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIAEIEEGRMDPQINPLKMS  379

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+
Sbjct  380  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPM  436



>gb|KGB84088.1| glycine dehydrogenase, partial [Pseudomonas aeruginosa]
Length=223

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANY+A RLE+HYPV + G NG VAHE I+DLR  K+++GI  +DVAKRLMD+
Sbjct  43   ASEMAILNANYIAHRLEEHYPVLYAGGNGLVAHECILDLRPLKDSSGISVDDVAKRLMDF  102

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLMIEPTESESKAELDRFCD +I IREEI  +E G+ D  +N  KNA
Sbjct  103  GFHAPTMSFPVAGTLMIEPTESESKAELDRFCDAMIRIREEIRAVECGELDKEDNPLKNA  162

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  + L+ + W   YSRE AA+P   L  AK+WP  GRVDNVYGDRNL C+  P+    
Sbjct  163  PHTAAELLGE-WNHAYSREQAAYPLASLVEAKYWPPVGRVDNVYGDRNLTCSCPPIEAYS  221

Query  191  ED  186
            E+
Sbjct  222  EE  223



>ref|WP_026763335.1| glycine dehydrogenase [Sediminibacterium salmoneum]
Length=957

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            +++ AILNANYM  RLEK+YP+ + G NGT AHEFI+DLR FK +AG+EAED+AKRL+DY
Sbjct  774  STEYAILNANYMKARLEKYYPILYTGKNGTCAHEFIVDLRPFKQSAGVEAEDIAKRLIDY  833

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GT+MIEPTESE KAELDRFCD LI+I  EI  IE GK D  NN  KNA
Sbjct  834  GFHAPTMSFPVAGTIMIEPTESEDKAELDRFCDALIAIHGEIKDIENGKADKANNPLKNA  893

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH  +++ AD WT+PY+R+ AAFP  ++   KFWP+  RV+N +GDRNLICT  PVS   
Sbjct  894  PHTQAVVCADEWTRPYTRQEAAFPLYYVTLNKFWPSVARVNNTHGDRNLICTCEPVSSYA  953

Query  191  ED  186
            E+
Sbjct  954  EE  955



>ref|WP_011057442.1| glycine dehydrogenase [Thermosynechococcus elongatus]
 ref|NP_682393.1| glycine dehydrogenase [Thermosynechococcus elongatus BP-1]
 sp|Q8DII3.1|GCSP_THEEB RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC09155.1| glycine cleavage system protein P [Thermosynechococcus elongatus 
BP-1]
Length=954

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+ IAILNANY+AKRLE +YPV ++G +G VAHE I+DLR  K +AGIE ED+AKRLMDY
Sbjct  776  ATAIAILNANYIAKRLEPYYPVLYKGAHGLVAHECILDLRPLKKSAGIEVEDIAKRLMDY  835

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGTLMIEPTESE+KAELDRFC+ +I+IR EIA+IE G  D   N  KNA
Sbjct  836  GFHAPTVSWPVPGTLMIEPTESETKAELDRFCEAMIAIRSEIAEIEAGVSDRQQNPLKNA  895

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PHP  +L  + W  PYSRE AA+PA WL+  KFWP   R+DN YGDR+L+CT
Sbjct  896  PHPALMLATEPWPYPYSREVAAYPAPWLREYKFWPAVARIDNAYGDRHLVCT  947



>ref|WP_015182831.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
 gb|AFZ18682.1| glycine dehydrogenase, decarboxylating [Microcoleus sp. PCC 7113]
Length=988

 Score =   255 bits (651),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/174 (63%), Positives = 139/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RLE +YPV ++G +G VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  807  ATKVAILNANYIARRLEAYYPVLYKGKSGLVAHECILDLRQLKKSAGIEVDDIAKRLMDY  866

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ +I+IR+EI +IE GK D  +NV KNA
Sbjct  867  GFHAPTVSWPVAGTMMVEPTESESKEELDRFCEAMIAIRKEIEEIETGKVDDQDNVLKNA  926

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLL  210
            PH    LM+  W  PYSRE AA+PA W +  KFWPT GR+DN +GDRNL+C+ +
Sbjct  927  PHTAEFLMSSEWIHPYSREQAAYPAPWTREHKFWPTVGRIDNAFGDRNLVCSCV  980



>ref|WP_041430269.1| glycine dehydrogenase [Synechococcus sp. PCC 7502]
Length=961

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE  YP+ ++G N  VAHE I+DLR  K++AGIE +D+AKRLMDY
Sbjct  781  ATEVAILNANYIAKRLESSYPILYKGENSLVAHECILDLRSLKSSAGIEVDDIAKRLMDY  840

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +ISIR EI++IE G  D  +N  KNA
Sbjct  841  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMISIRAEISKIESGAMDKLDNPLKNA  900

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L+ D WT PYSR  AA+PA W K  KFW T GR+DN +GDRN IC+  P+ +  
Sbjct  901  PHTAEFLLKDEWTHPYSRSQAAYPAPWTKVHKFWATVGRIDNAFGDRNFICSCQPMEEYS  960

Query  191  E  189
            E
Sbjct  961  E  961



>ref|WP_015198875.1| glycine dehydrogenase [Calothrix parietina]
 gb|AFZ02247.1| Glycine dehydrogenase (decarboxylating) [Calothrix sp. PCC 6303]
Length=961

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANY+AKRLE HYPV ++G NG VAHE I+DLR  K +A I+ +DVAKRLMDY
Sbjct  781  ATKIAILNANYIAKRLEGHYPVLYKGSNGYVAHECILDLRALKKSANIDIDDVAKRLMDY  840

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD LI+IR EIA IE GK DI +N+ KNA
Sbjct  841  GFHAPTVSWPVAGTIMVEPTESESKAELDRFCDALIAIRAEIALIEAGKMDIQDNLLKNA  900

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L++  WT PY+RE AA+PA W +  KFW +  R+D  +GDRN +C+ LP+    
Sbjct  901  PHTAESLISGEWTHPYTREEAAYPAPWTRDNKFWVSVSRIDAAFGDRNFVCSCLPMDAYS  960

Query  191  E  189
            E
Sbjct  961  E  961



>ref|WP_015171139.1| glycine dehydrogenase subunit alpha/beta [Geitlerinema sp. PCC 
7407]
 gb|AFY65572.1| glycine dehydrogenase (decarboxylating) beta subunit, glycine 
dehydrogenase (decarboxylating) alpha subunit [Geitlerinema 
sp. PCC 7407]
Length=973

 Score =   254 bits (650),  Expect = 2e-74, Method: Composition-based stats.
 Identities = 111/176 (63%), Positives = 135/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+ IAILNANY+A+RL  HYP+ +RG    +AHE I+DLRG K +AGIE EDVAKRLMDY
Sbjct  792  ATAIAILNANYIAQRLAPHYPILYRGETDRIAHECILDLRGLKKSAGIEVEDVAKRLMDY  851

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GTLM+EPTESESK ELDRFCD +I+IR+E+  I +G  D  NN  K+A
Sbjct  852  GFHAPTVSWPVAGTLMVEPTESESKEELDRFCDAMIAIRQEVEAIAQGTSDPQNNPLKHA  911

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH   +L++  W +PYSRE AA+PA WL+  KFWP   R+DN YGDRNLICT  P+
Sbjct  912  PHTAEVLISADWDRPYSREQAAYPAPWLREHKFWPAVSRIDNAYGDRNLICTCGPL  967



>ref|WP_012410110.1| glycine dehydrogenase [Nostoc punctiforme]
 sp|B2J427.1|GCSP_NOSP7 RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Nostoc punctiforme PCC 73102]
 gb|ACC82139.1| glycine dehydrogenase [Nostoc punctiforme PCC 73102]
Length=979

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  799  ATKVAILNANYIAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAAIEIDDVAKRLMDY  858

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA+IE GK D  +NV KNA
Sbjct  859  GFHAPTVSWPVGGTIMVEPTESESKQELDRFCDALIAIRQEIAEIEVGKVDAQDNVLKNA  918

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  919  PHTAESLITGEWQHPYSREQAAYPAPWTREYKFWPAVGRIDAAFGDRNFVCSCLPM  974



>gb|AFY75171.1| glycine dehydrogenase, decarboxylating [Synechococcus sp. PCC 
7502]
Length=964

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE  YP+ ++G N  VAHE I+DLR  K++AGIE +D+AKRLMDY
Sbjct  784  ATEVAILNANYIAKRLESSYPILYKGENSLVAHECILDLRSLKSSAGIEVDDIAKRLMDY  843

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +ISIR EI++IE G  D  +N  KNA
Sbjct  844  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMISIRAEISKIESGAMDKLDNPLKNA  903

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH    L+ D WT PYSR  AA+PA W K  KFW T GR+DN +GDRN IC+  P+ +  
Sbjct  904  PHTAEFLLKDEWTHPYSRSQAAYPAPWTKVHKFWATVGRIDNAFGDRNFICSCQPMEEYS  963

Query  191  E  189
            E
Sbjct  964  E  964



>ref|WP_015212883.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica]
 gb|AFZ56230.1| Glycine dehydrogenase (decarboxylating) [Anabaena cylindrica 
PCC 7122]
Length=963

 Score =   254 bits (650),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  784  ATKVAILNANYIAKRLESYYPVLYQGKNGLVAHECILDLRSLKKSAHIEIDDVAKRLMDY  843

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ LI+IREE+A IE GK DI +N+ KNA
Sbjct  844  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCNALIAIREEVAAIESGKMDIQDNLLKNA  903

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  904  PHTAESLIIGEWNHPYSREQAAYPAPWNKEYKFWPSVGRIDAAFGDRNFVCSCLPM  959



>ref|WP_033335677.1| glycine dehydrogenase [Scytonema hofmanni]
Length=983

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RLE +YPV ++G N  VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  805  ATKVAILNANYIARRLESYYPVLYKGKNNLVAHECILDLRSLKKSASIEIDDIAKRLMDY  864

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESES+ ELDRFCD LI+IR+EIA+IE GK DI +NV KNA
Sbjct  865  GFHAPTVSWPVAGTIMVEPTESESQEELDRFCDALIAIRQEIAEIESGKMDIQDNVLKNA  924

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  925  PHTAESLIVGEWKHPYSREQAAYPAPWTREHKFWPSVGRIDAAFGDRNFVCSCLPM  980



>ref|WP_039895601.1| glycine dehydrogenase, partial [Lyngbya sp. PCC 8106]
Length=950

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMA RL+  YP+ ++G NG +AHE I+DLRG K +A IE +D+AKRLMD+
Sbjct  769  ATKVAILNANYMAFRLKDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDF  828

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGT+M+EPTESESKAELDRFC+ +I+IR EI  IE G  D  NN  KNA
Sbjct  829  GFHAPTVSWPVPGTMMVEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTENNPLKNA  888

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+
Sbjct  889  PHTAESLIVGEWNHPYSREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCLPM  944



>ref|WP_032826728.1| glycine dehydrogenase, partial [Bordetella holmesii]
 gb|KAK76216.1| hypothetical protein L573_0389, partial [Bordetella holmseii 
H620]
Length=251

 Score =   238 bits (607),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+A RL +HYPV + G +G VAHE I+D+R  K+++G+ AED+AKRLMDY
Sbjct  72   ATEVAILNANYVATRLREHYPVLYAGRHGRVAHECILDVRPLKDSSGVSAEDIAKRLMDY  131

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PV GTLM+EPTESE  AEL+RF D +++IR EIAQIE+G+ D  +NV KNA
Sbjct  132  GFHAPTMSFPVAGTLMVEPTESEGLAELERFIDAMVAIRTEIAQIERGERDREDNVLKNA  191

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH   +L+AD W   Y R+ AA+P   L+ AK+WP   RVDN YGDRNL+C  LP+
Sbjct  192  PHTAQMLLADEWHHDYPRQQAAYPVATLREAKYWPPVARVDNAYGDRNLVCACLPI  247



>gb|EAW38056.1| glycine dehydrogenase [Lyngbya sp. PCC 8106]
Length=992

 Score =   254 bits (649),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMA RL+  YP+ ++G NG +AHE I+DLRG K +A IE +D+AKRLMD+
Sbjct  811  ATKVAILNANYMAFRLKDAYPILYKGKNGLIAHECILDLRGVKKSANIEVDDIAKRLMDF  870

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPVPGT+M+EPTESESKAELDRFC+ +I+IR EI  IE G  D  NN  KNA
Sbjct  871  GFHAPTVSWPVPGTMMVEPTESESKAELDRFCEAMIAIRREIGAIESGDIDTENNPLKNA  930

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA WL+  KFWP+ GR+DN YGDRN +C+ LP+
Sbjct  931  PHTAESLIVGEWNHPYSREQAAYPAPWLREHKFWPSVGRIDNAYGDRNFVCSCLPM  986



>gb|KIE11464.1| glycine dehydrogenase [Tolypothrix bouteillei VB521301]
Length=982

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RLE +YPV ++G N  VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  804  ATKVAILNANYIARRLEAYYPVLYKGKNNLVAHECILDLRSLKKSASIEIDDIAKRLMDY  863

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA+IE GK DI +NV KNA
Sbjct  864  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIRQEIAEIESGKMDIQDNVLKNA  923

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+A  W  PYSRE AA+PA W +  KFWP+  R+D  +GDRN +C+ LP+
Sbjct  924  PHTAESLIAGEWHHPYSREQAAYPAPWTREHKFWPSVSRIDAAFGDRNFVCSCLPM  979



>ref|WP_011319516.1| glycine dehydrogenase [Anabaena variabilis]
 sp|Q3M9G1.1|GCSP_ANAVT RecName: Full=Glycine dehydrogenase (decarboxylating); AltName: 
Full=Glycine cleavage system P-protein; AltName: Full=Glycine 
decarboxylase; AltName: Full=Glycine dehydrogenase (aminomethyl-transferring) 
[Anabaena variabilis ATCC 29413]
 gb|ABA22375.1| glycine dehydrogenase (decarboxylating) alpha subunit [Anabaena 
variabilis ATCC 29413]
Length=974

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +D+AKRL+DY
Sbjct  795  ATKVAILNANYIAKRLETYYPVLYKGQNGLVAHECILDLRALKKSANIEIDDIAKRLIDY  854

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESES+AELDRFCD LI+IR+EIA IE GK D +NN+ KNA
Sbjct  855  GFHAPTVSWPVTGTIMVEPTESESQAELDRFCDALIAIRQEIAAIEAGKMDTHNNLLKNA  914

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+P  W +  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  915  PHTIESLIVGEWLHPYSREQAAYPVSWTREYKFWPSVGRIDAAFGDRNFVCSCLPM  970



>ref|WP_039743276.1| glycine dehydrogenase [Hassallia byssoidea]
 gb|KIF35727.1| glycine dehydrogenase [Hassallia byssoidea VB512170]
Length=1019

 Score =   254 bits (649),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             A+K+AILNANY+AKRLEK+YPV ++G N  VAHE I+DLR  K +A I+ +D+AKRLMDY
Sbjct  840   ATKVAILNANYIAKRLEKYYPVLYKGKNALVAHECILDLRSLKKSANIDIDDIAKRLMDY  899

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NV KNA
Sbjct  900   GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRKEIAEIESGKMDAQDNVLKNA  959

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
             PH    L+   W  PYSRE AA+PA W +  KFW + GR+DN YGDRN +C+ LP+
Sbjct  960   PHTAESLITGEWHHPYSREQAAYPAPWTREHKFWMSVGRIDNAYGDRNFVCSCLPM  1015



>ref|WP_027250002.1| glycine dehydrogenase [Planktothrix agardhii]
Length=958

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A RL  +YP+ ++G  G VAHE I+DLRG K +AGIE +D+AKRLMDY
Sbjct  779  ATKLAILNANYIAHRLNNYYPILYKGNQGFVAHECILDLRGVKKSAGIEVDDIAKRLMDY  838

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESKAELDRFCD +I+I +EI++IE G  D  NN+ KNA
Sbjct  839  GFHAPTVSWPVAGTMMVEPTESESKAELDRFCDAMIAIYQEISEIESGAMDATNNMLKNA  898

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  KFWP+ GR+DN +GDRN IC+ LP+
Sbjct  899  PHTAISLLCGEWNHPYSREQAAYPAPWTKEHKFWPSVGRIDNAFGDRNFICSCLPM  954



>ref|WP_013193021.1| glycine dehydrogenase [Trichormus azollae]
 gb|ADI66011.1| glycine dehydrogenase ['Nostoc azollae' 0708]
Length=964

 Score =   254 bits (648),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANY+AKRLE +YP+ ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  785  ATKIAILNANYIAKRLELYYPILYQGKNGLVAHECILDLRSLKKSAHIEIDDVAKRLMDY  844

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IREE+A IE G+ DI +NV KNA
Sbjct  845  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIREEVATIESGEMDIQDNVLKNA  904

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W K  K WP+ GR+D  +GDRN +C+ LP+
Sbjct  905  PHTAESLIVGEWNHPYSREQAAYPAPWNKEYKLWPSVGRIDAAFGDRNFVCSCLPM  960



>ref|WP_009149788.1| glycine dehydrogenase [Moorea producens]
 gb|EGJ30430.1| glycine dehydrogenase (decarboxylating) alpha subunit [Moorea 
producens 3L]
Length=989

 Score =   253 bits (647),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 136/172 (79%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMAKRL+ +YPV ++G NG VAHE I+DLR  K +AGIE +D+AKRLMDY
Sbjct  810  ATKVAILNANYMAKRLDPYYPVLYKGNNGLVAHECIVDLRSLKKSAGIEVDDIAKRLMDY  869

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EI  IE G+ D  +N  KNA
Sbjct  870  GFHAPTVSWPVAGTMMVEPTESESKEELDRFCDAMIAIRQEIEAIESGQVDQTDNQLKNA  929

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PH    LM   W+ PY+RE AA+PA WL+  KFWP  GR+DN +GDRNL+C+
Sbjct  930  PHTAEALMVIEWSHPYTREEAAYPAPWLREHKFWPVVGRIDNAFGDRNLVCS  981



>ref|WP_028088591.1| glycine dehydrogenase [Dolichospermum circinale]
Length=956

 Score =   253 bits (646),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+KIAILNANYMAK+LE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  777  ATKIAILNANYMAKKLESYYPVLYQGKNGLVAHECILDLRSLKKSAQIEIDDVAKRLMDY  836

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFC+ LI+IR+EI++IE GK D+ +NV KNA
Sbjct  837  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCEALIAIRKEISEIESGKMDLQDNVLKNA  896

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W   YSRE AA+PA W K  KFWP+ GR+D  +GDRN +C+ LP+
Sbjct  897  PHTAESLIVGEWKHDYSREQAAYPASWSKEYKFWPSVGRIDAAFGDRNFVCSCLPM  952



>ref|WP_010571257.1| glycine dehydrogenase [Leptospira broomii]
 gb|EQA44571.1| glycine dehydrogenase [Leptospira broomii serovar Hurstbridge 
str. 5399]
Length=963

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 142/182 (78%), Gaps = 0/182 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K AILNANY+AKRLE +YPV ++G +G VAHE I+D+R FK T+GIE EDVAKRLMDY
Sbjct  782  ATKAAILNANYIAKRLENYYPVLYKGKHGFVAHECILDVRPFKKTSGIEVEDVAKRLMDY  841

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ ELDRFC+ +I I +EI +IE GK D  +N  KNA
Sbjct  842  GFHAPTMSFPVPGTLMIEPTESESQEELDRFCEAMILIHDEIKEIEGGKADPKDNPLKNA  901

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++ +D+W   Y+RE AA+P  W K  KFWP  GR+DNVYGDRNL+C+ LP+   +
Sbjct  902  PHTAQMVTSDSWKHAYTREKAAYPTNWTKEHKFWPYVGRIDNVYGDRNLVCSCLPIEDYL  961

Query  191  ED  186
            ++
Sbjct  962  QN  963



>ref|WP_022960455.1| glycine dehydrogenase [Spongiibacter tropicus]
Length=957

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANYMAKRL +HYPV + G  G VAHE IIDLR  K ++GI  EDVAKRLMDY
Sbjct  778  ATEVAILNANYMAKRLGEHYPVLYTGKMGRVAHECIIDLRPLKESSGISEEDVAKRLMDY  837

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESESKAELDRFCD +ISIR EIA++E G+   ++N   NA
Sbjct  838  GFHAPTMSFPVPGTLMIEPTESESKAELDRFCDAMISIRREIARVEAGQLPADDNPLVNA  897

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + ++ + WT+ YSRE AA+PA +LK AK+WPT  R+DNVYGDRNLIC+  PV
Sbjct  898  PHTQADVIGNDWTRAYSREEAAWPASYLKDAKYWPTVNRIDNVYGDRNLICSCPPV  953



>ref|WP_015119530.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
 gb|AFY55964.1| glycine dehydrogenase, decarboxylating [Rivularia sp. PCC 7116]
Length=961

 Score =   253 bits (646),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANYMAKRLEKHYPV + G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  781  ATKVAILNANYMAKRLEKHYPVLYAGKNGLVAHECILDLRSLKKSANIEIDDIAKRLMDY  840

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESES  ELDRFCD ++SIREE+AQIE GK D  +NV KNA
Sbjct  841  GFHAPTVSWPVAGTVMVEPTESESLEELDRFCDAMVSIREEVAQIEAGKVDAQDNVLKNA  900

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PH    L+   W  PY+RE AA+PA W +  KFW   GR+D  +GDRNLIC+
Sbjct  901  PHTAQSLIVGEWNHPYTREQAAYPAPWTREHKFWVAVGRIDAAFGDRNLICS  952



>ref|WP_026736448.1| glycine dehydrogenase [Fischerella sp. PCC 9605]
Length=973

 Score =   253 bits (646),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AKRLE +YPV ++G NG VAHE I+DLR  K +A IE +DVAKRLMDY
Sbjct  793  ATKVAILNANYIAKRLEGYYPVLYQGKNGLVAHECILDLRSLKKSASIEIDDVAKRLMDY  852

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD LI+IR+EIA IE GK D+ +NV KNA
Sbjct  853  GFHAPTVSWPVAGTIMVEPTESESKEELDRFCDALIAIRQEIAAIESGKADLQDNVLKNA  912

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            P+    L+   W  PYSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  913  PYTAESLIVGEWNHPYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  968



>ref|WP_019017579.1| glycine dehydrogenase [Halomonas lutea]
Length=964

 Score =   253 bits (645),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 141/172 (82%), Gaps = 0/172 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+++AILNANY+AKRLE+HYPV ++G+NGTVAHE I+D+R  K T+GI  ED+AKRLMDY
Sbjct  784  ATELAILNANYIAKRLEQHYPVLYKGINGTVAHECIVDIRPLKATSGISEEDIAKRLMDY  843

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMS+PVPGTLMIEPTESES+ E+DRFCD +I+IREEIA++E G++   +N   NA
Sbjct  844  GFHAPTMSFPVPGTLMIEPTESESRYEIDRFCDAMIAIREEIARVESGEWPAEDNPLVNA  903

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICT  216
            PH  + LM D+W +PY RE AAFP++  K AKFWP   RVDNV+GDR LIC+
Sbjct  904  PHTMADLMDDSWQRPYGREIAAFPSEATKAAKFWPAVNRVDNVHGDRQLICS  955



>ref|XP_007510359.1| glycine dehydrogenase [Bathycoccus prasinos]
 emb|CCO18704.1| glycine dehydrogenase [Bathycoccus prasinos]
Length=1040

 Score =   253 bits (646),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -2

Query  731   ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
             AS+ AILNANYMAKRLE HYPV F+G NGT AHEFI+D+R  K+TAG+E ED+AKRLMDY
Sbjct  860   ASERAILNANYMAKRLENHYPVLFKGKNGTCAHEFILDMRPLKDTAGVEVEDIAKRLMDY  919

Query  551   GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
             G+H PTMSWPV GTLMIEPTESESK ELDRFC+ +I+IR+EIA IE G  D  NN+   A
Sbjct  920   GYHSPTMSWPVSGTLMIEPTESESKQELDRFCNAMIAIRKEIADIESGAADKENNLLTRA  979

Query  371   PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQM  195
             PH  + + A  W +PYS++ A FPA W+  +KFWPT  RVDNVYGDRNL+ T   + ++
Sbjct  980   PHTAASI-AGEWDRPYSKQDAVFPADWVSQSKFWPTNARVDNVYGDRNLVTTHAAIEEV  1037



>ref|WP_016861897.1| glycine dehydrogenase [Fischerella muscicola]
Length=962

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AK LE HYP+ ++G NG VAHE I+DLR  K +A IE +D+AKRLMDY
Sbjct  783  ATKVAILNANYIAKCLEAHYPILYQGKNGYVAHECILDLRSLKKSASIEIDDIAKRLMDY  842

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +ISIR+EIA+IE GK D+ +NV KNA
Sbjct  843  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMISIRQEIAEIEAGKADLQDNVLKNA  902

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W   YSRE AA+PA W +  KFWP  GR+D  +GDRN +C+ LP+
Sbjct  903  PHTAESLIIGEWNHSYSREQAAYPAPWTREHKFWPAVGRIDAAFGDRNFVCSCLPM  958



>ref|WP_029637128.1| glycine dehydrogenase [[Scytonema hofmanni] UTEX B 1581]
Length=980

 Score =   252 bits (644),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 137/176 (78%), Gaps = 0/176 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+AK+LE+HYPV ++G N  VAHE I+DLR  K +A I+ +DVAKRLMDY
Sbjct  800  ATKVAILNANYIAKKLEQHYPVLYKGKNALVAHECILDLRSLKKSANIDIDDVAKRLMDY  859

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+SWPV GT+M+EPTESESK ELDRFCD +I+IR+EIA+IE GK D  +NV KNA
Sbjct  860  GFHAPTVSWPVAGTIMVEPTESESKQELDRFCDAMIAIRQEIAEIESGKADAQDNVLKNA  919

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH    L+   W  PYSRE AA+PA W +  KFW +  R+DN YGDRN +C+ LP+
Sbjct  920  PHTAENLITGEWNHPYSREQAAYPAPWTREYKFWVSVNRIDNAYGDRNFVCSCLPM  975



>ref|XP_008944450.1| PREDICTED: glycine dehydrogenase (decarboxylating), mitochondrial, 
partial [Merops nubicus]
Length=451

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 138/177 (78%), Gaps = 1/177 (1%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            AS++AILNANYMAKRLEKHY + F+G  G VAHEFI+D R FK TA IEA D+AKRL DY
Sbjct  260  ASEVAILNANYMAKRLEKHYKILFKGAKGYVAHEFILDTRPFKKTANIEAVDLAKRLQDY  319

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PTMSWPV GTLMIEPTESE KAELDRFCD +ISIR+EIA IE+G+ D   N  K +
Sbjct  320  GFHAPTMSWPVAGTLMIEPTESEDKAELDRFCDAMISIRQEIADIEEGRMDPQINPLKMS  379

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLK-TAKFWPTTGRVDNVYGDRNLICTLLPV  204
            PH  + + +  W +PYSRE AAFP  ++K  +KFWPT  R+D++YGD++L+CT  P+
Sbjct  380  PHTLNCVTSSKWDRPYSREVAAFPLPFVKPESKFWPTIARIDDIYGDQHLVCTCPPM  436



>ref|WP_015349077.1| glycine dehydrogenase [Myxococcus stipitatus]
 ref|YP_007360500.1| glycine dehydrogenase [Myxococcus stipitatus DSM 14675]
 gb|AGC44816.1| glycine dehydrogenase [Myxococcus stipitatus DSM 14675]
Length=968

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 143/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  731  ASKIAILNANYMAKRLEKHYPVXFRGVNGTVAHEFIIDLRGFKNTAGIEAEDVAKRLMDY  552
            A+K+AILNANY+A+RL+ HYPV +RG  G VAHE I+DLR  K T+G+E EDVAKRLMDY
Sbjct  780  ATKLAILNANYIAERLQPHYPVLYRGKRGRVAHECIVDLRPLKKTSGVEVEDVAKRLMDY  839

Query  551  GFHGPTMSWPVPGTLMIEPTESESKAELDRFCDTLISIREEIAQIEKGKFDINNNVXKNA  372
            GFH PT+S+PV GTLMIEPTESES+AELDRFCD +I+IR+EI ++E+G+   +NNV KNA
Sbjct  840  GFHAPTVSFPVAGTLMIEPTESESRAELDRFCDAMIAIRQEIREVEEGRMPKDNNVLKNA  899

Query  371  PHPPSLLMADAWTKPYSREYAAFPAQWLKTAKFWPTTGRVDNVYGDRNLICTLLPVSQMV  192
            PH   ++ A  W +PYSRE A FPA W++  KFWP+ GR++NV GDR L+C+  P+   +
Sbjct  900  PHTSRVISAPEWNRPYSREVAVFPAPWVRDNKFWPSVGRLNNVLGDRKLVCSCPPIEDYM  959

Query  191  EDE  183
              E
Sbjct  960  TPE  962



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485