BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031N09

Length=749
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004170962.1|  PREDICTED: chlorophyll a-b binding protein o...    444   7e-155   
ref|XP_004134608.1|  PREDICTED: chlorophyll a-b binding protein o...    444   8e-155   
ref|XP_004134603.1|  PREDICTED: chlorophyll a-b binding protein o...    444   8e-155   
ref|XP_009400578.1|  PREDICTED: chlorophyll a-b binding protein o...    443   1e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008456347.1|  PREDICTED: chlorophyll a-b binding protein o...    443   1e-154   Cucumis melo [Oriental melon]
ref|XP_004145734.1|  PREDICTED: chlorophyll a-b binding protein, ...    443   2e-154   Cucumis sativus [cucumbers]
ref|XP_008439658.1|  PREDICTED: chlorophyll a-b binding protein o...    442   3e-154   Cucumis melo [Oriental melon]
sp|P08221.1|CB21_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    441   3e-154   Cucumis sativus [cucumbers]
ref|XP_006467509.1|  PREDICTED: chlorophyll a-b binding protein 3...    442   4e-154   Citrus sinensis [apfelsine]
ref|XP_006449645.1|  hypothetical protein CICLE_v10016286mg             441   6e-154   
ref|XP_011085268.1|  PREDICTED: chlorophyll a-b binding protein 2...    441   6e-154   Sesamum indicum [beniseed]
ref|XP_011011531.1|  PREDICTED: chlorophyll a-b binding protein o...    441   6e-154   Populus euphratica
ref|XP_006449643.1|  hypothetical protein CICLE_v10016287mg             441   6e-154   Citrus clementina [clementine]
ref|XP_006449644.1|  hypothetical protein CICLE_v10016074mg             442   6e-154   
ref|XP_003548104.1|  PREDICTED: chlorophyll a-b binding protein 2...    441   7e-154   
gb|ABF70112.1|  chlorophyll A-B binding protein (CAB), putative         441   8e-154   Musa balbisiana [starchy banana]
ref|NP_001240146.1|  chlorophyll a-b binding protein 21, chloropl...    441   8e-154   Glycine max [soybeans]
ref|XP_009421488.1|  PREDICTED: chlorophyll a-b binding protein o...    441   1e-153   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011096521.1|  PREDICTED: chlorophyll a-b binding protein 2...    441   1e-153   Sesamum indicum [beniseed]
ref|XP_009395692.1|  PREDICTED: chlorophyll a-b binding protein o...    441   1e-153   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011045092.1|  PREDICTED: chlorophyll a-b binding protein o...    441   1e-153   Populus euphratica
ref|XP_008444193.1|  PREDICTED: chlorophyll a-b binding protein o...    441   1e-153   Cucumis melo [Oriental melon]
ref|NP_001266111.1|  chlorophyll a-b binding protein AB80, chloro...    441   1e-153   Cicer arietinum [garbanzo]
ref|XP_008784387.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Phoenix dactylifera
ref|XP_011096520.1|  PREDICTED: chlorophyll a-b binding protein 2...    440   2e-153   Sesamum indicum [beniseed]
ref|XP_010056879.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Eucalyptus grandis [rose gum]
ref|XP_008439659.1|  PREDICTED: chlorophyll a-b binding protein o...    443   2e-153   
ref|XP_009389379.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241277.1|  uncharacterized protein LOC100805310               440   2e-153   Glycine max [soybeans]
ref|XP_002306927.1|  Chlorophyll a-b binding protein 2                  440   2e-153   Populus trichocarpa [western balsam poplar]
ref|XP_011045093.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Populus euphratica
ref|XP_010924306.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Elaeis guineensis
ref|XP_009396492.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010916097.1|  PREDICTED: chlorophyll a-b binding protein o...    440   2e-153   Elaeis guineensis
ref|XP_003548106.1|  PREDICTED: chlorophyll a/b-binding protein p...    440   3e-153   
gb|KDP37945.1|  hypothetical protein JCGZ_04588                         439   3e-153   Jatropha curcas
ref|XP_010904844.1|  PREDICTED: chlorophyll a-b binding protein o...    439   3e-153   Elaeis guineensis
ref|XP_002316737.1|  Chlorophyll a-b binding protein 2                  439   3e-153   Populus trichocarpa [western balsam poplar]
gb|KHN28981.1|  Chlorophyll a-b binding protein 3, chloroplastic        439   4e-153   Glycine soja [wild soybean]
ref|XP_007211864.1|  hypothetical protein PRUPE_ppa010081mg             439   4e-153   Prunus persica
ref|XP_002302798.2|  hypothetical protein POPTR_0002s19010g             439   4e-153   Populus trichocarpa [western balsam poplar]
sp|P12329.1|CB21_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    439   4e-153   Zea mays [maize]
ref|XP_004147416.1|  PREDICTED: chlorophyll a-b binding protein 4...    439   4e-153   Cucumis sativus [cucumbers]
ref|XP_002519724.1|  chlorophyll A/B binding protein, putative          439   4e-153   Ricinus communis
ref|XP_007211869.1|  hypothetical protein PRUPE_ppa010099mg             439   4e-153   Prunus persica
ref|XP_008800689.1|  PREDICTED: chlorophyll a-b binding protein o...    439   5e-153   Phoenix dactylifera
ref|XP_002515206.1|  chlorophyll A/B binding protein, putative          439   5e-153   Ricinus communis
gb|AFK40061.1|  unknown                                                 439   5e-153   Medicago truncatula
gb|AAC25775.1|  chlorophyll a/b binding protein                         439   6e-153   Medicago sativa [alfalfa]
ref|XP_010097596.1|  Chlorophyll a-b binding protein 40                 439   7e-153   Morus notabilis
gb|AHB24929.1|  chloroplast light-harvesting complex II chlorophy...    439   8e-153   Sedum alfredii
ref|XP_002307725.1|  Chlorophyll a-b binding protein 2                  438   8e-153   Populus trichocarpa [western balsam poplar]
ref|XP_010275593.1|  PREDICTED: chlorophyll a-b binding protein o...    439   9e-153   Nelumbo nucifera [Indian lotus]
gb|ACU23816.1|  unknown                                                 438   9e-153   Glycine max [soybeans]
gb|ABF17940.1|  putative chloroplast chlorophyll a/b-binding protein    438   9e-153   Carya cathayensis
gb|KHN41291.1|  Chlorophyll a-b binding protein of LHCII type I, ...    437   1e-152   Glycine soja [wild soybean]
ref|XP_004957570.1|  PREDICTED: chlorophyll a-b binding protein 1...    438   1e-152   Setaria italica
ref|XP_009416547.1|  PREDICTED: chlorophyll a-b binding protein o...    438   1e-152   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABW70800.1|  chloroplast light harvesting chlorophyll a/b bind...    438   1e-152   Populus euphratica
gb|AFW90512.1|  chlorophyll a/b-binding protein                         438   1e-152   Phaseolus vulgaris [French bean]
dbj|BAA24493.1|  chlorophyll a/b-binding protein                        438   1e-152   Fagus crenata
ref|XP_007158961.1|  hypothetical protein PHAVU_002G196400g             438   1e-152   Phaseolus vulgaris [French bean]
ref|XP_010926397.1|  PREDICTED: chlorophyll a-b binding protein o...    438   2e-152   Elaeis guineensis
ref|NP_001147639.1|  chlorophyll a-b binding protein 1, chloropla...    437   2e-152   
ref|XP_010052095.1|  PREDICTED: chlorophyll a-b binding protein o...    437   2e-152   Eucalyptus grandis [rose gum]
gb|ACN31249.1|  unknown                                                 436   2e-152   Zea mays [maize]
ref|XP_007158464.1|  hypothetical protein PHAVU_002G154500g             437   2e-152   Phaseolus vulgaris [French bean]
ref|XP_007221496.1|  hypothetical protein PRUPE_ppa010066mg             437   2e-152   Prunus persica
ref|XP_004148579.1|  PREDICTED: chlorophyll a-b binding protein 3...    437   2e-152   Cucumis sativus [cucumbers]
gb|ABK20976.1|  unknown                                                 438   2e-152   Picea sitchensis
ref|XP_008229430.1|  PREDICTED: chlorophyll a-b binding protein o...    437   2e-152   Prunus mume [ume]
ref|XP_007215816.1|  hypothetical protein PRUPE_ppa010034mg             437   2e-152   Prunus persica
gb|ACR08639.1|  chloroplast chlorophyll A/B binding protein             437   2e-152   Mangifera indica
gb|AAR10886.1|  chlorophyll a/b binding protein                         437   2e-152   Trifolium pratense [peavine clover]
ref|XP_002283566.1|  PREDICTED: chlorophyll a-b binding protein o...    437   3e-152   Vitis vinifera
gb|KCW75953.1|  hypothetical protein EUGRSUZ_D00321                     438   3e-152   Eucalyptus grandis [rose gum]
ref|XP_008779641.1|  PREDICTED: chlorophyll a-b binding protein o...    437   3e-152   Phoenix dactylifera
ref|XP_010097597.1|  Chlorophyll a-b binding protein 40                 437   3e-152   Morus notabilis
ref|XP_002440263.1|  hypothetical protein SORBIDRAFT_09g028720          437   3e-152   Sorghum bicolor [broomcorn]
sp|P09756.1|CB23_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    437   3e-152   Glycine max [soybeans]
gb|AEQ67395.1|  chloroplast chlorophyll A/B binding protein             437   3e-152   Canarium album [Chinese white-olive]
ref|XP_008343203.1|  PREDICTED: chlorophyll a-b binding protein o...    439   3e-152   
gb|ACF84273.1|  unknown                                                 437   4e-152   Zea mays [maize]
ref|XP_008229429.1|  PREDICTED: chlorophyll a-b binding protein o...    437   4e-152   Prunus mume [ume]
ref|XP_007217260.1|  hypothetical protein PRUPE_ppa010015mg             437   4e-152   Prunus persica
gb|ACU23974.1|  unknown                                                 437   4e-152   Glycine max [soybeans]
ref|XP_004961193.1|  PREDICTED: chlorophyll a-b binding protein M...    437   4e-152   Setaria italica
gb|AAF26741.1|AF220527_1  chlorophyll a/b binding protein precursor     437   4e-152   Euphorbia esula [wolf's milk]
ref|XP_009782905.1|  PREDICTED: chlorophyll a-b binding protein 7...    436   5e-152   Nicotiana sylvestris
ref|XP_009593856.1|  PREDICTED: chlorophyll a-b binding protein 4...    436   5e-152   Nicotiana tomentosiformis
ref|XP_006467511.1|  PREDICTED: chlorophyll a-b binding protein 3...    441   6e-152   
ref|XP_002460622.1|  hypothetical protein SORBIDRAFT_02g032040          436   6e-152   Sorghum bicolor [broomcorn]
ref|XP_004293579.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   Fragaria vesca subsp. vesca
ref|XP_010243713.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   Nelumbo nucifera [Indian lotus]
ref|XP_010052093.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   Eucalyptus grandis [rose gum]
gb|AAD21625.1|  putative chlorophyll a/b-binding protein                437   6e-152   Phalaenopsis hybrid cultivar
ref|XP_009772885.1|  PREDICTED: chlorophyll a-b binding protein 5...    436   6e-152   Nicotiana sylvestris
ref|XP_006856963.1|  hypothetical protein AMTR_s00189p00032350          436   6e-152   Amborella trichopoda
ref|XP_008364191.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   
ref|XP_008447450.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   Cucumis melo [Oriental melon]
ref|XP_008358195.1|  PREDICTED: chlorophyll a-b binding protein o...    436   6e-152   Malus domestica [apple tree]
ref|XP_008366007.1|  PREDICTED: chlorophyll a-b binding protein o...    436   7e-152   
gb|AAA60965.1|  light-harvesting chlorophyll a/b binding protein ...    436   7e-152   Ginkgo biloba [ginkgo]
ref|XP_008356026.1|  PREDICTED: chlorophyll a-b binding protein o...    436   7e-152   Malus domestica [apple tree]
gb|ACD64978.1|  chloroplast chlorophyll a/b-binding protein             436   8e-152   Ophiopogon japonicus
gb|AFC91647.1|  chloroplast chlorophyll A/B binding protein             436   8e-152   Hevea brasiliensis [jebe]
ref|XP_009782921.1|  PREDICTED: chlorophyll a-b binding protein 5...    436   9e-152   Nicotiana sylvestris
gb|ACN40194.1|  unknown                                                 436   9e-152   Picea sitchensis
ref|XP_009363087.1|  PREDICTED: chlorophyll a-b binding protein o...    436   9e-152   
gb|AEV59640.1|  chloroplast photosystem II light harvesting compl...    434   1e-151   Oxytropis campestris subsp. johannensis
ref|XP_004969083.1|  PREDICTED: chlorophyll a-b binding protein 2...    436   1e-151   Setaria italica
gb|AEV59639.1|  chloroplast photosystem II light harvesting compl...    434   1e-151   Oxytropis arctobia
gb|AAA80593.1|  chlorophyll a/b binding protein                         436   1e-151   Solanum tuberosum [potatoes]
ref|XP_009597417.1|  PREDICTED: chlorophyll a-b binding protein 5...    436   1e-151   Nicotiana tomentosiformis
gb|AEV59645.1|  chloroplast photosystem II light harvesting compl...    434   1e-151   Oxytropis lambertii
emb|CAA57409.1|  light harvesting chlorophyll a /b-binding protei...    436   1e-151   Picea abies
gb|KCW75954.1|  hypothetical protein EUGRSUZ_D00322                     439   1e-151   Eucalyptus grandis [rose gum]
ref|XP_002524616.1|  chlorophyll A/B binding protein, putative          435   1e-151   Ricinus communis
ref|XP_004303877.1|  PREDICTED: chlorophyll a-b binding protein o...    435   1e-151   Fragaria vesca subsp. vesca
ref|XP_009782924.1|  PREDICTED: chlorophyll a-b binding protein 5...    435   2e-151   Nicotiana sylvestris
ref|XP_006840304.1|  hypothetical protein AMTR_s00045p00069900          435   2e-151   
gb|AEO51755.1|  chloroplast chlorophyll A/B binding protein             435   2e-151   Dimocarpus longan [longan]
sp|P07369.1|CB2G_SOLLC  RecName: Full=Chlorophyll a-b binding pro...    435   2e-151   Solanum lycopersicum
gb|AGV54498.1|  LHCII type I chlorophyll a/b-binding protein            435   2e-151   Phaseolus vulgaris [French bean]
emb|CAA57408.1|  light harvesting chlorophyll a /b-binding protei...    436   2e-151   Picea abies
ref|XP_009775533.1|  PREDICTED: chlorophyll a-b binding protein 7...    435   2e-151   Nicotiana sylvestris
ref|XP_009628755.1|  PREDICTED: chlorophyll a-b binding protein 4...    435   2e-151   Nicotiana tomentosiformis
ref|XP_010247422.1|  PREDICTED: chlorophyll a-b binding protein o...    435   2e-151   Nelumbo nucifera [Indian lotus]
gb|AFI60242.1|  light harvesting chlorophyll a/b binding protein        435   2e-151   Panicum virgatum
ref|XP_007151996.1|  hypothetical protein PHAVU_004G093000g             435   2e-151   Phaseolus vulgaris [French bean]
ref|XP_006364025.1|  PREDICTED: chlorophyll a-b binding protein 5...    435   2e-151   Solanum tuberosum [potatoes]
ref|XP_007151979.1|  hypothetical protein PHAVU_004G091600g             435   2e-151   Phaseolus vulgaris [French bean]
ref|XP_008364187.1|  PREDICTED: chlorophyll a-b binding protein o...    435   2e-151   
ref|XP_009782923.1|  PREDICTED: chlorophyll a-b binding protein 5...    435   2e-151   Nicotiana sylvestris
ref|XP_008356022.1|  PREDICTED: chlorophyll a-b binding protein o...    435   2e-151   
gb|AHA84197.1|  chlorophyll a/b-binding protein                         434   2e-151   Phaseolus vulgaris [French bean]
ref|XP_009790934.1|  PREDICTED: chlorophyll a-b binding protein 4...    435   2e-151   Nicotiana sylvestris
ref|XP_003633024.1|  PREDICTED: chlorophyll a-b binding protein o...    434   3e-151   Vitis vinifera
ref|XP_009795316.1|  PREDICTED: chlorophyll a-b binding protein 4...    435   3e-151   Nicotiana sylvestris
ref|XP_009628757.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   Nicotiana tomentosiformis
ref|XP_009795314.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   Nicotiana sylvestris
ref|XP_002275075.1|  PREDICTED: chlorophyll a-b binding protein o...    434   3e-151   Vitis vinifera
emb|CAA47950.1|  chlorophyll a/b binding protein                        435   3e-151   Pinus contorta
ref|XP_006356077.1|  PREDICTED: chlorophyll a-b binding protein 3...    434   3e-151   Solanum tuberosum [potatoes]
ref|XP_006361530.1|  PREDICTED: chlorophyll a-b binding protein 3...    434   3e-151   Solanum tuberosum [potatoes]
ref|XP_006356078.1|  PREDICTED: chlorophyll a-b binding protein 3...    434   3e-151   
ref|XP_006368026.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   Solanum tuberosum [potatoes]
ref|XP_004303878.1|  PREDICTED: chlorophyll a-b binding protein o...    434   3e-151   Fragaria vesca subsp. vesca
emb|CAN78667.1|  hypothetical protein VITISV_031287                     434   3e-151   Vitis vinifera
ref|XP_006365560.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   Solanum tuberosum [potatoes]
ref|XP_008371581.1|  PREDICTED: chlorophyll a-b binding protein o...    434   3e-151   
ref|XP_006365572.1|  PREDICTED: chlorophyll a-b binding protein 1...    434   3e-151   Solanum tuberosum [potatoes]
gb|AIR93785.1|  chloroplast light harvesting chlorophyll A/B bind...    434   3e-151   Kalanchoe fedtschenkoi [lavender-scallops]
ref|XP_006356073.1|  PREDICTED: chlorophyll a-b binding protein 3...    434   4e-151   Solanum tuberosum [potatoes]
ref|XP_004294267.1|  PREDICTED: chlorophyll a-b binding protein o...    434   4e-151   Fragaria vesca subsp. vesca
gb|AGV54521.1|  LHCII type I chlorophyll a/b-binding protein            434   4e-151   Phaseolus vulgaris [French bean]
gb|AAZ79657.1|  putative chlorophyll a/b-binding protein                434   4e-151   Fagus sylvatica
gb|AAB61236.1|  chlorophyll a/b-binding protein                         434   4e-151   Mesembryanthemum crystallinum
ref|XP_009795315.1|  PREDICTED: chlorophyll a-b binding protein 4...    434   4e-151   Nicotiana sylvestris
gb|AHM26643.1|  a-b binding protein                                     434   4e-151   Pyrus x bretschneideri [bai li]
gb|AAA80591.1|  chlorophyll a/b binding protein                         434   4e-151   Solanum tuberosum [potatoes]
emb|CAC38830.1|  chlorophyll a/b binding protein                        434   4e-151   Pinus contorta
gb|AHA84168.1|  chlorophyll a/b-binding protein                         434   4e-151   Phaseolus vulgaris [French bean]
gb|AAF89206.1|AF279249_1  LHCII type I chlorophyll a/b-binding pr...    434   5e-151   Vigna radiata [mung bean]
ref|XP_009790936.1|  PREDICTED: chlorophyll a-b binding protein 4...    434   5e-151   Nicotiana sylvestris
ref|XP_011460161.1|  PREDICTED: chlorophyll a-b binding protein o...    434   5e-151   Fragaria vesca subsp. vesca
sp|P27490.1|CB28_PEA  RecName: Full=Chlorophyll a-b binding prote...    434   5e-151   Pisum sativum [garden pea]
ref|XP_009782821.1|  PREDICTED: chlorophyll a-b binding protein 7...    434   5e-151   Nicotiana sylvestris
ref|XP_008371583.1|  PREDICTED: chlorophyll a-b binding protein o...    435   5e-151   
sp|P27491.1|CB27_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    434   6e-151   Nicotiana tabacum [American tobacco]
ref|XP_006356074.1|  PREDICTED: chlorophyll a-b binding protein 3...    434   6e-151   Solanum tuberosum [potatoes]
ref|XP_009782922.1|  PREDICTED: chlorophyll a-b binding protein 5...    434   6e-151   Nicotiana sylvestris
gb|KJB66916.1|  hypothetical protein B456_010G165100                    434   6e-151   Gossypium raimondii
gb|KJB57287.1|  hypothetical protein B456_009G156900                    434   6e-151   Gossypium raimondii
gb|ABN49454.2|  chloroplast chlorophyll a/b binding protein             434   7e-151   Pisum sativum [garden pea]
ref|XP_009618329.1|  PREDICTED: chlorophyll a-b binding protein 4...    434   7e-151   Nicotiana tomentosiformis
ref|XP_009618330.1|  PREDICTED: chlorophyll a-b binding protein 4...    433   8e-151   Nicotiana tomentosiformis
ref|XP_007151990.1|  hypothetical protein PHAVU_004G092600g             433   9e-151   Phaseolus vulgaris [French bean]
emb|CDP06328.1|  unnamed protein product                                433   9e-151   Coffea canephora [robusta coffee]
gb|ACO51067.1|  chloroplast chlorophyll A-B binding protein             433   9e-151   Gossypium hirsutum [American cotton]
ref|XP_006368025.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   Solanum tuberosum [potatoes]
gb|AEY85026.1|  light-harvesting complex II protein                     433   1e-150   Cajanus cajan
ref|XP_007025143.1|  Chlorophyll a-b binding protein, chloroplastic     433   1e-150   
ref|NP_001235283.1|  chlorophyll a/b-binding protein                    433   1e-150   
ref|XP_009775645.1|  PREDICTED: chlorophyll a-b binding protein 2...    433   1e-150   Nicotiana sylvestris
gb|KJB69716.1|  hypothetical protein B456_011G041600                    433   1e-150   Gossypium raimondii
gb|ACL50948.1|  putative chloroplast chlorophyll a/b binding protein    432   1e-150   Solanum nigrum
ref|XP_009598577.1|  PREDICTED: chlorophyll a-b binding protein 2...    433   1e-150   Nicotiana tomentosiformis
gb|KCW75952.1|  hypothetical protein EUGRSUZ_D00320                     433   1e-150   Eucalyptus grandis [rose gum]
gb|AEV59643.1|  chloroplast photosystem II light harvesting compl...    432   1e-150   Oxytropis splendens
gb|AFW81158.1|  light harvesting chlorophyll a/b binding protein3       434   1e-150   
pdb|1VCR|A  Chain A, An Icosahedral Assembly Of Light-Harvesting ...    432   1e-150   Pisum sativum [garden pea]
sp|P27492.1|CB21_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    433   1e-150   Nicotiana tabacum [American tobacco]
ref|XP_009598575.1|  PREDICTED: chlorophyll a-b binding protein 2...    433   1e-150   Nicotiana tomentosiformis
gb|AAC78690.1|  chlorophyll a/b-binding protein                         433   1e-150   Pinus thunbergii [green pine]
ref|XP_006365573.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   
gb|ACF85694.1|  unknown                                                 433   1e-150   Zea mays [maize]
ref|XP_009628754.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   Nicotiana tomentosiformis
ref|XP_004233096.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   
sp|P07371.1|CB22_PEA  RecName: Full=Chlorophyll a-b binding prote...    433   1e-150   Pisum sativum [garden pea]
ref|XP_009759685.1|  PREDICTED: chlorophyll a-b binding protein 4...    433   1e-150   Nicotiana sylvestris
ref|XP_009630190.1|  PREDICTED: chlorophyll a-b binding protein 2...    433   1e-150   Nicotiana tomentosiformis
ref|XP_004233101.1|  PREDICTED: chlorophyll a-b binding protein 1...    433   1e-150   
dbj|BAA25389.1|  light harvesting chlorophyll a/b-binding protein       433   1e-150   Nicotiana sylvestris
ref|XP_002273106.2|  PREDICTED: chlorophyll a-b binding protein o...    432   2e-150   Vitis vinifera
gb|ABB55370.1|  chlorophyll a-b binding protein 3C-like                 432   2e-150   Solanum tuberosum [potatoes]
ref|XP_009775649.1|  PREDICTED: chlorophyll a-b binding protein 2...    432   2e-150   Nicotiana sylvestris
sp|P04782.1|CB24_PETSP  RecName: Full=Chlorophyll a-b binding pro...    432   2e-150   Petunia sp.
gb|AAF89207.1|AF279250_1  LHCII type I chlorophyll a/b-binding pr...    432   2e-150   Vigna radiata [mung bean]
gb|AES74698.2|  light-harvesting complex I chlorophyll A/B-bindin...    432   2e-150   Medicago truncatula
ref|XP_010317413.1|  PREDICTED: chlorophyll a-b binding protein 3...    432   2e-150   
ref|XP_006844081.1|  hypothetical protein AMTR_s00006p00251360          432   2e-150   Amborella trichopoda
gb|AFW90565.1|  chlorophyll a-b binding protein 3C-like mRNA            431   2e-150   Solanum tuberosum [potatoes]
emb|CDP06329.1|  unnamed protein product                                432   3e-150   Coffea canephora [robusta coffee]
sp|P27496.1|CB25_TOBAC  RecName: Full=Chlorophyll a-b binding pro...    432   3e-150   Nicotiana tabacum [American tobacco]
ref|XP_007025148.1|  Chlorophyll a-b binding protein, chloroplastic     432   3e-150   Theobroma cacao [chocolate]
ref|XP_009775650.1|  PREDICTED: chlorophyll a-b binding protein 2...    432   3e-150   Nicotiana sylvestris
gb|ABQ81856.1|  chloroplast chlorophyll a/b binding protein             432   3e-150   Phyllostachys edulis [kikko-chiku]
gb|AAW31511.1|  light-harvesting chlorophyll-a/b binding protein ...    432   3e-150   Pisum sativum [garden pea]
gb|AAA80594.1|  chlorophyll a/b binding protein                         432   3e-150   Solanum tuberosum [potatoes]
gb|AAA34148.1|  chlorophyll a/b-binding protein Cab-3C                  432   3e-150   Solanum lycopersicum
ref|XP_002455902.1|  hypothetical protein SORBIDRAFT_03g027040          432   3e-150   Sorghum bicolor [broomcorn]
sp|P15194.1|CB2B_PINSY  RecName: Full=Chlorophyll a-b binding pro...    432   3e-150   Pinus sylvestris [Scotch pine]
ref|XP_009606800.1|  PREDICTED: chlorophyll a-b binding protein 5...    432   3e-150   Nicotiana tomentosiformis
gb|ACN41907.1|  chlorophyll A/B binding protein                         432   3e-150   Gardenia jasminoides
ref|XP_006660556.1|  PREDICTED: chlorophyll a-b binding protein 2...    432   4e-150   Oryza brachyantha
gb|ABQ81857.1|  chloroplast chlorophyll a/b binding protein             432   4e-150   Phyllostachys edulis [kikko-chiku]
ref|XP_009786355.1|  PREDICTED: chlorophyll a-b binding protein 2...    432   4e-150   Nicotiana sylvestris
ref|XP_006365561.1|  PREDICTED: chlorophyll a-b binding protein 1...    432   4e-150   Solanum tuberosum [potatoes]
prf||1204205B  protein 1B,chlorophyll binding                           432   4e-150   Solanum lycopersicum
gb|AAA18529.1|  chlorophyll A/B binding protein                         432   4e-150   Gossypium hirsutum [American cotton]
sp|P12333.1|CB2A_SPIOL  RecName: Full=Chlorophyll a-b binding pro...    432   4e-150   Spinacia oleracea
sp|P04781.1|CB23_PETSP  RecName: Full=Chlorophyll a-b binding pro...    432   4e-150   Petunia sp.
sp|P04783.1|CB25_PETSP  RecName: Full=Chlorophyll a-b binding pro...    432   4e-150   Petunia sp.
ref|XP_010666512.1|  PREDICTED: chlorophyll a-b binding protein, ...    432   4e-150   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP37944.1|  hypothetical protein JCGZ_04587                         431   4e-150   Jatropha curcas
gb|AAA80592.1|  chlorophyll a/b binding protein                         432   4e-150   Solanum tuberosum [potatoes]
ref|NP_001105545.1|  chlorophyll a-b binding protein M9, chloropl...    432   4e-150   
gb|AAB61237.1|  chlorophyll a/b-binding protein                         432   4e-150   Mesembryanthemum crystallinum
ref|XP_009598574.1|  PREDICTED: chlorophyll a-b binding protein 2...    431   4e-150   Nicotiana tomentosiformis
ref|XP_010231410.1|  PREDICTED: chlorophyll a-b binding protein o...    431   4e-150   Brachypodium distachyon [annual false brome]
ref|XP_010316912.1|  PREDICTED: chlorophyll a-b binding protein 1...    431   5e-150   
ref|XP_006840305.1|  hypothetical protein AMTR_s00045p00070890          430   5e-150   Amborella trichopoda
ref|XP_009611577.1|  PREDICTED: chlorophyll a-b binding protein 4...    431   5e-150   Nicotiana tomentosiformis
ref|XP_010374558.1|  PREDICTED: chlorophyll a-b binding protein o...    430   5e-150   
gb|ABK22510.1|  unknown                                                 432   5e-150   Picea sitchensis
gb|EYU19613.1|  hypothetical protein MIMGU_mgv1a011885mg                431   6e-150   Erythranthe guttata [common monkey flower]
gb|AGJ50622.1|  chlorophyll a/b binding protein                         431   6e-150   Salicornia brachiata
ref|XP_006356080.1|  PREDICTED: chlorophyll a-b binding protein 3...    431   6e-150   Solanum tuberosum [potatoes]
ref|XP_006356075.1|  PREDICTED: chlorophyll a-b binding protein 3...    431   6e-150   Solanum tuberosum [potatoes]
gb|AEV59642.1|  chloroplast photosystem II light harvesting compl...    430   6e-150   Oxytropis maydelliana
prf||1503276A  chlorophyll a/b binding protein                          430   7e-150   Glycine max [soybeans]
ref|XP_009377327.1|  PREDICTED: chlorophyll a-b binding protein o...    431   7e-150   Pyrus x bretschneideri [bai li]
ref|XP_010316911.1|  PREDICTED: chlorophyll a-b binding protein 1...    431   7e-150   
ref|XP_006356076.1|  PREDICTED: chlorophyll a-b binding protein 3...    431   7e-150   
ref|XP_009606802.1|  PREDICTED: chlorophyll a-b binding protein 1...    431   8e-150   Nicotiana tomentosiformis
emb|CAX64458.1|  major chlorophyll a/b binding protein LHCb1.4 pr...    431   9e-150   Spinacia oleracea
sp|P15193.1|CB2A_PINSY  RecName: Full=Chlorophyll a-b binding pro...    431   1e-149   Pinus sylvestris [Scotch pine]
emb|CAJ77390.1|  major chlorophyll a/b binding protein LHCb1.2          431   1e-149   Spinacia oleracea
ref|XP_002455901.1|  hypothetical protein SORBIDRAFT_03g027030          431   1e-149   Sorghum bicolor [broomcorn]
gb|AAB61238.1|  chlorophyll a/b-binding protein                         430   2e-149   Mesembryanthemum crystallinum
gb|KEH25005.1|  light-harvesting complex I chlorophyll A/B-bindin...    430   2e-149   Medicago truncatula
gb|EMT29002.1|  Chlorophyll a-b binding protein, chloroplastic          430   2e-149   
gb|KEH25007.1|  light-harvesting complex I chlorophyll A/B-bindin...    430   2e-149   Medicago truncatula
ref|XP_010091411.1|  Chlorophyll a-b binding protein 16                 429   2e-149   
gb|EYU19649.1|  hypothetical protein MIMGU_mgv1a011927mg                430   2e-149   Erythranthe guttata [common monkey flower]
ref|XP_009377344.1|  PREDICTED: chlorophyll a-b binding protein o...    430   2e-149   Pyrus x bretschneideri [bai li]
emb|CDP06330.1|  unnamed protein product                                429   2e-149   Coffea canephora [robusta coffee]
ref|XP_010231015.1|  PREDICTED: chlorophyll a-b binding protein o...    429   3e-149   Brachypodium distachyon [annual false brome]
ref|NP_001043493.1|  Os01g0600900                                       429   3e-149   
dbj|BAJ93064.1|  predicted protein                                      429   3e-149   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001105427.1|  light harvesting chlorophyll a /b binding pr...    429   3e-149   
dbj|BAJ90643.1|  predicted protein                                      429   3e-149   Hordeum vulgare subsp. vulgare [two-rowed barley]
pdb|2BHW|A  Chain A, Pea Light-Harvesting Complex Ii At 2.5 Angst...    428   3e-149   Pisum sativum [garden pea]
ref|XP_010685893.1|  PREDICTED: chlorophyll a-b binding protein, ...    429   3e-149   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU28183.1|  hypothetical protein MIMGU_mgv1a012019mg                429   3e-149   Erythranthe guttata [common monkey flower]
gb|ACY66805.1|  chlorophyll a/b-binding protein                         430   3e-149   Pinus massoniana [Chinese red pine]
ref|XP_009377335.1|  PREDICTED: chlorophyll a-b binding protein o...    429   3e-149   Pyrus x bretschneideri [bai li]
sp|P12471.1|CB21_SOYBN  RecName: Full=Chlorophyll a-b binding pro...    428   4e-149   Glycine max [soybeans]
pdb|4LCZ|A  Chain A, Crystal Structure Of A Multilayer-packed Maj...    427   4e-149   
pdb|1RWT|A  Chain A, Crystal Structure Of Spinach Major Light-har...    428   4e-149   
sp|P12470.1|CB25_NICPL  RecName: Full=Chlorophyll a-b binding pro...    429   4e-149   
ref|NP_001062939.1|  Os09g0346500                                       429   5e-149   
gb|EYU28184.1|  hypothetical protein MIMGU_mgv1a011918mg                429   5e-149   
gb|AFV34722.1|  light harvesting chlorophyll a/b-binding protein 1-1    429   5e-149   
ref|XP_004302854.1|  PREDICTED: chlorophyll a-b binding protein o...    429   5e-149   
gb|EYU28185.1|  hypothetical protein MIMGU_mgv1a012021mg                429   5e-149   
ref|XP_003618482.1|  Chlorophyll a/b-binding protein                    429   5e-149   
gb|KEH25006.1|  light-harvesting complex I chlorophyll A/B-bindin...    429   6e-149   
prf||1615137B  chlorophyll a/b binding protein P27                      427   6e-149   
gb|AAB87573.1|  chlorophyll a/b binding protein of LHCII type I p...    429   6e-149   
sp|P24006.1|CB2A_PYRPY  RecName: Full=Chlorophyll a-b binding pro...    429   6e-149   
dbj|BAJ90772.1|  predicted protein                                      429   6e-149   
dbj|BAJ08392.1|  light harvesting chlorophyll a/b-binding protein...    429   6e-149   
sp|P08963.1|CB22_HORVU  RecName: Full=Chlorophyll a-b binding pro...    429   6e-149   
gb|ABM66819.1|  chloroplast light-harvesting chlorophyll a/b bind...    429   7e-149   
dbj|BAK02173.1|  predicted protein                                      429   7e-149   
gb|AAD27879.2|AF139467_1  LHCII type I chlorophyll a/b binding pr...    428   7e-149   
ref|NP_001142284.1|  uncharacterized protein LOC100274453               428   8e-149   
sp|P12469.1|CB23_NICPL  RecName: Full=Chlorophyll a-b binding pro...    428   8e-149   
ref|XP_004489391.1|  PREDICTED: chlorophyll a-b binding protein 3...    428   9e-149   
ref|XP_002285646.1|  PREDICTED: chlorophyll a-b binding protein o...    428   1e-148   
dbj|BAJ85110.1|  predicted protein                                      428   1e-148   
gb|EMS53958.1|  Chlorophyll a-b binding protein 3C, chloroplastic       428   1e-148   
ref|XP_003578592.1|  PREDICTED: chlorophyll a-b binding protein o...    428   1e-148   
gb|EYU28186.1|  hypothetical protein MIMGU_mgv1a012011mg                428   1e-148   
gb|ACN40044.1|  unknown                                                 428   1e-148   
ref|XP_010052094.1|  PREDICTED: chlorophyll a-b binding protein o...    433   1e-148   
gb|EYU28462.1|  hypothetical protein MIMGU_mgv1a012008mg                427   2e-148   
gb|AEV59641.1|  chloroplast photosystem II light harvesting compl...    426   2e-148   
gb|ABQ32304.1|  chloroplast light-harvesting chlorophyll a/b-bind...    427   2e-148   
gb|EYU29602.1|  hypothetical protein MIMGU_mgv1a019986mg                427   2e-148   
gb|EMT23952.1|  Chlorophyll a-b binding protein 1B, chloroplastic       427   2e-148   
gb|AAA33396.1|  light-harvesting chlorophyll a/b protein precursor      427   2e-148   
gb|EMS50797.1|  Chlorophyll a-b binding protein, chloroplastic          427   2e-148   
gb|EYU28187.1|  hypothetical protein MIMGU_mgv1a009948mg                430   2e-148   
gb|EPS64140.1|  chlorophyll a-b binding protein 21, chloroplastic       427   2e-148   
ref|NP_001044090.1|  Os01g0720500                                       427   2e-148   
gb|AAB18209.1|  chlorophyll a/b-binding protein WCAB precursor          427   2e-148   
gb|EYU35814.1|  hypothetical protein MIMGU_mgv1a011908mg                427   2e-148   
dbj|BAJ86427.1|  predicted protein                                      427   2e-148   
gb|AAH53854.1|  Unknown (protein for IMAGE:5194336)                     428   2e-148   
sp|P06671.1|CB22_MAIZE  RecName: Full=Chlorophyll a-b binding pro...    427   3e-148   
gb|ADL41158.1|  chloroplast light-harvesting chlorophyll a/b bind...    427   3e-148   
gb|EMS51039.1|  Chlorophyll a-b binding protein 3C, chloroplastic       427   3e-148   
gb|AFK39586.1|  unknown                                                 427   3e-148   
ref|NP_001148439.1|  chlorophyll a-b binding protein 2                  427   3e-148   
gb|EMS45686.1|  Chlorophyll a-b binding protein, chloroplastic          427   4e-148   
gb|EYU43278.1|  hypothetical protein MIMGU_mgv1a011933mg                427   4e-148   
gb|ABD38707.1|  chloroplast chlorophyll a/b binding protein             427   4e-148   
gb|EMT29003.1|  Chlorophyll a-b binding protein, chloroplastic          426   4e-148   
gb|EMS51257.1|  Chlorophyll a-b binding protein 1, chloroplastic        427   4e-148   
gb|EYU29604.1|  hypothetical protein MIMGU_mgv1a023200mg                426   4e-148   
dbj|BAJ87045.1|  predicted protein                                      426   5e-148   
dbj|BAK03973.1|  predicted protein                                      426   6e-148   
gb|EMS67016.1|  Chlorophyll a-b binding protein, chloroplastic          426   7e-148   
gb|EMS50796.1|  Chlorophyll a-b binding protein, chloroplastic          426   7e-148   
tpg|DAA58853.1|  TPA: hypothetical protein ZEAMMB73_924562              426   7e-148   
gb|ADV19258.1|  chlorophyll a/b-binding protein-like protein            425   7e-148   
dbj|BAA00536.1|  type I light-harvesting chlorophyll a/b-binding ...    426   8e-148   
gb|EMT02225.1|  Chlorophyll a-b binding protein, chloroplastic          426   9e-148   
gb|EMT02412.1|  Chlorophyll a-b binding protein, chloroplastic          425   1e-147   
dbj|BAA03104.1|  light-harvesting chlorophyll a/b-binding protein...    426   1e-147   
ref|XP_010237260.1|  PREDICTED: chlorophyll a-b binding protein o...    426   1e-147   
sp|P92919.1|CB23_APIGR  RecName: Full=Chlorophyll a-b binding pro...    425   1e-147   
emb|CAJ77391.1|  major chlorophyll a/b binding protein LHCb1.1          425   1e-147   
ref|XP_004234241.1|  PREDICTED: uncharacterized protein LOC101245729    436   1e-147   
ref|XP_008675448.1|  PREDICTED: chlorophyll a-b binding protein o...    425   1e-147   
ref|XP_010235395.1|  PREDICTED: chlorophyll a-b binding protein o...    425   2e-147   
gb|EMT02753.1|  Chlorophyll a-b binding protein 3C, chloroplastic       425   2e-147   
gb|EYU43289.1|  hypothetical protein MIMGU_mgv11b019945mg               425   2e-147   
emb|CAA78379.1|  chlorophyll a/b-binding protein PS II-Type I           425   2e-147   
gb|EMS67017.1|  Chlorophyll a-b binding protein, chloroplastic          425   2e-147   
sp|P04779.1|CB21_PETSP  RecName: Full=Chlorophyll a-b binding pro...    424   3e-147   
gb|EMS57503.1|  Chlorophyll a-b binding protein, chloroplastic          424   4e-147   
dbj|BAJ89881.1|  predicted protein                                      424   4e-147   
gb|ADC35579.1|  chloroplast chlorophyll a/b binding protein             424   4e-147   
gb|EMS59660.1|  Chlorophyll a-b binding protein, chloroplastic          426   6e-147   
emb|CAA57407.1|  light harvesting chlorophyll a /b-binding protei...    424   1e-146   
dbj|BAJ87240.1|  predicted protein                                      423   1e-146   
ref|XP_002967230.1|  light-harvesting complex                           423   1e-146   
gb|ABK23263.1|  unknown                                                 423   1e-146   
gb|ABK26071.1|  unknown                                                 423   2e-146   
ref|XP_009360962.1|  PREDICTED: chlorophyll a-b binding protein o...    423   2e-146   
gb|ABK23849.1|  unknown                                                 423   2e-146   
gb|ABK22330.1|  unknown                                                 423   2e-146   
gb|EYU38943.1|  hypothetical protein MIMGU_mgv1a012024mg                422   2e-146   
ref|XP_002960494.1|  light-harvesting complex                           422   4e-146   
emb|CAA32109.1|  chlorophyll a/b-binding preprotein (AA -28 to 235)     421   4e-146   
sp|P04780.1|CB22_PETSP  RecName: Full=Chlorophyll a-b binding pro...    421   8e-146   
gb|EYU43279.1|  hypothetical protein MIMGU_mgv1a011871mg                421   1e-145   
emb|CAA32108.1|  chlorophyll a/b-binding preprotein (AA -31 to 235)     420   1e-145   
ref|XP_010666522.1|  PREDICTED: uncharacterized protein LOC104883672    433   2e-145   
sp|P04159.1|CB21_PEA  RecName: Full=Chlorophyll a-b binding prote...    419   2e-145   
gb|ACN40027.1|  unknown                                                 421   2e-145   
gb|AAT08647.1|  chloroplast chlorophyll A-B binding protein 3C          417   3e-145   
ref|XP_010549470.1|  PREDICTED: chlorophyll a-b binding protein 1...    419   4e-145   
ref|XP_006415534.1|  hypothetical protein EUTSA_v10008479mg             419   6e-145   
gb|EMT09894.1|  Chlorophyll a-b binding protein, chloroplastic          418   7e-145   
ref|XP_010509751.1|  PREDICTED: chlorophyll a-b binding protein 1...    418   8e-145   
gb|EMT04380.1|  Chlorophyll a-b binding protein, chloroplastic          423   8e-145   
gb|KFK36334.1|  hypothetical protein AALP_AA4G109200                    418   9e-145   
gb|EMT04379.1|  Chlorophyll a-b binding protein, chloroplastic          418   9e-145   
dbj|BAD97888.1|  CAB homologue1                                         417   9e-145   
gb|AAB18404.1|  chlorophyll a/b binding protein                         417   1e-144   
ref|XP_010504897.1|  PREDICTED: chlorophyll a-b binding protein 1...    418   2e-144   
ref|XP_010538237.1|  PREDICTED: chlorophyll a-b binding protein 1...    417   2e-144   
ref|XP_006293384.1|  hypothetical protein CARUB_v10023856mg             417   2e-144   
ref|NP_565787.1|  light-harvesting chlorophyll protein complex II...    417   3e-144   
gb|EYU29603.1|  hypothetical protein MIMGU_mgv1a025305mg                416   3e-144   
gb|EMT25652.1|  hypothetical protein F775_43704                         431   3e-144   
gb|KFK36335.1|  hypothetical protein AALP_AA4G109300                    416   4e-144   
ref|XP_010509756.1|  PREDICTED: chlorophyll a-b binding protein 1...    416   4e-144   
ref|XP_006295385.1|  hypothetical protein CARUB_v10024479mg             416   4e-144   
ref|NP_565786.1|  photosystem II light harvesting complex protein...    416   4e-144   
ref|XP_006305533.1|  hypothetical protein CARUB_v10010022mg             416   5e-144   
ref|XP_002879498.1|  LHB1B1                                             416   7e-144   
emb|CAH59405.1|  light harvesting protein 1                             414   1e-143   
gb|AAM64379.1|  putative photosystem II type I chlorophyll a b bi...    415   1e-143   
ref|XP_002881334.1|  chlorophyll A-B-binding protein 2 precursor        414   1e-143   
emb|CDX79562.1|  BnaC03g18980D                                          415   1e-143   
emb|CDX84316.1|  BnaC04g10780D                                          415   1e-143   
emb|CDY17247.1|  BnaA05g09410D                                          415   1e-143   
ref|XP_006304391.1|  hypothetical protein CARUB_v10010908mg             415   1e-143   
sp|P13851.1|CB21_SINAL  RecName: Full=Chlorophyll a-b binding pro...    415   2e-143   
ref|XP_010504898.1|  PREDICTED: chlorophyll a-b binding protein 1...    415   2e-143   
ref|XP_006410587.1|  hypothetical protein EUTSA_v10017088mg             415   2e-143   
sp|P04784.1|CB21_WHEAT  RecName: Full=Chlorophyll a-b binding pro...    414   2e-143   
gb|AAL67432.1|AF458406_1  chlorophyll a/b binding protein               414   2e-143   
emb|CDY26306.1|  BnaA09g26570D                                          414   2e-143   
emb|CDY66768.1|  BnaAnng22920D                                          414   2e-143   
sp|P08222.1|CB22_CUCSA  RecName: Full=Chlorophyll a-b binding pro...    412   3e-143   
gb|KFK44817.1|  hypothetical protein AALP_AA1G306700                    414   3e-143   
sp|P15195.1|CB23_POLMU  RecName: Full=Chlorophyll a-b binding pro...    414   3e-143   
ref|NP_174286.1|  chlorophyll A/B binding protein 1                     414   3e-143   
ref|XP_010499509.1|  PREDICTED: chlorophyll a-b binding protein 1...    414   3e-143   
ref|XP_009141380.1|  PREDICTED: chlorophyll a-b binding protein 1...    414   3e-143   
ref|XP_010460769.1|  PREDICTED: chlorophyll a-b binding protein 1...    414   4e-143   
ref|XP_002890838.1|  hypothetical protein ARALYDRAFT_473204             414   4e-143   
ref|XP_010460768.1|  PREDICTED: chlorophyll a-b binding protein 2...    414   4e-143   
ref|NP_564339.1|  chlorophyll A/B binding protein 3                     414   5e-143   
emb|CDY35271.1|  BnaC03g59520D                                          414   5e-143   
ref|XP_010499505.1|  PREDICTED: chlorophyll a-b binding protein 2...    414   5e-143   
ref|XP_002893588.1|  hypothetical protein ARALYDRAFT_473203             414   5e-143   
ref|XP_009109634.1|  PREDICTED: chlorophyll a-b binding protein 2...    413   7e-143   
ref|XP_009132986.1|  PREDICTED: chlorophyll a-b binding protein 1...    413   8e-143   
gb|AHB24928.1|  chloroplast chlorophyll a-b binding protein 2/3         413   9e-143   
gb|AAB19040.1|  type 2 light-harvesting chlorophyll a/b-binding p...    412   1e-142   
emb|CDY17248.1|  BnaA05g09400D                                          413   1e-142   
gb|AHC95482.1|  chlorophyll A/B binding protein                         413   1e-142   
gb|KFK44818.1|  hypothetical protein AALP_AA1G306800                    413   1e-142   
gb|AAG52048.1|AC022455_2  chlorophyll A-B-binding protein 2 precu...    412   1e-142   
ref|XP_009102798.1|  PREDICTED: chlorophyll a-b binding protein 1...    412   1e-142   
ref|XP_006415537.1|  hypothetical protein EUTSA_v10008476mg             412   1e-142   
ref|XP_009143778.1|  PREDICTED: chlorophyll a-b binding protein 1...    412   2e-142   
gb|AAL38341.1|  chlorophyll a/b-binding protein                         412   3e-142   
emb|CAA27542.1|  chlorophyll a/b binding protein (LHCP AB 180)          410   3e-142   
ref|XP_006447758.1|  hypothetical protein CICLE_v10016280mg             412   3e-142   
gb|KDO58421.1|  hypothetical protein CISIN_1g024579mg                   411   3e-142   
emb|CAA61432.1|  LHCII type I protein                                   411   4e-142   
ref|XP_010478366.1|  PREDICTED: chlorophyll a-b binding protein 1...    411   4e-142   
emb|CDX98158.1|  BnaC07g09400D                                          411   4e-142   
gb|ABG29728.1|  chloroplast chlorophyll a/b binding protein             411   5e-142   
dbj|BAA32346.1|  light-harvesting chlorophyll a/b-binding protein...    411   5e-142   
emb|CDX99866.1|  BnaC05g22880D                                          411   6e-142   
ref|XP_001762089.1|  predicted protein                                  410   9e-142   
ref|XP_009102801.1|  PREDICTED: chlorophyll a-b binding protein 1...    410   1e-141   
emb|CDX84315.1|  BnaC04g10770D                                          412   1e-141   
ref|XP_001779318.1|  predicted protein                                  410   1e-141   
gb|ABK22382.1|  unknown                                                 410   1e-141   
ref|XP_001757271.1|  predicted protein                                  410   1e-141   
gb|KDO58422.1|  hypothetical protein CISIN_1g024579mg                   409   1e-141   
ref|XP_010112785.1|  Chlorophyll a-b binding protein 151                410   1e-141   
ref|XP_008810536.1|  PREDICTED: chlorophyll a-b binding protein 5...    410   2e-141   
gb|KFK42335.1|  hypothetical protein AALP_AA2G243100                    409   2e-141   
ref|XP_001774812.1|  predicted protein                                  409   2e-141   
ref|XP_004144543.1|  PREDICTED: chlorophyll a-b binding protein 1...    409   3e-141   
emb|CAA43907.1|  chlorophyll a/b-binding protein                        409   3e-141   
ref|XP_008462084.1|  PREDICTED: chlorophyll a-b binding protein 1...    409   3e-141   
ref|XP_001751426.1|  predicted protein                                  409   3e-141   
gb|ADI88502.1|  protoporphyrin IX magnesium chelatase                   409   4e-141   
ref|XP_002531690.1|  chlorophyll A/B binding protein, putative          409   4e-141   
ref|XP_007049308.1|  Photosystem II light harvesting complex gene...    409   4e-141   
emb|CAL07971.1|  chlorophyll a/b-binding protein, photosystem II        407   4e-141   
gb|KJB06589.1|  hypothetical protein B456_001G192000                    409   4e-141   
gb|KJB10748.1|  hypothetical protein B456_001G220900                    409   5e-141   
ref|XP_009365212.1|  PREDICTED: chlorophyll a-b binding protein 1...    409   5e-141   
ref|XP_009143774.1|  PREDICTED: chlorophyll a-b binding protein 1...    409   5e-141   
dbj|BAE46383.1|  chlorophyll a/b binding protein                        409   5e-141   
gb|AAD48017.1|AF165529_1  chlorophyll a/b binding protein               409   5e-141   
emb|CAA52750.1|  chlorophyll a/b binding protein                        408   6e-141   
sp|P27518.2|CB21_GOSHI  RecName: Full=Chlorophyll a-b binding pro...    408   6e-141   
gb|AFW90594.1|  chloroplast chlorophyll a/b binding protein             409   6e-141   
gb|KJB06801.1|  hypothetical protein B456_001G192300                    408   7e-141   
gb|KDP29912.1|  hypothetical protein JCGZ_18481                         408   9e-141   
ref|XP_001761868.1|  predicted protein                                  408   1e-140   
gb|AFJ25031.1|  chlorophyll a/b binding protein                         408   1e-140   
ref|XP_010045878.1|  PREDICTED: chlorophyll a-b binding protein 3...    408   1e-140   
gb|ABK21446.1|  unknown                                                 407   1e-140   
ref|XP_001774452.1|  predicted protein                                  407   1e-140   
gb|AEY78525.1|  chlorophyll a/b-binding protein                         407   1e-140   
ref|XP_006836754.1|  hypothetical protein AMTR_s00088p00153020          407   2e-140   
gb|ABK21429.1|  unknown                                                 407   2e-140   
ref|XP_008379987.1|  PREDICTED: chlorophyll a-b binding protein 1...    407   2e-140   
gb|ABK21323.1|  unknown                                                 407   2e-140   
gb|ABO20852.1|  chlorophyll a/b binding protein of LHCII type I         407   2e-140   
ref|XP_002271687.1|  PREDICTED: chlorophyll a-b binding protein 1...    407   2e-140   
ref|XP_002321186.1|  chlorophyll a/b-binding family protein             407   2e-140   
ref|XP_001755762.1|  predicted protein                                  407   2e-140   
ref|XP_011100602.1|  PREDICTED: chlorophyll a-b binding protein 5...    407   2e-140   
ref|XP_001751359.1|  predicted protein                                  407   2e-140   
ref|XP_011003152.1|  PREDICTED: chlorophyll a-b binding protein o...    407   3e-140   
ref|XP_008229895.1|  PREDICTED: chlorophyll a-b binding protein 1...    407   3e-140   
emb|CAA89823.1|  light-harvesting chlorophyll a/b binding protein...    405   3e-140   
gb|AEK26372.1|  chloroplast photosystem II chlorophyll a/b bindin...    407   3e-140   
ref|XP_007215825.1|  hypothetical protein PRUPE_ppa010078mg             406   3e-140   
ref|XP_009136161.1|  PREDICTED: chlorophyll a-b binding protein 1...    406   4e-140   
ref|XP_010665939.1|  PREDICTED: chlorophyll a-b binding protein 5...    406   4e-140   
ref|XP_009397219.1|  PREDICTED: chlorophyll a-b binding protein 1...    406   4e-140   
gb|KCW73782.1|  hypothetical protein EUGRSUZ_E02381                     405   5e-140   



>ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
 gb|KGN49375.1| hypothetical protein Csa_6G522690 [Cucumis sativus]
Length=265

 Score =   444 bits (1141),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004134608.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
[Cucumis sativus]
Length=265

 Score =   444 bits (1141),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004134603.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 1 [Cucumis sativus]
 ref|XP_004134604.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 2 [Cucumis sativus]
 ref|XP_004134605.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like 
isoform 3 [Cucumis sativus]
 gb|KGN49374.1| hypothetical protein Csa_6G522680 [Cucumis sativus]
Length=265

 Score =   444 bits (1141),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009400578.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Musa 
acuminata subsp. malaccensis]
Length=267

 Score =   443 bits (1140),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFS+GGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSDGGLDYLGNPSLIHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008456347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Cucumis 
melo]
Length=267

 Score =   443 bits (1139),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_004145734.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004169747.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Cucumis sativus]
 gb|KGN46826.1| hypothetical protein Csa_6G139750 [Cucumis sativus]
Length=267

 Score =   443 bits (1139),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008439658.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   442 bits (1137),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  265



>sp|P08221.1|CB21_CUCSA RecName: Full=Chlorophyll a-b binding protein of LHCII type I, 
chloroplastic; Short=CAB; Short=LHCP; Flags: Precursor, partial 
[Cucumis sativus]
 gb|AAA33124.1| chlorophyll a/b-binding protein, partial [Cucumis sativus]
Length=255

 Score =   441 bits (1135),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  39   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  98

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  99   ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  158

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  159  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  218

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  219  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  255



>ref|XP_006467509.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=264

 Score =   442 bits (1136),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006449645.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
 gb|ESR62885.1| hypothetical protein CICLE_v10016286mg [Citrus clementina]
Length=264

 Score =   441 bits (1135),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_011085268.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=265

 Score =   441 bits (1135),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_011011531.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
 ref|XP_011016419.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=264

 Score =   441 bits (1135),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 215/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006449643.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 ref|XP_006467513.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006467514.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR62883.1| hypothetical protein CICLE_v10016287mg [Citrus clementina]
 gb|KDO78114.1| hypothetical protein CISIN_1g024654mg [Citrus sinensis]
Length=264

 Score =   441 bits (1135),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006449644.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
 gb|ESR62884.1| hypothetical protein CICLE_v10016074mg [Citrus clementina]
Length=303

 Score =   442 bits (1138),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  87   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  146

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  147  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  206

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  207  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  266

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  267  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  303



>ref|XP_003548104.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Glycine max]
Length=264

 Score =   441 bits (1134),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|ABF70112.1| chlorophyll A-B binding protein (CAB), putative [Musa balbisiana]
Length=267

 Score =   441 bits (1134),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|NP_001240146.1| chlorophyll a-b binding protein 21, chloroplastic-like [Glycine 
max]
 gb|AAA50172.1| photosystem II type I chlorophyll a/b-binding protein [Glycine 
max]
 gb|ACU18421.1| unknown [Glycine max]
 gb|KHN41285.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   441 bits (1134),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009421488.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   441 bits (1134),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_011096521.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Sesamum indicum]
Length=286

 Score =   441 bits (1135),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  70   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  129

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  130  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  189

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  190  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  249

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  250  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  286



>ref|XP_009395692.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   441 bits (1133),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_011045092.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Populus 
euphratica]
Length=263

 Score =   441 bits (1133),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_008444193.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   441 bits (1133),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer 
arietinum]
 emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum]
Length=266

 Score =   441 bits (1133),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  266



>ref|XP_008784387.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   440 bits (1132),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_011096520.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Sesamum indicum]
Length=265

 Score =   440 bits (1132),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_010056879.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
Length=265

 Score =   440 bits (1132),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_008439659.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=338

 Score =   443 bits (1139),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 217/217 (100%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  122  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  181

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  182  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  241

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  242  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  301

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  302  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  338



>ref|XP_009389379.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=267

 Score =   440 bits (1132),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|NP_001241277.1| uncharacterized protein LOC100805310 [Glycine max]
 gb|ACU24438.1| unknown [Glycine max]
Length=263

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_002306927.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK95787.1| unknown [Populus trichocarpa]
 gb|ABK96559.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96723.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96730.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93923.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK  264



>ref|XP_011045093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Populus euphratica]
Length=263

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_010924306.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Elaeis 
guineensis]
Length=264

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009396492.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
Length=266

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_010916097.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   440 bits (1131),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_003548106.1| PREDICTED: chlorophyll a/b-binding protein precursor isoform 
1 [Glycine max]
 gb|KHN41288.1| Chlorophyll a-b binding protein 21, chloroplastic [Glycine soja]
Length=264

 Score =   440 bits (1131),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|KDP37945.1| hypothetical protein JCGZ_04588 [Jatropha curcas]
Length=265

 Score =   439 bits (1130),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_010904844.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=266

 Score =   439 bits (1130),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   439 bits (1130),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 214/217 (99%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNF PGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK  264



>gb|KHN28981.1| Chlorophyll a-b binding protein 3, chloroplastic [Glycine soja]
Length=263

 Score =   439 bits (1129),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_007211864.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
 ref|XP_008225346.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ13063.1| hypothetical protein PRUPE_ppa010081mg [Prunus persica]
Length=265

 Score =   439 bits (1130),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_002302798.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
 gb|EEE82071.2| hypothetical protein POPTR_0002s19010g [Populus trichocarpa]
Length=266

 Score =   439 bits (1130),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>sp|P12329.1|CB21_MAIZE RecName: Full=Chlorophyll a-b binding protein 1, chloroplastic; 
AltName: Full=LHCII type I CAB-1; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA32900.1| unnamed protein product [Zea mays]
 gb|ACF83754.1| unknown [Zea mays]
 gb|ACG25538.1| chlorophyll a-b binding protein 2 [Zea mays]
 gb|ACG28560.1| chlorophyll a-b binding protein 2 [Zea mays]
 tpg|DAA62636.1| TPA: light harvesting chlorophyll a/b binding protein2 [Zea mays]
Length=262

 Score =   439 bits (1129),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  46   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  105

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  106  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  165

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  166  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  225

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  226  VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>ref|XP_004147416.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Cucumis sativus]
 gb|KGN65549.1| Chlorophyll A/B binding protein [Cucumis sativus]
Length=265

 Score =   439 bits (1129),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL DPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLTDPVNNNAWAYATNFVPGK  265



>ref|XP_002519724.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF42697.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   439 bits (1129),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_007211869.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
 ref|XP_008225347.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Prunus 
mume]
 gb|EMJ13068.1| hypothetical protein PRUPE_ppa010099mg [Prunus persica]
Length=264

 Score =   439 bits (1129),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  264



>ref|XP_008800689.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Phoenix 
dactylifera]
Length=264

 Score =   439 bits (1129),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_002515206.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF47190.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=267

 Score =   439 bits (1129),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AFK40061.1| unknown [Medicago truncatula]
 gb|KEH31368.1| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=266

 Score =   439 bits (1129),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>gb|AAC25775.1| chlorophyll a/b binding protein [Medicago sativa]
Length=266

 Score =   439 bits (1128),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_010097596.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69297.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   439 bits (1128),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AHB24929.1| chloroplast light-harvesting complex II chlorophyll a/b binding 
protein 1 [Sedum alfredii]
Length=267

 Score =   439 bits (1128),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
 gb|ABK94788.1| unknown [Populus trichocarpa]
 gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa]
Length=264

 Score =   438 bits (1127),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAWAYATNF PGK
Sbjct  228  VQAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK  264



>ref|XP_010275593.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Nelumbo 
nucifera]
Length=269

 Score =   439 bits (1128),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH+RWAMLG
Sbjct  53   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHARWAMLG  112

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  113  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  172

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  173  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  232

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  233  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  269



>gb|ACU23816.1| unknown [Glycine max]
Length=263

 Score =   438 bits (1127),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|ABF17940.1| putative chloroplast chlorophyll a/b-binding protein [Carya cathayensis]
Length=267

 Score =   438 bits (1127),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|KHN41291.1| Chlorophyll a-b binding protein of LHCII type I, chloroplastic 
[Glycine soja]
Length=231

 Score =   437 bits (1123),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  15   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  74

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  75   ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  134

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  135  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  194

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  195  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  231



>ref|XP_004957570.1| PREDICTED: chlorophyll a-b binding protein 1, chloroplastic-like 
[Setaria italica]
Length=261

 Score =   438 bits (1126),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  45   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  104

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  105  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  164

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  165  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  224

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 
Sbjct  225  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGN  261



>ref|XP_009416547.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Musa acuminata subsp. malaccensis]
 gb|ABF69952.1| chlorophyll A-B binding protein (CAB), putative [Musa acuminata]
Length=265

 Score =   438 bits (1127),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABW70800.1| chloroplast light harvesting chlorophyll a/b binding protein 
[Populus euphratica]
Length=263

 Score =   438 bits (1126),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM GFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMLGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|AFW90512.1| chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=263

 Score =   438 bits (1126),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>dbj|BAA24493.1| chlorophyll a/b-binding protein [Fagus crenata]
Length=264

 Score =   438 bits (1126),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  264



>ref|XP_007158961.1| hypothetical protein PHAVU_002G196400g [Phaseolus vulgaris]
 gb|ESW30955.1| hypothetical protein PHAVU_002G196400g [Phaseolus vulgaris]
Length=263

 Score =   438 bits (1126),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_010926397.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Elaeis guineensis]
Length=264

 Score =   438 bits (1126),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|NP_001147639.1| chlorophyll a-b binding protein 1, chloroplastic precursor [Zea 
mays]
 gb|ACG28217.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=262

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADP+TFAKNRELEVIHSRWAMLG
Sbjct  46   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPKTFAKNRELEVIHSRWAMLG  105

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  106  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  165

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  166  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  225

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  226  VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  262



>ref|XP_010052095.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Eucalyptus 
grandis]
Length=264

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|ACN31249.1| unknown [Zea mays]
Length=233

 Score =   436 bits (1122),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  17   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  76

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  77   ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  136

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  137  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  196

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPG 
Sbjct  197  VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGN  233



>ref|XP_007158464.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 ref|XP_007158466.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
 gb|ESW30458.1| hypothetical protein PHAVU_002G154500g [Phaseolus vulgaris]
 gb|ESW30460.1| hypothetical protein PHAVU_002G154700g [Phaseolus vulgaris]
Length=264

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_007221496.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
 ref|XP_008227797.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
 gb|EMJ22695.1| hypothetical protein PRUPE_ppa010066mg [Prunus persica]
Length=265

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Cucumis sativus]
 gb|KGN58532.1| hypothetical protein Csa_3G664560 [Cucumis sativus]
Length=265

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAF+ELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFSELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABK20976.1| unknown [Picea sitchensis]
 gb|ABK21395.1| unknown [Picea sitchensis]
 gb|ABK25775.1| unknown [Picea sitchensis]
 gb|ABR17147.1| unknown [Picea sitchensis]
 gb|ABR17370.1| unknown [Picea sitchensis]
 gb|ACN39891.1| unknown [Picea sitchensis]
 gb|ACN40202.1| unknown [Picea sitchensis]
 gb|ACN40506.1| unknown [Picea sitchensis]
 gb|ACN40508.1| unknown [Picea sitchensis]
Length=274

 Score =   438 bits (1126),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>ref|XP_008229430.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_007215816.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
 gb|EMJ17015.1| hypothetical protein PRUPE_ppa010034mg [Prunus persica]
Length=267

 Score =   437 bits (1125),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  267



>gb|ACR08639.1| chloroplast chlorophyll A/B binding protein [Mangifera indica]
Length=264

 Score =   437 bits (1124),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYL PFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLSPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AAR10886.1| chlorophyll a/b binding protein [Trifolium pratense]
Length=266

 Score =   437 bits (1124),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_002283566.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN74831.1| hypothetical protein VITISV_023674 [Vitis vinifera]
Length=270

 Score =   437 bits (1125),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  54   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  113

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LM
Sbjct  114  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILM  173

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  174  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  233

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  234  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  270



>gb|KCW75953.1| hypothetical protein EUGRSUZ_D00321 [Eucalyptus grandis]
Length=300

 Score =   438 bits (1127),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  84   WYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  143

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LM
Sbjct  144  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILM  203

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  204  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  263

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK
Sbjct  264  VQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK  300



>ref|XP_008779641.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Phoenix dactylifera]
Length=266

 Score =   437 bits (1124),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGPADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_010097597.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
 gb|EXB69298.1| Chlorophyll a-b binding protein 40 [Morus notabilis]
Length=265

 Score =   437 bits (1124),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_002440263.1| hypothetical protein SORBIDRAFT_09g028720 [Sorghum bicolor]
 gb|EES18693.1| hypothetical protein SORBIDRAFT_09g028720 [Sorghum bicolor]
Length=265

 Score =   437 bits (1124),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>sp|P09756.1|CB23_SOYBN RecName: Full=Chlorophyll a-b binding protein 3, chloroplastic; 
AltName: Full=LHCII type I CAB-3; Short=LHCP; Flags: Precursor 
[Glycine max]
 emb|CAA31419.1| chlorophyll a/b binding preprotein (AA - 32 to 231) [Glycine 
max]
Length=263

 Score =   437 bits (1123),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLA PVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLAGPVNNNAWAYATNFVPGK  263



>gb|AEQ67395.1| chloroplast chlorophyll A/B binding protein [Canarium album]
Length=264

 Score =   437 bits (1123),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_008343203.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008362557.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=332

 Score =   439 bits (1130),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  116  WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  175

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  176  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  235

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  236  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  295

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  296  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  332



>gb|ACF84273.1| unknown [Zea mays]
 gb|ACG31360.1| chlorophyll a-b binding protein 2 [Zea mays]
Length=266

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHIADPVNNNAWAYATNFVPGK  266



>ref|XP_008229429.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Prunus mume]
Length=267

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGEITDPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_007217260.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
 gb|AAA50310.1| light-harvesting chlorophyll a/b-binding protein [Prunus persica]
 gb|EMJ18459.1| hypothetical protein PRUPE_ppa010015mg [Prunus persica]
Length=267

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGEITDPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEITDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>gb|ACU23974.1| unknown [Glycine max]
Length=264

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSY TGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYRTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELK+GRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKHGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_004961193.1| PREDICTED: chlorophyll a-b binding protein M9, chloroplastic-like 
[Setaria italica]
Length=264

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AAF26741.1|AF220527_1 chlorophyll a/b binding protein precursor [Euphorbia esula]
Length=268

 Score =   437 bits (1123),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  52   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  111

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  112  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  171

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  172  GAVEGYRIAGGPLGEVVDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  231

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL DPVNNNAWA+ATNFVPGK
Sbjct  232  VQAIVTGKGPLENLADHLFDPVNNNAWAFATNFVPGK  268



>ref|XP_009782905.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   436 bits (1122),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009593856.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   436 bits (1122),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006467511.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Citrus sinensis]
Length=399

 Score =   441 bits (1135),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 213/217 (98%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264


 Score =   275 bits (704),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 161/214 (75%), Gaps = 23/214 (11%)
 Frame = -1

Query  677  FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNG----------  528
            +PG   +D  GL+ DPE FA+ +  E+ + R AM    G     +++  G          
Sbjct  188  YPGG-SFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLA  246

Query  527  -----------VKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAV  381
                         F     F AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAV
Sbjct  247  DPVNNNAWAYATNFVPGKKF-AGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLMGAV  305

Query  380  EGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFFVQA  201
            EGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFFVQA
Sbjct  306  EGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQA  365

Query  200  IVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            IVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  366  IVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  399



>ref|XP_002460622.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
 gb|EER97143.1| hypothetical protein SORBIDRAFT_02g032040 [Sorghum bicolor]
Length=262

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  46   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  105

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  106  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLM  165

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  166  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  225

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG 
Sbjct  226  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGN  262



>ref|XP_004293579.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  107  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  263



>ref|XP_010243713.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=267

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010052093.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Eucalyptus grandis]
 gb|KCW75951.1| hypothetical protein EUGRSUZ_D00319 [Eucalyptus grandis]
Length=265

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNG+KFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AAD21625.1| putative chlorophyll a/b-binding protein [Phalaenopsis hybrid 
cultivar]
Length=277

 Score =   437 bits (1123),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  61   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  120

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGC+FPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNP+LIHAQSILAIWA QVVLM
Sbjct  121  ALGCIFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSILAIWAVQVVLM  180

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPG SFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  181  GAVEGYRIAGGPLGEITDPLYPGNSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  240

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  241  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  277



>ref|XP_009772885.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006856963.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
 gb|ERN18430.1| hypothetical protein AMTR_s00189p00032350 [Amborella trichopoda]
Length=268

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  52   WYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  111

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  112  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVILM  171

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  172  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  231

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  232  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  268



>ref|XP_008364191.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_009360860.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Pyrus 
x bretschneideri]
Length=264

 Score =   436 bits (1121),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  264



>ref|XP_008447450.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Cucumis melo]
Length=265

 Score =   436 bits (1122),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGV FGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVNFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_008358195.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   436 bits (1121),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  265



>ref|XP_008366007.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   436 bits (1121),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>gb|AAA60965.1| light-harvesting chlorophyll a/b binding protein of photosystem 
II [Ginkgo biloba]
Length=270

 Score =   436 bits (1122),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  54   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  113

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  114  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILM  173

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  174  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  233

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  234  VQAIVTGKGPIENLADHLADPVNNNAWAFATNFVPGK  270



>ref|XP_008356026.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
 ref|XP_008364190.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   436 bits (1121),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>gb|ACD64978.1| chloroplast chlorophyll a/b-binding protein [Ophiopogon japonicus]
Length=264

 Score =   436 bits (1121),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWASQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAF+ELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFSELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AFC91647.1| chloroplast chlorophyll A/B binding protein [Hevea brasiliensis]
Length=265

 Score =   436 bits (1121),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWAVQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009782921.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   436 bits (1121),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|ACN40194.1| unknown [Picea sitchensis]
Length=274

 Score =   436 bits (1121),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPS+LTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSHLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>ref|XP_009363087.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Pyrus x bretschneideri]
Length=265

 Score =   436 bits (1120),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 212/217 (98%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  265



>gb|AEV59640.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis campestris subsp. johannensis]
 gb|AEV59644.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis splendens]
Length=239

 Score =   434 bits (1117),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  23   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  82

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  83   ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILM  142

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  143  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  202

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  203  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  239



>ref|XP_004969083.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Setaria italica]
Length=265

 Score =   436 bits (1120),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AEV59639.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis arctobia]
Length=239

 Score =   434 bits (1117),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  23   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  82

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  83   ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILM  142

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  143  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  202

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  203  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  239



>gb|AAA80593.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   436 bits (1120),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009597417.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana tomentosiformis]
Length=267

 Score =   436 bits (1120),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>gb|AEV59645.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis lambertii]
Length=237

 Score =   434 bits (1117),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  21   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  80

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  81   ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILM  140

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  141  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  200

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  201  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  237



>emb|CAA57409.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-2 [Picea 
abies]
Length=275

 Score =   436 bits (1120),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  59   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  118

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  119  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  178

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  179  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  238

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  239  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  275



>gb|KCW75954.1| hypothetical protein EUGRSUZ_D00322 [Eucalyptus grandis]
Length=358

 Score =   439 bits (1129),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR KYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  142  WYGPDRAKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  201

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  202  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  261

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  262  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  321

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  322  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  358



>ref|XP_002524616.1| chlorophyll A/B binding protein, putative [Ricinus communis]
 gb|EEF37824.1| chlorophyll A/B binding protein, putative [Ricinus communis]
Length=265

 Score =   435 bits (1119),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004303877.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   435 bits (1119),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_009782924.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_006840304.1| hypothetical protein AMTR_s00045p00069900 [Amborella trichopoda]
 gb|ERN01979.1| hypothetical protein AMTR_s00045p00069900 [Amborella trichopoda]
Length=263

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYG DRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  47   WYGRDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  167  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|AEO51755.1| chloroplast chlorophyll A/B binding protein [Dimocarpus longan]
Length=263

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWD AGLSADPETFAKNRELEVIH RWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDAAGLSADPETFAKNRELEVIHCRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  107  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLG++TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGR AMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGKVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRSAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>sp|P07369.1|CB2G_SOLLC RecName: Full=Chlorophyll a-b binding protein 3C, chloroplastic; 
AltName: Full=LHCII type I CAB-3C; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 prf||1204205G protein 3C,chlorophyll binding
Length=267

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>gb|AGV54498.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSM GFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMVGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>emb|CAA57408.1| light harvesting chlorophyll a /b-binding protein Lhcb1*2-1 [Picea 
abies]
Length=274

 Score =   436 bits (1120),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPGK  274



>ref|XP_009775533.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic [Nicotiana 
sylvestris]
 dbj|BAA25395.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENL DHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLVDHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009628755.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27495.1|CB24_TOBAC RecName: Full=Chlorophyll a-b binding protein 40, chloroplastic; 
AltName: Full=LHCII type I CAB-40; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36958.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_010247422.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Nelumbo nucifera]
Length=268

 Score =   435 bits (1119),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  52   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  111

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  112  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  171

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPE FAELKVKE+KNGRLAMFSMFGFF
Sbjct  172  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEKFAELKVKEIKNGRLAMFSMFGFF  231

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  232  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  268



>gb|AFI60242.1| light harvesting chlorophyll a/b binding protein, partial [Panicum 
virgatum]
Length=260

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  44   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  103

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  104  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  163

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  164  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  223

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  224  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  260



>ref|XP_007151996.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
 gb|ESW23990.1| hypothetical protein PHAVU_004G093000g [Phaseolus vulgaris]
Length=264

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTG+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006364025.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_007151979.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
 gb|ESW23973.1| hypothetical protein PHAVU_004G091600g [Phaseolus vulgaris]
Length=264

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTG+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_008364187.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVANNAWXYATNFVPGK  265



>ref|XP_009782923.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008356022.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=265

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVANNAWXYATNFVPGK  265



>gb|AHA84197.1| chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=263

 Score =   434 bits (1117),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEITDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYA NFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYAPNFVPGK  263



>ref|XP_009790934.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25396.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   435 bits (1118),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_003633024.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
 emb|CAN67709.1| hypothetical protein VITISV_003096 [Vitis vinifera]
Length=264

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009795316.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25392.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   435 bits (1118),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009628757.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=266

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_009795314.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25393.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=266

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>ref|XP_002275075.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Vitis 
vinifera]
Length=264

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   435 bits (1118),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV+NNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK  274



>ref|XP_006356077.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_006361530.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006361531.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=267

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_006356078.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHGRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_006368026.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_004303878.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>emb|CAN78667.1| hypothetical protein VITISV_031287 [Vitis vinifera]
Length=264

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 210/217 (97%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006365560.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_008371581.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Malus 
domestica]
Length=265

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  265



>ref|XP_006365572.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
 gb|AAA80589.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|AIR93785.1| chloroplast light harvesting chlorophyll A/B binding protein 
[Kalanchoe fedtschenkoi]
Length=267

 Score =   434 bits (1117),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006356073.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   434 bits (1117),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEA+WFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAIWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_004294267.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=267

 Score =   434 bits (1117),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  111  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPIENLADHLADPVNNNAWSYATNFVPGK  267



>gb|AGV54521.1| LHCII type I chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=264

 Score =   434 bits (1116),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVLLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYA NFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYAPNFVPGK  264



>gb|AAZ79657.1| putative chlorophyll a/b-binding protein [Fagus sylvatica]
Length=260

 Score =   434 bits (1116),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 210/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  45   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  104

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  105  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWATQVLLM  164

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  165  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  224

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  102
            VQAIVTGKGP+ENLADHLADPV NNAWAYATNFVPG
Sbjct  225  VQAIVTGKGPIENLADHLADPVTNNAWAYATNFVPG  260



>gb|AAB61236.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   434 bits (1117),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009795315.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   434 bits (1117),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>gb|AHM26643.1| a-b binding protein [Pyrus x bretschneideri]
Length=264

 Score =   434 bits (1116),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  264



>gb|AAA80591.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   434 bits (1116),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta]
Length=274

 Score =   434 bits (1117),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPV+NNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK  274



>gb|AHA84168.1| chlorophyll a/b-binding protein [Phaseolus vulgaris]
Length=263

 Score =   434 bits (1116),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDY WDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYSWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGEITDP+YPGGSF PLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEITDPIYPGGSFRPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|AAF89206.1|AF279249_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   434 bits (1116),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFS+FGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSIFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009790936.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   434 bits (1116),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_011460161.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Fragaria vesca subsp. vesca]
Length=263

 Score =   434 bits (1116),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVEDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  263



>sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; 
AltName: Full=LHCII type I CAB-8; Flags: Precursor [Pisum 
sativum]
 emb|CAA39883.1| chlorophyll a/b binding protein [Pisum sativum]
Length=268

 Score =   434 bits (1116),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  52   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  111

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  112  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  171

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  172  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  231

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  232  VQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  268



>ref|XP_009782821.1| PREDICTED: chlorophyll a-b binding protein 7, chloroplastic-like 
[Nicotiana sylvestris]
Length=267

 Score =   434 bits (1116),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPL+NL DHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK  267



>ref|XP_008371583.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008356023.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
 ref|XP_008364186.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Malus domestica]
Length=291

 Score =   435 bits (1118),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 211/217 (97%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYL GEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  75   WYGPDRVKYLGPFSGEPPSYLKGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  134

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QVVLM
Sbjct  135  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWATQVVLM  194

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  195  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  254

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV NNAW YATNFVPGK
Sbjct  255  VQAIVTGKGPLENLADHLADPVANNAWNYATNFVPGK  291



>sp|P27491.1|CB27_TOBAC RecName: Full=Chlorophyll a-b binding protein 7, chloroplastic; 
AltName: Full=LHCII type I CAB-7; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA41187.1| chlorophyll a /b binding protein [Nicotiana tabacum]
Length=267

 Score =   434 bits (1115),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPL+NL DHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLDNLVDHLADPVNNNAWAYATNFVPGK  267



>ref|XP_006356074.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   434 bits (1115),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009782922.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic 
[Nicotiana sylvestris]
Length=267

 Score =   434 bits (1115),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>gb|KJB66916.1| hypothetical protein B456_010G165100 [Gossypium raimondii]
Length=265

 Score =   434 bits (1115),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|KJB57287.1| hypothetical protein B456_009G156900 [Gossypium raimondii]
Length=265

 Score =   434 bits (1115),  Expect = 6e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum]
Length=266

 Score =   434 bits (1115),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>ref|XP_009618329.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
 ref|XP_009628756.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   434 bits (1115),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNG+KFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGIKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009618330.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   433 bits (1114),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_007151990.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 ref|XP_007151998.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
 gb|ESW23984.1| hypothetical protein PHAVU_004G092600g [Phaseolus vulgaris]
 gb|ESW23992.1| hypothetical protein PHAVU_004G093200g [Phaseolus vulgaris]
Length=264

 Score =   433 bits (1114),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR KYLGPFSGE PSYLTG+FPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  48   WYGPDRAKYLGPFSGEAPSYLTGQFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>emb|CDP06328.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   433 bits (1114),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSG+PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGDPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIF EGGL+YLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFQEGGLNYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLG++TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGDVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|ACO51067.1| chloroplast chlorophyll A-B binding protein [Gossypium hirsutum]
Length=264

 Score =   433 bits (1114),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006368025.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   433 bits (1114),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|AEY85026.1| light-harvesting complex II protein [Cajanus cajan]
Length=262

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  46   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  105

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+ IFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  106  ALGCVFPELLARNGVKFGEAVWFKAGSLIFSEGGLDYLGNPSLIHAQSILAIWATQVILM  165

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  166  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  225

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVN+NAWAYATNFVPGK
Sbjct  226  VQAIVTGKGPLENLADHLSDPVNSNAWAYATNFVPGK  262



>ref|XP_007025143.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27765.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|NP_001235283.1| chlorophyll a/b-binding protein [Glycine max]
 gb|AAA80688.1| chlorophyll a/b-binding protein [Glycine max]
Length=263

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFA+N ELEVIHSRWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNPELEVIHSRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>ref|XP_009775645.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25391.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|KJB69716.1| hypothetical protein B456_011G041600 [Gossypium raimondii]
Length=264

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|ACL50948.1| putative chloroplast chlorophyll a/b binding protein [Solanum 
nigrum]
Length=249

 Score =   432 bits (1112),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  33   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  92

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  93   ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  152

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  153  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  212

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  213  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  249



>ref|XP_009598577.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|KCW75952.1| hypothetical protein EUGRSUZ_D00320 [Eucalyptus grandis]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDR K+LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRAKHLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNG+KFGEAVWFKAGAQIFSEGGLDYLGNP+LIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGIKFGEAVWFKAGAQIFSEGGLDYLGNPNLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK  265



>gb|AEV59643.1| chloroplast photosystem II light harvesting complex protein type 
I, partial [Oxytropis splendens]
Length=236

 Score =   432 bits (1110),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 209/216 (97%), Positives = 214/216 (99%), Gaps = 0/216 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  21   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  80

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  81   ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILM  140

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  141  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  200

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPG  102
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPG
Sbjct  201  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPG  236



>gb|AFW81158.1| light harvesting chlorophyll a/b binding protein3 [Zea mays]
Length=302

 Score =   434 bits (1117),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  86   WYGPDRVLYLGPLSGAPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  145

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  146  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  205

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  206  GAIEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  265

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  266  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  302



>pdb|1VCR|A Chain A, An Icosahedral Assembly Of Light-Harvesting Chlorophyll 
AB Protein Complex From Pea Thylakoid Membranes
Length=232

 Score =   432 bits (1110),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  16   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  75

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  76   ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  135

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  136  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  195

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  196  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  232



>sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; 
AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36955.1| unnamed protein product [Nicotiana tabacum]
Length=266

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>ref|XP_009598575.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|AAC78690.1| chlorophyll a/b-binding protein [Pinus thunbergii]
Length=274

 Score =   433 bits (1114),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDP+AFAELKVKE+KNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPDAFAELKVKEIKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENL DHLADPVNNNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLTDHLADPVNNNAWAYATNFVPGK  274



>ref|XP_006365573.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006365574.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
isoform X2 [Solanum tuberosum]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|ACF85694.1| unknown [Zea mays]
 gb|ACG30115.1| chlorophyll a-b binding protein 1 [Zea mays]
 gb|ACG33564.1| chlorophyll a-b binding protein 1 [Zea mays]
 gb|AFW81156.1| light harvesting chlorophyll a/b binding protein3 isoform 1 [Zea 
mays]
 gb|AFW81157.1| light harvesting chlorophyll a/b binding protein3 isoform 2 [Zea 
mays]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG PPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGAPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAIEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009628754.1| PREDICTED: chlorophyll a-b binding protein 16, chloroplastic 
[Nicotiana tomentosiformis]
Length=266

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  266



>ref|XP_004233096.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233099.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_004233100.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316910.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 ref|XP_010316913.1| PREDICTED: chlorophyll a-b binding protein 1C, chloroplastic 
[Solanum lycopersicum]
 sp|P07370.1|CB2B_SOLLC RecName: Full=Chlorophyll a-b binding protein 1B, chloroplastic; 
AltName: Full=LHCII type I CAB-1B; Short=LHCP; Flags: Precursor 
[Solanum lycopersicum]
 gb|AAA34147.1| chlorophyll a/b-binding protein Cab-1B [Solanum lycopersicum]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>sp|P07371.1|CB22_PEA RecName: Full=Chlorophyll a-b binding protein AB80, chloroplastic; 
AltName: Full=LHCII type I CAB-AB80; Short=LHCP; Flags: 
Precursor [Pisum sativum]
 gb|AAA63413.1| cab precursor [Pisum sativum]
 gb|AAA33651.1| polypeptide 15 precursor [Pisum sativum]
 prf||1006296A protein,chlorophyll a/b binding
Length=269

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  53   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  112

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  113  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  172

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  173  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  232

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  233  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  269



>ref|XP_009759685.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25394.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=267

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSG  PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGNSPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  267



>ref|XP_009630190.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana tomentosiformis]
 sp|P27493.1|CB22_TOBAC RecName: Full=Chlorophyll a-b binding protein 21, chloroplastic; 
AltName: Full=LHCII type I CAB-21; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36957.1| unnamed protein product [Nicotiana tabacum]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_004233101.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum lycopersicum]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   433 bits (1113),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_002273106.2| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like 
[Vitis vinifera]
Length=263

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  47   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP L+HAQSILAIWACQV+LM
Sbjct  107  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPGLVHAQSILAIWACQVILM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRI GGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIGGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|ABB55370.1| chlorophyll a-b binding protein 3C-like [Solanum tuberosum]
Length=267

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSDGGLDYLGNPSLIHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>sp|P04782.1|CB24_PETSP RecName: Full=Chlorophyll a-b binding protein 25, chloroplastic; 
AltName: Full=LHCII type I CAB-25; Short=LHCP; Flags: Precursor 
[Petunia sp.]
 emb|CAA26211.1| unnamed protein product [Petunia sp.]
Length=266

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPEL +RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELFARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>gb|AAF89207.1|AF279250_1 LHCII type I chlorophyll a/b-binding protein [Vigna radiata]
Length=264

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIHSRWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHSRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALG VFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWA QV+LM
Sbjct  108  ALGSVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWASQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>gb|AES74698.2| light-harvesting complex I chlorophyll A/B-binding protein [Medicago 
truncatula]
Length=265

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  109  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWAVQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ DPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHITDPVNNNAWAFATNFVPGK  265



>ref|XP_010317413.1| PREDICTED: chlorophyll a-b binding protein 3A, chloroplastic-like 
[Solanum lycopersicum]
Length=267

 Score =   432 bits (1112),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADH+ADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHIADPVNNNAWAFATNFVPGK  267



>ref|XP_006844081.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
 gb|ERN05756.1| hypothetical protein AMTR_s00006p00251360 [Amborella trichopoda]
Length=266

 Score =   432 bits (1111),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  50   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNP+L+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
             AVEGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  170  SAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  266



>gb|AFW90565.1| chlorophyll a-b binding protein 3C-like mRNA [Solanum tuberosum]
Length=233

 Score =   431 bits (1108),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  17   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  76

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  77   ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  136

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  137  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  196

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  197  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  233



>emb|CDP06329.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 215/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGV+FGEAVWFKAG+QIF EGGL+YLGNP+LIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLSRNGVQFGEAVWFKAGSQIFQEGGLNYLGNPNLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLG++TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGDVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; 
AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor 
[Nicotiana tabacum]
 emb|CAA36956.1| unnamed protein product [Nicotiana tabacum]
Length=267

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVK +KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKHIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_007025148.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
 gb|EOY27770.1| Chlorophyll a-b binding protein, chloroplastic [Theobroma cacao]
Length=264

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SG+PPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGDPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_009775650.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic 
[Nicotiana sylvestris]
Length=265

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|ABQ81856.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEF GDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFAGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGV+FGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVQFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum 
sativum]
Length=266

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  50   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  110  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWATQVILM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL+DPVNNNAW+YATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK  266



>gb|AAA80594.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   432 bits (1110),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGE VWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEVVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>gb|AAA34148.1| chlorophyll a/b-binding protein Cab-3C [Solanum lycopersicum]
Length=267

 Score =   432 bits (1110),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGPADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  267



>ref|XP_002455902.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
 gb|EES01022.1| hypothetical protein SORBIDRAFT_03g027040 [Sorghum bicolor]
Length=265

 Score =   432 bits (1110),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYG DRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGADRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>sp|P15194.1|CB2B_PINSY RecName: Full=Chlorophyll a-b binding protein type 2 member 1B, 
chloroplastic; AltName: Full=Chlorophyll a-b binding protein 
type II 1B; Short=CAB; AltName: Full=LHCP; Flags: Precursor 
[Pinus sylvestris]
 emb|CAA32658.1| unnamed protein product [Pinus sylvestris]
Length=274

 Score =   432 bits (1111),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPE FAKNRELEVIH RWAMLG
Sbjct  58   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPENFAKNRELEVIHCRWAMLG  117

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  118  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  177

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  178  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  237

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  238  VQAIVTGKGPIENLADHLADPVNNNAWAYATNFVPGK  274



>ref|XP_009606800.1| PREDICTED: chlorophyll a-b binding protein 50, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=267

 Score =   432 bits (1110),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAML 
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLA  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR++GGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVSGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHL DPVNNNAWAYATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLVDPVNNNAWAYATNFVPGK  267



>gb|ACN41907.1| chlorophyll A/B binding protein [Gardenia jasminoides]
Length=264

 Score =   432 bits (1110),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAM G
Sbjct  48   WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMPG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAG+QIF EGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLSRNGVKFGEAVWFKAGSQIFQEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDP+YPGGSFDPLGLAD PEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADVPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>ref|XP_006660556.1| PREDICTED: chlorophyll a-b binding protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=263

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  47   WYGADRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  106

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  107  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  166

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  167  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  226

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  227  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  263



>gb|ABQ81857.1| chloroplast chlorophyll a/b binding protein [Phyllostachys edulis]
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGV+FGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVQFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTG GP+ENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGNGPIENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_009786355.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana sylvestris]
 dbj|BAA25388.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris]
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLT EFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTSEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>ref|XP_006365561.1| PREDICTED: chlorophyll a-b binding protein 1B, chloroplastic-like 
[Solanum tuberosum]
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>prf||1204205B protein 1B,chlorophyll binding
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFS+GGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSQGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>gb|AAA18529.1| chlorophyll A/B binding protein [Gossypium hirsutum]
Length=264

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  48   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  107

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  108  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  167

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLG ADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  168  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGFADDPEAFAELKVKEIKNGRLAMFSMFGFF  227

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  228  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  264



>sp|P12333.1|CB2A_SPIOL RecName: Full=Chlorophyll a-b binding protein, chloroplastic; 
AltName: Full=LHCII type I CAB; Short=LHCP; Flags: Precursor 
[Spinacia oleracea]
 emb|CAA32526.1| chlorophyll a/b binding protein precursor [Spinacia oleracea]
 emb|CAJ77389.3| major chlorophyll a/b binding protein LHCb1.3 [Spinacia oleracea]
Length=267

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW +ATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK  267



>sp|P04781.1|CB23_PETSP RecName: Full=Chlorophyll a-b binding protein 22R, chloroplastic; 
AltName: Full=LHCII type I CAB-22R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26213.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 212/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFP DYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPSDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPEL +RNG+KFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELFARNGIKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVIDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; 
AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: 
Precursor [Petunia sp.]
 emb|CAA26209.1| unnamed protein product [Petunia sp.]
Length=267

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTA LSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAELSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>ref|XP_010666512.1| PREDICTED: chlorophyll a-b binding protein, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=268

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  52   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  111

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  112  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  171

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  172  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  231

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  232  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  268



>gb|KDP37944.1| hypothetical protein JCGZ_04587 [Jatropha curcas]
Length=260

 Score =   431 bits (1109),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 209/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPD VK LGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  44   WYGPDGVKNLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  103

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  104  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  163

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDP+YPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  164  GAVEGYRVAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  223

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  224  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  260



>gb|AAA80592.1| chlorophyll a/b binding protein [Solanum tuberosum]
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIF EGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFREGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ +PLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVNPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|NP_001105545.1| chlorophyll a-b binding protein M9, chloroplastic precursor [Zea 
mays]
 sp|P27497.1|CB29_MAIZE RecName: Full=Chlorophyll a-b binding protein M9, chloroplastic; 
AltName: Full=LHCII type I CAB-M9; Short=LHCP; Flags: Precursor 
[Zea mays]
 emb|CAA39376.1| light-harvesting chlorophyll a/b binding protein [Zea mays]
Length=265

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  49   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+ DPLYPGG+FDPLGLADDPEAFA++KVKELKNGRLAMFSMFGFF
Sbjct  169  GAIEGYRVAGGPLGEVVDPLYPGGTFDPLGLADDPEAFADVKVKELKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  265



>gb|AAB61237.1| chlorophyll a/b-binding protein [Mesembryanthemum crystallinum]
Length=267

 Score =   432 bits (1110),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 204/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF KNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFTKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAIEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



>ref|XP_009598574.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=265

 Score =   431 bits (1109),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQV+LM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  265



>ref|XP_010231410.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1 [Brachypodium 
distachyon]
Length=266

 Score =   431 bits (1109),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYG DRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELE+IHSRWAMLG
Sbjct  50   WYGSDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELELIHSRWAMLG  109

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  110  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  169

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGEI DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  170  GAVEGYRVAGGPLGEIVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  229

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  230  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  266



>ref|XP_010316912.1| PREDICTED: chlorophyll a-b binding protein 1A, chloroplastic 
[Solanum lycopersicum]
Length=265

 Score =   431 bits (1109),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 207/217 (95%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  49   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  108

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  109  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  168

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  169  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  228

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVPGK
Sbjct  229  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK  265



>ref|XP_006840305.1| hypothetical protein AMTR_s00045p00070890 [Amborella trichopoda]
 gb|ERN01980.1| hypothetical protein AMTR_s00045p00070890 [Amborella trichopoda]
Length=232

 Score =   430 bits (1106),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  16   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  75

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSL+HAQSILAIWA QV+LM
Sbjct  76   ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLVHAQSILAIWAAQVILM  135

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+TDPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  136  GAVEGYRVAGGPLGEVTDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  195

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  196  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  232



>ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=262

 Score =   431 bits (1109),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  46   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  105

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  106  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  165

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+ DPLYPGGSFDPLGLA+DPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  166  GAIEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFF  225

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNF PGK
Sbjct  226  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK  262



>ref|XP_010374558.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1, partial 
[Rhinopithecus roxellana]
Length=235

 Score =   430 bits (1106),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 208/217 (96%), Positives = 214/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFA+NRELEVIH RWAMLG
Sbjct  19   WYGPDRVLYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNRELEVIHCRWAMLG  78

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  79   ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  138

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+TDPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  139  GAVEGYRIAGGPLGEVTDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  198

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  199  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  235



>gb|ABK22510.1| unknown [Picea sitchensis]
 gb|ABK22691.1| unknown [Picea sitchensis]
 gb|ABK26115.1| unknown [Picea sitchensis]
 gb|ABR17282.1| unknown [Picea sitchensis]
Length=278

 Score =   432 bits (1110),  Expect = 5e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 216/217 (99%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRV YLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG
Sbjct  62   WYGPDRVLYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  121

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAGAQIFSEGGLDYLG+P+L+HAQSILAIWACQV+LM
Sbjct  122  ALGCVFPELLARNGVKFGEAVWFKAGAQIFSEGGLDYLGSPNLVHAQSILAIWACQVILM  181

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYR+AGGPLGE+TDP+YPGG+FDPLGLADDP+AFAELKVKELKNGRLAMFSMFGFF
Sbjct  182  GAIEGYRVAGGPLGEVTDPIYPGGNFDPLGLADDPDAFAELKVKELKNGRLAMFSMFGFF  241

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK
Sbjct  242  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  278



>gb|EYU19613.1| hypothetical protein MIMGU_mgv1a011885mg [Erythranthe guttata]
Length=267

 Score =   431 bits (1109),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIHSRWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHSRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIW  QVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWGVQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GA+EGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF
Sbjct  171  GAIEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAW+YATNFVPGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK  267



>gb|AGJ50622.1| chlorophyll a/b binding protein [Salicornia brachiata]
Length=267

 Score =   431 bits (1109),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGEPPSYLTGE PGDYGWDTAGLSADPETFAKNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEPPSYLTGELPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSLIHAQSILAIWACQV+LM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQSILAIWACQVILM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYR+AGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            +QAIVTGKGPLENLADHLADPVNNNAW+YATN VPGK
Sbjct  231  IQAIVTGKGPLENLADHLADPVNNNAWSYATNLVPGK  267



>ref|XP_006356080.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
[Solanum tuberosum]
Length=267

 Score =   431 bits (1109),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 206/217 (95%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQSILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNFVP K
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPRK  267



>ref|XP_006356075.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like 
isoform X1 [Solanum tuberosum]
Length=267

 Score =   431 bits (1109),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 205/217 (94%), Positives = 213/217 (98%), Gaps = 0/217 (0%)
 Frame = -1

Query  749  WYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLG  570
            WYGPDRVKYLGPFSGE PSYLTGEFPGDYGWDTAGLSADPETF+KNRELEVIH RWAMLG
Sbjct  51   WYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLG  110

Query  569  ALGCVFPELLSRNGVKFGEAVWFKAGAQIFSEGGLDYLGNPSLIHAQSILAIWACQVVLM  390
            ALGCVFPELL+RNGVKFGEAVWFKAG+QIFSEGGLDYLGNPSL+HAQ+ILAIWACQVVLM
Sbjct  111  ALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQNILAIWACQVVLM  170

Query  389  GAVEGYRIAGGPLGEITDPLYPGGSFDPLGLADDPEAFAELKVKELKNGRLAMFSMFGFF  210
            GAVEGYRIAGGPLGE+ DPLYPGGSFDPLGLADDPEAFAELKVKE+KNGRLAMFSMFGFF
Sbjct  171  GAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFF  230

Query  209  VQAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK  99
            VQAIVTGKGPLENLADHLADPVNNNAWA+ATNF PGK
Sbjct  231  VQAIVTGKGPLENLADHLADPVNNNAWAFATNFAPGK  267



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1374325004630