BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031L15

Length=779
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009587293.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    325   4e-108   
ref|XP_004243321.1|  PREDICTED: lipoyl synthase, mitochondrial          326   7e-107   Solanum lycopersicum
ref|XP_009771704.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    325   2e-106   Nicotiana sylvestris
ref|XP_009778191.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    325   3e-106   Nicotiana sylvestris
ref|XP_006357526.1|  PREDICTED: lipoyl synthase, mitochondrial-like     324   6e-106   Solanum tuberosum [potatoes]
sp|Q3LSN4.1|LIAS1_PEA  RecName: Full=Lipoyl synthase 1, mitochond...    323   1e-105   Pisum sativum [garden pea]
ref|XP_011072065.1|  PREDICTED: lipoyl synthase 2, mitochondrial        323   1e-105   Sesamum indicum [beniseed]
emb|CDP14732.1|  unnamed protein product                                322   2e-105   Coffea canephora [robusta coffee]
ref|XP_003540350.1|  PREDICTED: lipoyl synthase 2, mitochondrial        322   3e-105   Glycine max [soybeans]
ref|XP_009621653.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    322   3e-105   Nicotiana tomentosiformis
gb|KJB79957.1|  hypothetical protein B456_013G074500                    322   3e-105   Gossypium raimondii
ref|XP_004245423.1|  PREDICTED: lipoyl synthase 1, mitochondrial-...    320   3e-105   
ref|XP_010035697.1|  PREDICTED: lipoyl synthase 2, mitochondrial        322   4e-105   Eucalyptus grandis [rose gum]
ref|XP_008230240.1|  PREDICTED: lipoyl synthase 2, mitochondrial        319   4e-105   
sp|Q3LSN5.1|LIAS2_PEA  RecName: Full=Lipoyl synthase 2, mitochond...    322   5e-105   Pisum sativum [garden pea]
ref|XP_007149469.1|  hypothetical protein PHAVU_005G072800g             321   6e-105   Phaseolus vulgaris [French bean]
gb|EYU26119.1|  hypothetical protein MIMGU_mgv1a008134mg                321   7e-105   Erythranthe guttata [common monkey flower]
ref|XP_003543350.1|  PREDICTED: lipoyl synthase 2, mitochondrial        320   2e-104   Glycine max [soybeans]
emb|CBI38451.3|  unnamed protein product                                313   2e-104   Vitis vinifera
gb|KDP24175.1|  hypothetical protein JCGZ_25832                         319   3e-104   Jatropha curcas
gb|AHM22930.1|  lipoyl synthase                                         319   5e-104   Nicotiana tabacum [American tobacco]
gb|KEH39087.1|  lipoyl synthase                                         318   7e-104   Medicago truncatula
sp|B7FM45.1|LIAS_MEDTR  RecName: Full=Lipoyl synthase, mitochondr...    318   7e-104   Medicago truncatula
ref|XP_007215533.1|  hypothetical protein PRUPE_ppa007143mg             318   7e-104   Prunus persica
ref|XP_010095809.1|  Lipoyl synthase                                    318   2e-103   
ref|XP_007149882.1|  hypothetical protein PHAVU_005G106700g             317   2e-103   Phaseolus vulgaris [French bean]
ref|XP_004487312.1|  PREDICTED: lipoyl synthase 2, mitochondrial-...    317   2e-103   Cicer arietinum [garbanzo]
ref|XP_007043522.1|  Lipoyl synthase, mitochondrial isoform 1           317   2e-103   
gb|AFK43632.1|  unknown                                                 316   6e-103   Medicago truncatula
ref|XP_011025577.1|  PREDICTED: lipoyl synthase, mitochondrial-like     316   6e-103   Populus euphratica
ref|XP_008356122.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    316   7e-103   Malus domestica [apple tree]
gb|AFK48146.1|  unknown                                                 316   8e-103   Medicago truncatula
gb|KHG07122.1|  Lipoyl synthase, mitochondrial                          315   1e-102   Gossypium arboreum [tree cotton]
ref|XP_008455341.1|  PREDICTED: lipoyl synthase 2, mitochondrial        315   1e-102   
ref|XP_009357081.1|  PREDICTED: lipoyl synthase 2, mitochondrial        316   1e-102   Pyrus x bretschneideri [bai li]
gb|ABK96318.1|  unknown                                                 315   2e-102   Populus trichocarpa x Populus deltoides
ref|XP_002306361.1|  lipoic acid synthase family protein                315   3e-102   Populus trichocarpa [western balsam poplar]
ref|XP_008341911.1|  PREDICTED: lipoyl synthase, mitochondrial          315   3e-102   
ref|XP_006447321.1|  hypothetical protein CICLE_v10015632mg             314   4e-102   Citrus clementina [clementine]
gb|KDO40564.1|  hypothetical protein CISIN_1g017179mg                   314   4e-102   Citrus sinensis [apfelsine]
ref|XP_002266132.2|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    314   7e-102   Vitis vinifera
ref|XP_011021958.1|  PREDICTED: lipoyl synthase, mitochondrial          313   7e-102   Populus euphratica
ref|XP_010526527.1|  PREDICTED: lipoyl synthase, mitochondrial          313   1e-101   Tarenaya hassleriana [spider flower]
ref|XP_004136815.1|  PREDICTED: lipoyl synthase, mitochondrial-like     313   2e-101   Cucumis sativus [cucumbers]
gb|EPS65537.1|  lipoyl synthase, mitochondrial                          311   2e-101   Genlisea aurea
ref|XP_009398165.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    312   3e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006841751.1|  hypothetical protein AMTR_s00003p00261780          310   3e-101   
ref|XP_006380479.1|  hypothetical protein POPTR_0007s06900g             312   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009388773.1|  PREDICTED: lipoyl synthase, mitochondrial {E...    311   1e-100   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX81984.1|  BnaC08g36170D                                          310   2e-100   
ref|XP_010467759.1|  PREDICTED: lipoyl synthase, mitochondrial          309   4e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010278318.1|  PREDICTED: lipoyl synthase 2, mitochondrial        309   7e-100   Nelumbo nucifera [Indian lotus]
ref|NP_179682.1|  lipoic acid synthase 1                                308   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010926267.1|  PREDICTED: lipoyl synthase, mitochondrial          308   1e-99    Elaeis guineensis
ref|XP_010488982.1|  PREDICTED: lipoyl synthase, mitochondrial-like     307   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_009117465.1|  PREDICTED: lipoyl synthase, mitochondrial          307   2e-99    Brassica rapa
ref|XP_010239981.1|  PREDICTED: lipoyl synthase, mitochondrial          306   6e-99    Brachypodium distachyon [annual false brome]
ref|XP_006409024.1|  hypothetical protein EUTSA_v10002016mg             305   7e-99    Eutrema salsugineum [saltwater cress]
ref|XP_006653475.1|  PREDICTED: lipoyl synthase, mitochondrial-like     303   8e-99    
gb|KFK40464.1|  hypothetical protein AALP_AA3G376400                    305   1e-98    Arabis alpina [alpine rockcress]
ref|XP_004306011.1|  PREDICTED: lipoyl synthase 2, mitochondrial        308   1e-98    Fragaria vesca subsp. vesca
dbj|BAJ97232.1|  predicted protein                                      305   2e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004975823.1|  PREDICTED: lipoyl synthase, mitochondrial-like     305   2e-98    Setaria italica
ref|XP_002884228.1|  hypothetical protein ARALYDRAFT_900465             304   4e-98    Arabidopsis lyrata subsp. lyrata
dbj|BAK07245.1|  predicted protein                                      305   6e-98    Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|A2XU53.2|LIAS_ORYSI  RecName: Full=Lipoyl synthase, mitochondr...    303   6e-98    Oryza sativa Indica Group [Indian rice]
emb|CAH67016.1|  H0523F07.4                                             303   7e-98    Oryza sativa [red rice]
ref|NP_001052964.1|  Os04g0455800                                       301   5e-97    
ref|XP_002447950.1|  hypothetical protein SORBIDRAFT_06g018660          301   5e-97    Sorghum bicolor [broomcorn]
dbj|BAB44157.1|  lipoic acid synthase                                   300   1e-96    Bruguiera gymnorhiza [Burma mangrove]
ref|XP_008782125.1|  PREDICTED: lipoyl synthase, mitochondrial          300   1e-96    Phoenix dactylifera
ref|NP_001146235.1|  lipoyl synthase, mitochondrial                     299   4e-96    Zea mays [maize]
ref|XP_010671528.1|  PREDICTED: lipoyl synthase 2, mitochondrial        299   4e-96    Beta vulgaris subsp. vulgaris [field beet]
gb|EMS61096.1|  Lipoyl synthase, mitochondrial                          300   5e-96    Triticum urartu
gb|EMT08295.1|  Lipoyl synthase, mitochondrial                          300   1e-95    
ref|XP_006447320.1|  hypothetical protein CICLE_v10015632mg             293   3e-94    
ref|XP_006299291.1|  hypothetical protein CARUB_v10015445mg             287   6e-94    
sp|A9NNH7.1|LIAS_PICSI  RecName: Full=Lipoyl synthase, mitochondr...    285   1e-90    Picea sitchensis
ref|XP_001764819.1|  predicted protein                                  284   4e-90    
gb|KDO40563.1|  hypothetical protein CISIN_1g017179mg                   280   5e-89    Citrus sinensis [apfelsine]
ref|XP_010917111.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    271   4e-87    
ref|XP_002985852.1|  hypothetical protein SELMODRAFT_123090             274   7e-87    
ref|XP_002984787.1|  hypothetical protein SELMODRAFT_121095             274   7e-87    
gb|EAY94363.1|  hypothetical protein OsI_16128                          273   3e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_007043523.1|  Lipoyl synthase, mitochondrial isoform 2           251   5e-78    
ref|XP_006380478.1|  hypothetical protein POPTR_0007s06900g             245   1e-75    
ref|XP_002517968.1|  lipoic acid synthetase, putative                   244   2e-75    
dbj|BAI58534.1|  lipoic acid synthase                                   236   1e-73    Rhizophora mucronata
dbj|BAI58440.1|  lipoic acid synthase                                   233   1e-72    Rhizophora apiculata
ref|XP_006382932.1|  hypothetical protein POPTR_0005s08840g             231   3e-70    
ref|XP_006382933.1|  hypothetical protein POPTR_0005s08840g             229   3e-69    
gb|KDO40565.1|  hypothetical protein CISIN_1g017179mg                   227   1e-68    Citrus sinensis [apfelsine]
gb|AFK36952.1|  unknown                                                 218   3e-68    Lotus japonicus
ref|XP_006298130.1|  hypothetical protein CARUB_v10014173mg             214   6e-64    
ref|XP_005847137.1|  hypothetical protein CHLNCDRAFT_24051              212   1e-62    Chlorella variabilis
ref|XP_003062162.1|  predicted protein                                  210   2e-62    Micromonas pusilla CCMP1545
gb|KDD75330.1|  hypothetical protein H632_c740p1                        212   2e-62    Helicosporidium sp. ATCC 50920
gb|EFX79130.1|  hypothetical protein DAPPUDRAFT_304936                  211   4e-62    Daphnia pulex
ref|XP_008608559.1|  lipoyl synthase, mitochondrial                     211   5e-62    Saprolegnia diclina VS20
ref|XP_010866875.1|  PREDICTED: lipoyl synthase, mitochondrial          209   5e-61    Esox lucius
ref|XP_011396533.1|  Lipoyl synthase, mitochondrial                     208   6e-61    Auxenochlorella protothecoides
gb|EJK53838.1|  hypothetical protein THAOC_26643                        203   7e-61    Thalassiosira oceanica
gb|KDN45963.1|  Lipoyl synthase                                         208   7e-61    Tilletiaria anomala UBC 951
ref|XP_008410916.1|  PREDICTED: lipoyl synthase, mitochondrial          207   2e-60    Poecilia reticulata
gb|KFV80466.1|  hypothetical protein N308_07734                         206   2e-60    Struthio camelus australis
emb|CDS10851.1|  Putative Lipoyl synthase, mitochondrial                207   2e-60    Lichtheimia ramosa
emb|CDH58810.1|  lipoic acid synthetase precursor                       207   3e-60    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_009671746.1|  PREDICTED: lipoyl synthase, mitochondrial          206   4e-60    Struthio camelus australis
ref|XP_005807826.1|  PREDICTED: lipoyl synthase, mitochondrial-like     206   4e-60    Xiphophorus maculatus
ref|XP_005651902.1|  lipoic acid synthetase                             204   4e-60    Coccomyxa subellipsoidea C-169
ref|XP_009836562.1|  lipoyl synthase, mitochondrial                     205   6e-60    Aphanomyces astaci
ref|XP_007551988.1|  PREDICTED: lipoyl synthase, mitochondrial          206   7e-60    Poecilia formosa
gb|KDO24055.1|  lipoyl synthase                                         205   7e-60    Saprolegnia parasitica CBS 223.65
ref|XP_006630109.1|  PREDICTED: lipoyl synthase, mitochondrial-like     205   8e-60    
ref|XP_008873914.1|  lipoyl synthase, mitochondrial                     204   1e-59    Aphanomyces invadans
gb|KFW73063.1|  hypothetical protein AS28_12364                         203   2e-59    Pygoscelis adeliae
ref|XP_004905775.1|  PREDICTED: lipoyl synthase, mitochondrial          204   3e-59    
gb|EKC32311.1|  Lipoyl synthase, mitochondrial                          202   3e-59    Crassostrea gigas
gb|KFW83864.1|  hypothetical protein N305_05087                         202   4e-59    Manacus vitellinus
ref|XP_002507881.1|  lipoic acid synthase                               204   4e-59    Micromonas commoda
ref|XP_009330740.1|  PREDICTED: lipoyl synthase, mitochondrial          203   4e-59    Pygoscelis adeliae
gb|KFM08116.1|  hypothetical protein AS27_09519                         202   4e-59    Aptenodytes forsteri
ref|XP_011440930.1|  PREDICTED: lipoyl synthase, mitochondrial-like     203   5e-59    Crassostrea gigas
gb|ETI37440.1|  lipoyl synthase, mitochondrial                          203   5e-59    Phytophthora parasitica P1569
ref|XP_008911775.1|  lipoyl synthase, mitochondrial                     203   6e-59    Phytophthora parasitica INRA-310
ref|XP_008925719.1|  PREDICTED: lipoyl synthase, mitochondrial          202   6e-59    
ref|XP_009531563.1|  hypothetical protein PHYSODRAFT_562522             203   6e-59    Phytophthora sojae
ref|XP_009060732.1|  hypothetical protein LOTGIDRAFT_150656             202   6e-59    Lottia gigantea
ref|XP_006895466.1|  PREDICTED: lipoyl synthase, mitochondrial          202   9e-59    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|EMC82961.1|  Lipoyl synthase, mitochondrial                          201   9e-59    
ref|XP_005415685.1|  PREDICTED: lipoyl synthase, mitochondrial          202   9e-59    
ref|XP_009099697.1|  PREDICTED: lipoyl synthase, mitochondrial          204   1e-58    
ref|XP_009278445.1|  PREDICTED: lipoyl synthase, mitochondrial          202   1e-58    
gb|KGL93190.1|  hypothetical protein N301_01854                         201   1e-58    Charadrius vociferus
gb|KFH64353.1|  lipoic acid synthetase                                  203   1e-58    Mortierella verticillata NRRL 6337
ref|XP_005392039.1|  PREDICTED: lipoyl synthase, mitochondrial is...    202   1e-58    Chinchilla lanigera
ref|XP_002189456.1|  PREDICTED: lipoyl synthase, mitochondrial          202   1e-58    Taeniopygia guttata
gb|KFV64353.1|  hypothetical protein N307_06684                         201   2e-58    Picoides pubescens
emb|CCI49885.1|  unnamed protein product                                202   2e-58    Albugo candida
ref|XP_003452182.2|  PREDICTED: lipoyl synthase, mitochondrial-like     202   2e-58    
ref|XP_001699662.1|  lipoic acid synthetase                             202   3e-58    Chlamydomonas reinhardtii
emb|CEF98458.1|  Radical SAM                                            200   3e-58    Ostreococcus tauri
ref|XP_002956597.1|  hypothetical protein VOLCADRAFT_43591              199   3e-58    Volvox carteri f. nagariensis
ref|XP_010572846.1|  PREDICTED: lipoyl synthase, mitochondrial          202   3e-58    Haliaeetus leucocephalus
ref|XP_002778818.1|  lipoic acid synthase precursor, putative           199   3e-58    Perkinsus marinus ATCC 50983
ref|XP_005501430.1|  PREDICTED: lipoyl synthase, mitochondrial          201   3e-58    
ref|NP_001085534.1|  lipoyl synthase, mitochondrial                     201   3e-58    Xenopus laevis [clawed frog]
gb|KFO64951.1|  hypothetical protein N302_04047                         200   3e-58    Corvus brachyrhynchos
ref|XP_006787315.1|  PREDICTED: lipoyl synthase, mitochondrial-like     201   3e-58    Neolamprologus brichardi [lyretail cichlid]
ref|XP_009883302.1|  PREDICTED: lipoyl synthase, mitochondrial          201   4e-58    Charadrius vociferus
ref|XP_004065786.1|  PREDICTED: lipoyl synthase, mitochondrial          201   4e-58    Oryzias latipes [Japanese rice fish]
ref|XP_005490601.1|  PREDICTED: lipoyl synthase, mitochondrial          203   4e-58    
ref|XP_005030883.1|  PREDICTED: lipoyl synthase, mitochondrial          200   4e-58    
ref|XP_006011271.1|  PREDICTED: lipoyl synthase, mitochondrial is...    201   4e-58    
gb|KFQ94486.1|  hypothetical protein Y956_08279                         199   4e-58    Nipponia nippon
ref|XP_006504257.1|  PREDICTED: lipoyl synthase, mitochondrial is...    198   5e-58    
ref|XP_004910979.1|  PREDICTED: lipoyl synthase, mitochondrial-like     200   5e-58    Xenopus tropicalis [western clawed frog]
emb|CCU98976.1|  unnamed protein product                                200   5e-58    Malassezia sympodialis ATCC 42132
gb|KFP18031.1|  hypothetical protein Z169_05668                         199   5e-58    Egretta garzetta
ref|XP_001418286.1|  predicted protein                                  201   5e-58    Ostreococcus lucimarinus CCE9901
ref|XP_007945361.1|  PREDICTED: lipoyl synthase, mitochondrial-like     197   5e-58    Orycteropus afer afer
gb|ETL84350.1|  lipoyl synthase, mitochondrial                          200   6e-58    Phytophthora parasitica
ref|XP_002899048.1|  lipoic acid synthetase, mitochondrial precursor    200   6e-58    Phytophthora infestans T30-4
ref|XP_010708614.1|  PREDICTED: lipoyl synthase, mitochondrial          200   6e-58    Meleagris gallopavo [common turkey]
ref|XP_001374049.1|  PREDICTED: lipoyl synthase, mitochondrial          200   7e-58    Monodelphis domestica
ref|XP_004564359.1|  PREDICTED: lipoyl synthase, mitochondrial-like     200   7e-58    
ref|XP_009894883.1|  PREDICTED: lipoyl synthase, mitochondrial          200   7e-58    Picoides pubescens
ref|XP_004396213.1|  PREDICTED: lipoyl synthase, mitochondrial          200   7e-58    Odobenus rosmarus divergens
ref|XP_009460123.1|  PREDICTED: lipoyl synthase, mitochondrial          199   7e-58    Nipponia nippon
ref|XP_010400474.1|  PREDICTED: lipoyl synthase, mitochondrial          199   7e-58    
emb|CBY38287.1|  unnamed protein product                                199   7e-58    Oikopleura dioica
emb|CBY20860.1|  unnamed protein product                                199   8e-58    Oikopleura dioica
ref|XP_005286416.1|  PREDICTED: lipoyl synthase, mitochondrial is...    199   8e-58    Chrysemys picta bellii
ref|XP_423226.3|  PREDICTED: lipoyl synthase, mitochondrial isofo...    200   9e-58    
gb|EPX74142.1|  lipoic acid synthetase                                  199   1e-57    Schizosaccharomyces octosporus yFS286
gb|ERE87602.1|  lipoyl synthase                                         196   1e-57    Cricetulus griseus [Chinese hamsters]
ref|XP_003972216.1|  PREDICTED: lipoyl synthase, mitochondrial-like     200   1e-57    
gb|KFO99312.1|  hypothetical protein N300_04072                         199   1e-57    Calypte anna
ref|XP_009639591.1|  PREDICTED: lipoyl synthase, mitochondrial          199   1e-57    Egretta garzetta
ref|XP_005286415.1|  PREDICTED: lipoyl synthase, mitochondrial is...    200   1e-57    Chrysemys picta bellii
gb|EPB85254.1|  lipoyl synthase, mitochondrial                          199   1e-57    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005741202.1|  PREDICTED: lipoyl synthase, mitochondrial-like     199   1e-57    
ref|NP_001012037.1|  lipoyl synthase, mitochondrial precursor           199   1e-57    Rattus norvegicus [brown rat]
ref|XP_008490116.1|  PREDICTED: lipoyl synthase, mitochondrial          199   1e-57    Calypte anna
gb|KFO80379.1|  hypothetical protein N303_08395                         198   1e-57    Cuculus canorus
ref|XP_001632487.1|  predicted protein                                  198   1e-57    Nematostella vectensis
ref|XP_008639723.1|  PREDICTED: lipoyl synthase, mitochondrial          199   1e-57    
gb|KGL80416.1|  hypothetical protein N309_03875                         197   2e-57    Tinamus guttatus
ref|XP_006029302.1|  PREDICTED: lipoyl synthase, mitochondrial          199   2e-57    
gb|EWM28169.1|  lipoic acid synthetase                                  199   2e-57    Nannochloropsis gaditana
ref|XP_008831461.1|  PREDICTED: lipoyl synthase, mitochondrial is...    199   2e-57    Nannospalax galili
ref|XP_010217486.1|  PREDICTED: lipoyl synthase, mitochondrial          197   2e-57    Tinamus guttatus
ref|XP_007612770.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-57    
ref|XP_009564868.1|  PREDICTED: lipoyl synthase, mitochondrial          198   2e-57    Cuculus canorus
gb|EDL37740.1|  lipoic acid synthetase, isoform CRA_b                   197   2e-57    Mus musculus [mouse]
ref|XP_001659989.1|  AAEL009368-PA                                      199   2e-57    Aedes aegypti
ref|XP_011390992.1|  hypothetical protein UMAG_11549                    206   2e-57    Ustilago maydis 521
ref|XP_003471593.1|  PREDICTED: lipoyl synthase, mitochondrial          198   2e-57    Cavia porcellus [guinea pig]
ref|XP_004681401.1|  PREDICTED: lipoyl synthase, mitochondrial          198   2e-57    Condylura cristata
emb|CCX04952.1|  Similar to Lipoyl synthase, mitochondrial; acc. ...    199   3e-57    Pyronema omphalodes CBS 100304
ref|XP_007605726.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-57    Cricetulus griseus [Chinese hamsters]
ref|XP_008315124.1|  PREDICTED: lipoyl synthase, mitochondrial          199   3e-57    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005149243.1|  PREDICTED: lipoyl synthase, mitochondrial          198   4e-57    Melopsittacus undulatus
ref|XP_005435425.1|  PREDICTED: lipoyl synthase, mitochondrial          198   4e-57    
ref|XP_006732375.1|  PREDICTED: lipoyl synthase, mitochondrial is...    198   4e-57    Leptonychotes weddellii
ref|NP_077791.1|  lipoyl synthase, mitochondrial precursor              198   4e-57    Mus musculus [mouse]
ref|XP_005191392.1|  PREDICTED: lipoyl synthase, mitochondrial          198   4e-57    Musca domestica
ref|XP_002181691.1|  predicted protein                                  196   5e-57    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008580203.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   5e-57    Galeopterus variegatus [Malayan flying lemur]
ref|XP_005243299.1|  PREDICTED: lipoyl synthase, mitochondrial          198   5e-57    
ref|XP_007426516.1|  PREDICTED: lipoyl synthase, mitochondrial is...    198   5e-57    Python bivittatus
ref|XP_004009824.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   5e-57    Ovis aries [domestic sheep]
ref|XP_005359323.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   6e-57    Microtus ochrogaster [prairie voles]
ref|XP_010978683.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   6e-57    Camelus dromedarius [camel]
ref|XP_002047613.1|  GJ11834                                            195   6e-57    
ref|XP_536255.1|  PREDICTED: lipoyl synthase, mitochondrial isofo...    197   6e-57    Canis lupus familiaris [dogs]
ref|XP_006129607.1|  PREDICTED: lipoyl synthase, mitochondrial          198   6e-57    
ref|XP_006189037.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   6e-57    Camelus ferus
ref|XP_008276634.1|  PREDICTED: lipoyl synthase, mitochondrial          198   6e-57    Stegastes partitus
ref|XP_004703221.1|  PREDICTED: lipoyl synthase, mitochondrial          197   7e-57    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005319979.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   7e-57    Ictidomys tridecemlineatus
ref|XP_001702321.1|  lipoic acid synthetase                             196   7e-57    Chlamydomonas reinhardtii
ref|XP_010382782.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   7e-57    Rhinopithecus roxellana
gb|EIE77277.1|  hypothetical protein RO3G_01981                         198   7e-57    Rhizopus delemar RA 99-880
ref|XP_010776311.1|  PREDICTED: lipoyl synthase, mitochondrial          197   7e-57    Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006169324.1|  PREDICTED: lipoyl synthase, mitochondrial          198   8e-57    
ref|XP_001732059.1|  hypothetical protein MGL_0652                      196   8e-57    Malassezia globosa CBS 7966
ref|XP_007066486.1|  PREDICTED: lipoyl synthase, mitochondrial          199   8e-57    
ref|XP_003060743.1|  predicted protein                                  195   8e-57    Micromonas pusilla CCMP1545
ref|XP_007887310.1|  PREDICTED: lipoyl synthase, mitochondrial          197   8e-57    Callorhinchus milii [Australian ghost shark]
ref|XP_005554757.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   9e-57    Macaca fascicularis [crab eating macaque]
ref|XP_003773359.1|  PREDICTED: lipoyl synthase, mitochondrial          197   9e-57    Sarcophilus harrisii
ref|NP_001103871.1|  lipoyl synthase, mitochondrial                     197   9e-57    Danio rerio [leopard danio]
ref|XP_006258548.1|  PREDICTED: lipoyl synthase, mitochondrial          198   9e-57    
dbj|GAN00642.1|  lipoyl synthase, mitochondrial                         198   9e-57    Mucor ambiguus
ref|XP_006680624.1|  hypothetical protein BATDEDRAFT_13027              196   9e-57    Batrachochytrium dendrobatidis JAM81
ref|NP_001248031.1|  lipoyl synthase, mitochondrial                     197   9e-57    Macaca mulatta [rhesus macaque]
sp|Q6PHG4.1|LIAS_DANRE  RecName: Full=Lipoyl synthase, mitochondr...    197   9e-57    Danio rerio [leopard danio]
ref|XP_003985482.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    197   9e-57    
emb|CBQ69085.1|  related to LIP5-lipoic acid synthase                   204   1e-56    Sporisorium reilianum SRZ2
ref|XP_010623415.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   1e-56    Fukomys damarensis [Damara mole rat]
gb|KFU95968.1|  hypothetical protein M959_04245                         196   1e-56    Chaetura pelagica
ref|XP_008699635.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   1e-56    Ursus maritimus [white bear]
ref|XP_002504861.1|  predicted protein                                  195   1e-56    Micromonas commoda
ref|XP_006571537.1|  PREDICTED: lipoyl synthase, mitochondrial          196   1e-56    
ref|XP_005897411.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   1e-56    Bos mutus
dbj|GAM18868.1|  hypothetical protein SAMD00019534_020430               198   1e-56    Acytostelium subglobosum LB1
ref|XP_003258640.1|  PREDICTED: lipoyl synthase, mitochondrial is...    197   1e-56    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_007670123.1|  PREDICTED: lipoyl synthase, mitochondrial          197   1e-56    
ref|NP_001017944.1|  lipoyl synthase, mitochondrial precursor           197   1e-56    Bos taurus [bovine]
ref|XP_002814728.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   1e-56    Pongo abelii [orang utan]
emb|CEP10066.1|  hypothetical protein                                   197   1e-56    Parasitella parasitica
gb|KIY99331.1|  lipoic acid synthetase                                  191   1e-56    Monoraphidium neglectum
ref|XP_003411445.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   1e-56    Loxodonta africana [African bush elephant]
ref|XP_007098937.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   1e-56    Panthera tigris altaica
ref|XP_004475564.1|  PREDICTED: lipoyl synthase, mitochondrial          196   1e-56    
ref|XP_005518086.1|  PREDICTED: lipoyl synthase, mitochondrial          197   1e-56    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004642696.1|  PREDICTED: lipoyl synthase, mitochondrial          196   1e-56    Octodon degus
ref|XP_006974666.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-56    Peromyscus maniculatus bairdii
dbj|BAM19535.1|  lipoic acid synthase                                   192   2e-56    Papilio xuthus [Chinese swallowtail]
ref|XP_005644292.1|  Lipoyl synthase                                    194   2e-56    Coccomyxa subellipsoidea C-169
ref|XP_526552.2|  PREDICTED: lipoyl synthase, mitochondrial isofo...    196   2e-56    Pan troglodytes
ref|XP_003489933.1|  PREDICTED: lipoyl synthase, mitochondrial-like     197   2e-56    Bombus impatiens
ref|XP_008015804.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-56    Chlorocebus sabaeus
ref|XP_002925215.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-56    Ailuropoda melanoleuca
ref|XP_006066201.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-56    Bubalus bubalis [domestic water buffalo]
ref|XP_003695502.1|  PREDICTED: lipoyl synthase, mitochondrial-like     196   2e-56    Apis florea [dwarf honeybee]
ref|XP_007522861.1|  PREDICTED: lipoyl synthase, mitochondrial          196   2e-56    Erinaceus europaeus [common hedgehog]
ref|NP_006850.2|  lipoyl synthase, mitochondrial isoform 1 precursor    196   2e-56    Homo sapiens [man]
emb|CEG65422.1|  Putative Lipoic acid synthetase                        194   2e-56    Rhizopus microsporus
ref|XP_005681577.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   2e-56    
gb|EHJ72263.1|  hypothetical protein KGM_05108                          196   2e-56    
ref|XP_009042726.1|  hypothetical protein AURANDRAFT_14185              194   2e-56    Aureococcus anophagefferens
ref|XP_010004454.1|  PREDICTED: lipoyl synthase, mitochondrial          196   2e-56    Chaetura pelagica
ref|XP_007719229.1|  lipoyl synthase, mitochondrial                     197   2e-56    Capronia coronata CBS 617.96
ref|XP_004419045.1|  PREDICTED: lipoyl synthase, mitochondrial          196   3e-56    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008138448.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-56    Eptesicus fuscus
ref|XP_007612769.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-56    
ref|XP_005961063.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-56    Pantholops hodgsonii [Tibetan antelope]
emb|CEF97617.1|  Radical SAM                                            196   3e-56    
ref|XP_004384724.1|  PREDICTED: lipoyl synthase, mitochondrial          196   3e-56    
ref|XP_002436243.1|  lipoic acid synthase, putative                     192   3e-56    
ref|XP_006088561.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-56    
ref|XP_001498146.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   3e-56    
ref|XP_003515359.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   4e-56    
ref|XP_002709320.1|  PREDICTED: lipoyl synthase, mitochondrial is...    196   4e-56    
ref|XP_006220318.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    195   4e-56    
ref|XP_002085654.1|  GD12187                                            195   4e-56    
ref|XP_001957274.1|  GF24134                                            196   4e-56    
ref|XP_006616173.1|  PREDICTED: lipoyl synthase, mitochondrial-li...    195   4e-56    
ref|XP_006616172.1|  PREDICTED: lipoyl synthase, mitochondrial-li...    195   4e-56    
ref|XP_003898642.1|  PREDICTED: lipoyl synthase, mitochondrial is...    195   4e-56    
ref|XP_002095457.1|  GE22400                                            195   4e-56    
ref|XP_009038982.1|  hypothetical protein AURANDRAFT_29425              196   4e-56    
ref|XP_004579208.1|  PREDICTED: lipoyl synthase, mitochondrial          195   5e-56    
ref|XP_002040667.1|  GM22215                                            195   5e-56    
gb|EPY49264.1|  lipoic acid synthetase                                  195   5e-56    
ref|XP_006922504.1|  PREDICTED: lipoyl synthase, mitochondrial          195   5e-56    
ref|XP_009204948.1|  PREDICTED: lipoyl synthase, mitochondrial is...    195   5e-56    
ref|XP_002086625.1|  GE22745                                            195   5e-56    
ref|XP_006873278.1|  PREDICTED: lipoyl synthase, mitochondrial is...    195   5e-56    
ref|XP_011194961.1|  PREDICTED: lipoyl synthase, mitochondrial          196   6e-56    
emb|CEG65421.1|  Putative Lipoic acid synthetase                        196   6e-56    
ref|XP_007880300.1|  hypothetical protein PFL1_04583                    202   7e-56    
gb|EHH53622.1|  Lipoyl synthase, mitochondrial                          195   7e-56    
ref|XP_005045440.1|  PREDICTED: lipoyl synthase, mitochondrial          198   7e-56    
ref|XP_002990181.1|  hypothetical protein SELMODRAFT_185127             194   7e-56    
ref|XP_005093392.1|  PREDICTED: lipoyl synthase, mitochondrial-like     195   7e-56    
ref|XP_004814045.1|  PREDICTED: lipoyl synthase, mitochondrial          194   8e-56    
gb|AAH23635.1|  Lipoic acid synthetase                                  194   8e-56    
ref|XP_002008396.1|  GI13471                                            194   8e-56    
gb|EIE87647.1|  hypothetical protein RO3G_12358                         195   8e-56    
ref|XP_004608076.1|  PREDICTED: lipoyl synthase, mitochondrial          194   8e-56    
sp|B6K4J2.1|LIPA_SCHJY  RecName: Full=Lipoyl synthase, mitochondr...    194   8e-56    
ref|XP_002174692.2|  lipoic acid synthetase                             195   1e-55    
emb|CCA20116.1|  lipoic acid synthetase putative                        195   1e-55    
ref|XP_011361042.1|  PREDICTED: lipoyl synthase, mitochondrial is...    194   1e-55    
gb|ESA06017.1|  hypothetical protein GLOINDRAFT_99456                   195   1e-55    
ref|XP_007113946.1|  PREDICTED: lipoyl synthase, mitochondrial is...    193   1e-55    
ref|XP_002992506.1|  hypothetical protein SELMODRAFT_186771             194   1e-55    
ref|NP_001230391.1|  lipoic acid synthetase                             194   1e-55    
ref|XP_004266292.1|  PREDICTED: lipoyl synthase, mitochondrial          194   1e-55    
gb|AEX88628.1|  lipoic acid synthetase                                  194   1e-55    
gb|EXX53006.1|  putative lipoate synthase                               195   1e-55    
ref|XP_007449480.1|  PREDICTED: lipoyl synthase, mitochondrial is...    194   1e-55    
gb|ADQ32257.1|  lipoic acid synthetase                                  194   1e-55    
dbj|BAC27579.1|  unnamed protein product                                194   1e-55    
ref|XP_004223570.1|  lipoyl synthase                                    195   1e-55    
gb|KIY00250.1|  lipoyl synthase, mitochondrial                          195   1e-55    
dbj|BAO40685.1|  lipoyl synthase                                        194   1e-55    
ref|XP_001845830.1|  lipoic acid synthase                               194   2e-55    
emb|CDI55154.1|  related to LIP5-lipoic acid synthase                   201   2e-55    
ref|XP_007730428.1|  lipoyl synthase, mitochondrial                     195   2e-55    
ref|XP_011205668.1|  PREDICTED: lipoyl synthase, mitochondrial          194   2e-55    
ref|XP_009158115.1|  lipoyl synthase, mitochondrial                     195   2e-55    
gb|KIW78976.1|  lipoyl synthase, mitochondrial                          194   2e-55    
gb|KIW25010.1|  lipoyl synthase, mitochondrial                          194   2e-55    
ref|XP_007113945.1|  PREDICTED: lipoyl synthase, mitochondrial is...    193   2e-55    
ref|XP_673203.1|  lipoate synthase                                      192   2e-55    
ref|XP_004332277.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    193   2e-55    
ref|NP_524183.2|  lipoic acid synthase                                  193   2e-55    
ref|XP_008622499.1|  lipoyl synthase, apicoplast                        195   3e-55    
ref|XP_008721960.1|  lipoyl synthase, mitochondrial                     194   3e-55    
ref|XP_005666641.1|  PREDICTED: lipoic acid synthetase isoform X2       194   3e-55    
ref|XP_001354122.1|  GA18753                                            193   3e-55    
gb|AAL13786.1|  LD24887p                                                193   3e-55    
ref|XP_005666640.1|  PREDICTED: lipoic acid synthetase isoform X1       194   3e-55    
ref|XP_003927573.1|  PREDICTED: lipoyl synthase, mitochondrial          193   3e-55    
ref|XP_005710221.1|  Lipoate synthase                                   191   3e-55    
ref|XP_002745951.1|  PREDICTED: lipoyl synthase, mitochondrial is...    193   3e-55    
ref|XP_006814380.1|  PREDICTED: lipoyl synthase, mitochondrial-like     193   4e-55    
ref|XP_007512419.1|  predicted protein                                  195   5e-55    
gb|KDR07551.1|  Lipoyl synthase, mitochondrial                          192   5e-55    
ref|XP_002836453.1|  hypothetical protein                               194   5e-55    
gb|KIW73670.1|  lipoyl synthase, mitochondrial                          194   6e-55    
ref|XP_003392941.1|  PREDICTED: lipoyl synthase, mitochondrial-like     193   6e-55    
ref|XP_008067976.1|  PREDICTED: lipoyl synthase, mitochondrial is...    192   6e-55    
ref|XP_003221569.2|  PREDICTED: lipoyl synthase, mitochondrial          193   6e-55    
dbj|GAC77712.1|  lipoate synthase                                       199   6e-55    
ref|XP_007752541.1|  lipoyl synthase, mitochondrial                     193   7e-55    
gb|EGI64150.1|  Lipoyl synthase, mitochondrial                          188   7e-55    
ref|XP_007178869.1|  PREDICTED: lipoyl synthase, mitochondrial is...    192   7e-55    
ref|XP_314540.4|  AGAP010568-PA                                         192   8e-55    
ref|XP_003079989.1|  lipoic acid synthase (ISS)                         199   8e-55    
gb|ELU44382.1|  lipoic acid synthase                                    187   8e-55    
dbj|GAC93218.1|  hypothetical protein PHSY_000781                       199   9e-55    
emb|CCU77425.1|  putative lipoic acid synthase                          192   9e-55    
ref|XP_009027550.1|  hypothetical protein HELRODRAFT_185116             191   9e-55    
gb|EST08888.1|  hypothetical protein PSEUBRA_SCAF14g01669               197   9e-55    
gb|ETS60276.1|  hypothetical protein PaG_05827                          198   1e-54    
ref|XP_001790961.1|  hypothetical protein SNOG_00270                    192   1e-54    
gb|EUD71755.1|  lipoyl synthase, apicoplast                             194   1e-54    
ref|XP_002120599.1|  PREDICTED: lipoyl synthase, mitochondrial-like     191   1e-54    
gb|KFB38613.1|  AGAP010568-PA-like protein                              192   1e-54    
ref|XP_001973489.1|  GG13311                                            192   1e-54    
ref|XP_002286650.1|  lipoic acid synthetase                             189   1e-54    
gb|ELU13623.1|  hypothetical protein CAPTEDRAFT_176739                  191   1e-54    
ref|XP_001417274.1|  predicted protein                                  190   1e-54    
ref|XP_011277160.1|  hypothetical protein BN7_665                       192   1e-54    
gb|ETN62407.1|  lipoic acid synthetase                                  192   1e-54    
emb|CBJ31058.1|  lipoate synthase                                       189   2e-54    
ref|XP_002641488.1|  Hypothetical protein CBG09779                      191   2e-54    
ref|XP_003388352.1|  PREDICTED: lipoyl synthase, mitochondrial-like     191   2e-54    
gb|EJK62255.1|  hypothetical protein THAOC_17138                        192   2e-54    
dbj|GAK66421.1|  mitochondrial Lipoyl synthase                          197   2e-54    
emb|CDR16050.1|  lipoyl synthase, putative                              193   2e-54    
ref|XP_011172572.1|  PREDICTED: lipoyl synthase, mitochondrial          187   2e-54    
ref|NP_497722.3|  Protein M01F1.3                                       190   2e-54    
ref|XP_002426395.1|  lipoic acid synthetase, putative                   193   3e-54    
ref|XP_002065849.1|  GK17689                                            190   3e-54    
ref|XP_007742948.1|  lipoyl synthase, mitochondrial                     192   3e-54    
gb|KFR11447.1|  hypothetical protein N306_13424                         189   3e-54    
gb|ETB62644.1|  lipoyl synthase, apicoplast                             192   3e-54    
ref|XP_011311370.1|  PREDICTED: lipoyl synthase, mitochondrial          190   3e-54    
ref|XP_001984904.1|  GH16746                                            190   3e-54    
ref|XP_003112909.1|  hypothetical protein CRE_25164                     190   3e-54    
emb|CDS51017.1|  lipoyl synthase                                        192   3e-54    
gb|EHB16208.1|  Lipoyl synthase, mitochondrial                          190   4e-54    
ref|XP_726810.1|  lipoic acid synthetase                                193   5e-54    
ref|XP_009933856.1|  PREDICTED: lipoyl synthase, mitochondrial          189   5e-54    
gb|KEP54071.1|  lipoic acid synthase                                    190   5e-54    
dbj|GAM87085.1|  hypothetical protein ANO11243_051060                   191   5e-54    
ref|XP_001643375.1|  hypothetical protein Kpol_479p5                    186   5e-54    
ref|XP_011256526.1|  PREDICTED: lipoyl synthase, mitochondrial          190   6e-54    
ref|XP_002259908.1|  lipoate synthase                                   191   6e-54    
ref|XP_007923821.1|  hypothetical protein MYCFIDRAFT_162202             189   6e-54    
gb|AAG41240.1|AF210624_3  Lip5                                          183   7e-54    
gb|EUC61059.1|  lipoic acid synthase                                    190   7e-54    
ref|XP_001605463.2|  PREDICTED: lipoyl synthase, mitochondrial is...    189   9e-54    
ref|XP_011270386.1|  hypothetical protein CAOG_08756                    192   1e-53    
ref|XP_011137775.1|  PREDICTED: lipoyl synthase, mitochondrial          189   1e-53    
ref|XP_003424380.1|  PREDICTED: lipoyl synthase, mitochondrial is...    189   1e-53    
gb|EKV19150.1|  Lipoyl synthase, mitochondrial                          190   1e-53    
ref|XP_001754202.1|  predicted protein                                  189   1e-53    
ref|XP_011056443.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    189   1e-53    
gb|EOA93366.1|  Lipoyl synthase, mitochondrial                          188   1e-53    
ref|XP_011401089.1|  Lipoyl synthase, chloroplastic                     189   1e-53    
ref|XP_002287622.1|  lipoic acid synthetase                             189   1e-53    
emb|CDM31919.1|  Lipoyl synthase, mitochondrial                         190   1e-53    
gb|KDN40219.1|  Lipoyl synthase, mitochondrial                          189   1e-53    
ref|XP_004344202.1|  lipoyl synthase                                    190   2e-53    
ref|XP_754950.1|  lipoic acid synthetase precursor                      189   2e-53    
gb|KEF58660.1|  lipoyl synthase, mitochondrial                          189   2e-53    
emb|CEL63190.1|  lipoic acid synthetase                                 192   2e-53    
ref|XP_004665545.1|  PREDICTED: lipoyl synthase, mitochondrial-like     188   2e-53    
ref|XP_007297714.1|  lipoic acid synthase                               189   2e-53    
gb|KIX02064.1|  lipoyl synthase, mitochondrial                          189   2e-53    
gb|KIV81194.1|  lipoyl synthase, mitochondrial                          189   2e-53    
gb|EPQ64737.1|  hypothetical protein BGT96224_2848                      189   2e-53    
gb|KGO75357.1|  Aldolase-type TIM barrel                                189   3e-53    
ref|XP_004927741.1|  PREDICTED: lipoyl synthase, mitochondrial-like     188   3e-53    
ref|XP_007512984.1|  predicted protein                                  190   3e-53    
ref|XP_008815753.1|  lipoyl synthase, apicoplast                        190   3e-53    
gb|ETW55587.1|  lipoyl synthase, apicoplast                             188   3e-53    
gb|KGO45190.1|  Elongator protein 3/MiaB/NifB                           189   3e-53    
gb|ETW47383.1|  lipoyl synthase, apicoplast                             188   3e-53    
gb|ETW34648.1|  lipoyl synthase, apicoplast                             188   3e-53    
emb|CDO66230.1|  lipoyl synthase, putative                              189   3e-53    
ref|XP_001945618.1|  PREDICTED: lipoyl synthase, mitochondrial is...    187   4e-53    
emb|CDY60229.1|  BnaA03g55730D                                          188   4e-53    
ref|XP_002609221.1|  hypothetical protein BRAFLDRAFT_125969             187   4e-53    
ref|XP_009131066.1|  PREDICTED: lipoyl synthase, chloroplastic          188   4e-53    
ref|XP_001614224.1|  lipoyl synthase                                    189   4e-53    
gb|KEY76375.1|  lipoic acid synthetase                                  188   4e-53    
gb|KIN07584.1|  hypothetical protein OIDMADRAFT_151237                  188   5e-53    
ref|XP_011115165.1|  hypothetical protein H072_9607                     188   5e-53    
ref|XP_001350160.1|  lipoate synthase, putative                         188   5e-53    
ref|XP_007372815.1|  hypothetical protein SPAPADRAFT_133253             187   5e-53    
gb|ETW59493.1|  lipoyl synthase, apicoplast                             188   6e-53    
gb|EZA50935.1|  Lipoyl synthase, mitochondrial                          187   6e-53    
ref|XP_005841279.1|  hypothetical protein GUITHDRAFT_83954              186   6e-53    
gb|EMP29566.1|  Lipoyl synthase                                         187   7e-53    
ref|XP_678238.1|  hypothetical protein                                  186   7e-53    
emb|CCF48320.1|  related to LIP5-lipoic acid synthase                   193   7e-53    
ref|XP_005828347.1|  hypothetical protein GUITHDRAFT_158225             186   7e-53    
gb|ERL95510.1|  hypothetical protein D910_12772                         187   7e-53    
ref|XP_006670098.1|  lipoic acid synthetase                             188   7e-53    
ref|XP_011344204.1|  PREDICTED: lipoyl synthase, mitochondrial          187   8e-53    
gb|KIW45500.1|  lipoyl synthase, mitochondrial                          189   8e-53    
emb|CDX81104.1|  BnaC03g03580D                                          187   9e-53    
gb|ENN83412.1|  hypothetical protein YQE_00229                          186   9e-53    
emb|CAF94211.1|  unnamed protein product                                186   1e-52    
gb|KIW96361.1|  lipoyl synthase, mitochondrial                          188   1e-52    
ref|XP_004522406.1|  PREDICTED: lipoyl synthase, mitochondrial-like     187   1e-52    
ref|XP_002383943.1|  lipoic acid synthetase precursor                   187   1e-52    
gb|ADD24517.1|  Lipoyl synthase, mitochondrial                          186   1e-52    
ref|XP_001824676.1|  lipoyl synthase                                    187   1e-52    
ref|XP_003323073.1|  lipoyl synthase                                    186   1e-52    
gb|EGT53315.1|  hypothetical protein CAEBREN_31948                      186   1e-52    
ref|XP_007410830.1|  hypothetical protein MELLADRAFT_72050              186   1e-52    
ref|XP_005392040.1|  PREDICTED: lipoyl synthase, mitochondrial is...    186   2e-52    
gb|EME38626.1|  hypothetical protein DOTSEDRAFT_75404                   187   2e-52    
ref|XP_003703828.1|  PREDICTED: lipoyl synthase, mitochondrial-like     186   2e-52    
gb|EFB17888.1|  hypothetical protein PANDA_014664                       185   2e-52    
ref|XP_001270674.1|  lipoic acid synthetase precursor                   187   2e-52    
gb|ENN80469.1|  hypothetical protein YQE_03109                          185   2e-52    
ref|XP_002562872.1|  Pc20g03200                                         187   2e-52    
emb|CAP29335.3|  Protein CBR-RPL-16                                     190   2e-52    
emb|CEP64109.1|  LALA0S10e02476g1_1                                     186   2e-52    
ref|XP_008546620.1|  PREDICTED: lipoyl synthase, mitochondrial          185   2e-52    
ref|XP_003724473.1|  PREDICTED: LOW QUALITY PROTEIN: lipoyl synth...    186   3e-52    
ref|XP_005877506.1|  PREDICTED: LOW QUALITY PROTEIN: lipoic acid ...    185   3e-52    
ref|XP_001217348.1|  lipoic acid synthetase, mitochondrial precursor    184   3e-52    
gb|KIW49073.1|  lipoyl synthase, mitochondrial                          186   3e-52    
gb|KFM59635.1|  Lipoyl synthase, mitochondrial                          186   3e-52    
ref|XP_001263796.1|  lipoic acid synthetase precursor                   186   3e-52    
ref|XP_002545384.1|  lipoic acid synthetase, mitochondrial precursor    185   4e-52    
gb|KIW07476.1|  lipoyl synthase, mitochondrial                          186   4e-52    
ref|XP_002117516.1|  expressed hypothetical protein                     184   4e-52    
emb|CDW60587.1|  lipoyl synthase, mitochondrial                         184   4e-52    
gb|KIO18641.1|  hypothetical protein M407DRAFT_31717                    185   4e-52    
emb|CDQ01259.1|  Protein Bm5051                                         184   5e-52    
ref|XP_002486109.1|  lipoic acid synthetase precursor                   186   5e-52    
ref|XP_003958377.1|  hypothetical protein KAFR_0G02080                  184   6e-52    
dbj|BAA21430.1|  LIPOIC ACID SYNTHETASE PRECURSOR(LIP-SYN)              182   6e-52    
ref|XP_002456408.1|  hypothetical protein SORBIDRAFT_03g035760          184   6e-52    
ref|XP_007782969.1|  lipoyl synthase, mitochondrial                     186   6e-52    
ref|XP_010424725.1|  PREDICTED: lipoyl synthase, chloroplastic-like     184   6e-52    
ref|XP_002177558.1|  predicted protein                                  185   7e-52    
ref|XP_005707307.1|  lipoic acid synthetase                             184   7e-52    



>ref|XP_009587293.1| PREDICTED: lipoyl synthase 2, mitochondrial-like, partial [Nicotiana 
tomentosiformis]
Length=244

 Score =   325 bits (832),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 159/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQ VVRDHRANFKQSMDVLMMAKD AP
Sbjct  81   ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQRVVRDHRANFKQSMDVLMMAKDCAP  140

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRP+KRHMPVSEY+TPEAFE
Sbjct  141  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPTKRHMPVSEYVTPEAFE  200

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+VLGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  201  NYRVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  242



>ref|XP_004243321.1| PREDICTED: lipoyl synthase, mitochondrial [Solanum lycopersicum]
Length=380

 Score =   326 bits (836),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 154/164 (94%), Positives = 159/164 (97%), Gaps = 0/164 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGDP CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAK+YAP
Sbjct  217  ALTPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EYITPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPEQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVTEYITPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             YQVLG QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL+
Sbjct  337  NYQVLGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLS  380



>ref|XP_009771704.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana sylvestris]
Length=385

 Score =   325 bits (834),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/162 (96%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGDP CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAKDYAP
Sbjct  222  ALTPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKDYAP  281

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVVKTMEKVRA GVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  282  AGTLTKTSIMLGCGETPEQVVKTMEKVRATGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  341

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+VLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  342  NYRVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  383



>ref|XP_009778191.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Nicotiana sylvestris]
Length=384

 Score =   325 bits (833),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKVAKSGLDVFAHNIETVEELQ VVRDHRANFKQSMDVLMMAKD AP
Sbjct  221  ALVPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQRVVRDHRANFKQSMDVLMMAKDCAP  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRP+KRHMPVSEYITPEAFE
Sbjct  281  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPTKRHMPVSEYITPEAFE  340

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+VLGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  341  NYRVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  382



>ref|XP_006357526.1| PREDICTED: lipoyl synthase, mitochondrial-like [Solanum tuberosum]
Length=380

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGDP CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAK+YAP
Sbjct  217  ALTPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EYITPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPEQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVTEYITPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             YQVLG QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  337  NYQVLGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  378



>sp|Q3LSN4.1|LIAS1_PEA RecName: Full=Lipoyl synthase 1, mitochondrial; AltName: Full=Lipoate 
synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoic 
acid synthase 1; Flags: Precursor [Pisum sativum]
 gb|ABA29156.1| putative lipoic acid synthase [Pisum sativum]
Length=376

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKEYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRAAS
Sbjct  334  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAAS  375



>ref|XP_011072065.1| PREDICTED: lipoyl synthase 2, mitochondrial [Sesamum indicum]
Length=382

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS+DVL+MAKDYAP
Sbjct  219  ALVPDFRGNSGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSLDVLVMAKDYAP  278

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  279  PGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  338

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  339  KYRTLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  380



>emb|CDP14732.1| unnamed protein product [Coffea canephora]
Length=375

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGLDVFAHNIETVEELQSVVRDHRANF+QSMDVLM AKDYAP
Sbjct  212  ALVPDFRGDPSCVEKVATSGLDVFAHNIETVEELQSVVRDHRANFEQSMDVLMKAKDYAP  271

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHM VSEYITPEAFE
Sbjct  272  VGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMSVSEYITPEAFE  331

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+VLGM+MGFRYVASGPMVRSSYKAGE+YIKSMI+SDRAAS
Sbjct  332  KYRVLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIQSDRAAS  373



>ref|XP_003540350.1| PREDICTED: lipoyl synthase 2, mitochondrial [Glycine max]
Length=382

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS+DVLMMAK+ AP
Sbjct  214  ALVPDFRGDADCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSLDVLMMAKENAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF+
Sbjct  274  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFD  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  334  KYQKLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  375



>ref|XP_009621653.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128} 
[Nicotiana tomentosiformis]
Length=383

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDF GDP CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAKDYAP
Sbjct  220  ALTPDFLGDPGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKDYAP  279

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  280  AGTLTKTSIMLGCGETPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+VLG QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  340  NYRVLGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  381



>gb|KJB79957.1| hypothetical protein B456_013G074500 [Gossypium raimondii]
Length=377

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQ VVRDHRANFKQS+DVLMMAK+YAP
Sbjct  214  ALVPDFRGDAGCVEKVAKSGLDVFAHNIETVEELQRVVRDHRANFKQSLDVLMMAKEYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+A+
Sbjct  334  KYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSAA  375



>ref|XP_004245423.1| PREDICTED: lipoyl synthase 1, mitochondrial-like [Solanum lycopersicum]
Length=313

 Score =   320 bits (819),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/161 (93%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            + PDFRGDP CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAK+YAPA
Sbjct  151  VAPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKEYAPA  210

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
            GTLTKTSIMLGCGETP+QVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EYITPEAFE 
Sbjct  211  GTLTKTSIMLGCGETPEQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVTEYITPEAFEN  270

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            YQV G QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  271  YQVFGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  311



>ref|XP_010035697.1| PREDICTED: lipoyl synthase 2, mitochondrial [Eucalyptus grandis]
 gb|KCW47138.1| hypothetical protein EUGRSUZ_K00943 [Eucalyptus grandis]
Length=384

 Score =   322 bits (825),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDV AHNIETVEELQS VRDHRANFKQS+DVLMMAKDYAP
Sbjct  216  ALVPDFRGDSGCVEKVAKSGLDVLAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYAP  275

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+KTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  276  AGTLTKTSIMLGCGETPDQVIKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFD  335

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIE+DRA S
Sbjct  336  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIEADRAGS  377



>ref|XP_008230240.1| PREDICTED: lipoyl synthase 2, mitochondrial [Prunus mume]
Length=299

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKVA SGLDV AHNIETVEELQ  VRDHRANFKQS+DVLMMAKDYAP
Sbjct  132  ALVPDFRGDSSCVEKVATSGLDVLAHNIETVEELQRAVRDHRANFKQSLDVLMMAKDYAP  191

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  192  AGTLTKTSVMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  251

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRA S
Sbjct  252  KYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRATS  293



>sp|Q3LSN5.1|LIAS2_PEA RecName: Full=Lipoyl synthase 2, mitochondrial; AltName: Full=Lipoate 
synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoic 
acid synthase 2; Flags: Precursor [Pisum sativum]
 gb|ABA29155.1| putative lipoic acid synthase [Pisum sativum]
Length=376

 Score =   322 bits (824),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKEYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQ+MRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQHMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRAAS
Sbjct  334  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAAS  375



>ref|XP_007149469.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris]
 gb|ESW21463.1| hypothetical protein PHAVU_005G072800g [Phaseolus vulgaris]
Length=377

 Score =   321 bits (823),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQ+VVRDHRANFKQS+DVLMMAK+YA 
Sbjct  213  ALVPDFRGDADCVEKVAKSGLDVFAHNIETVEELQNVVRDHRANFKQSLDVLMMAKEYAS  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF 
Sbjct  273  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFN  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  333  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  374



>gb|EYU26119.1| hypothetical protein MIMGU_mgv1a008134mg [Erythranthe guttata]
Length=383

 Score =   321 bits (823),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS VRDHRANFKQSMDVLMMAK++AP
Sbjct  219  ALVPDFRGDSGCVEKVAKSGLDVFAHNIETVEELQSAVRDHRANFKQSMDVLMMAKEFAP  278

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMT GQYMRPSKRHMPVSEYITPEAFE
Sbjct  279  PGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTLGQYMRPSKRHMPVSEYITPEAFE  338

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ+LG QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA+S
Sbjct  339  KYQILGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRASS  380



>ref|XP_003543350.1| PREDICTED: lipoyl synthase 2, mitochondrial [Glycine max]
Length=378

 Score =   320 bits (820),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/161 (94%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQ+ VRDHRANFKQS+DVLMMAK+YAP
Sbjct  214  ALVPDFRGDADCVEKVAKSGLDVFAHNIETVEELQNFVRDHRANFKQSLDVLMMAKEYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF+
Sbjct  274  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFD  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA
Sbjct  334  KYQKLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  374



>emb|CBI38451.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS++VL +AK+YA 
Sbjct  5    ALVPDFRGDPGCVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFKQSLEVLKLAKEYAD  64

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  65   AGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  124

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*TS  220
            KY++LGM MGFRYVASGPMVRSSYKAGEFYIKSMI++DRA S A +S
Sbjct  125  KYRILGMDMGFRYVASGPMVRSSYKAGEFYIKSMIDADRAMSWASSS  171



>gb|KDP24175.1| hypothetical protein JCGZ_25832 [Jatropha curcas]
Length=377

 Score =   319 bits (818),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQ VVRDHRANF+QS+DVLMMAKD+AP
Sbjct  210  ALVPDFRGDSGCVEKVAKSGLDVFAHNIETVEELQRVVRDHRANFRQSLDVLMMAKDHAP  269

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETP+QVVKTMEKVRAAGVDVMTFGQYMRP+KRHMPVSEYITPEAFE
Sbjct  270  SGTLTKTSIMLGCGETPEQVVKTMEKVRAAGVDVMTFGQYMRPTKRHMPVSEYITPEAFE  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  330  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  371



>gb|AHM22930.1| lipoyl synthase [Nicotiana tabacum]
Length=385

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/162 (94%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDF GDP CV KVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVL MAKDYAP
Sbjct  222  ALTPDFLGDPGCVGKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLKMAKDYAP  281

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  282  AGTLTKTSIMLGCGETPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  341

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+VLG QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  342  NYRVLGTQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  383



>gb|KEH39087.1| lipoyl synthase [Medicago truncatula]
Length=378

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANF QS+DVL MAKDYAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFNQSLDVLRMAKDYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRA S
Sbjct  334  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAVS  375



>sp|B7FM45.1|LIAS_MEDTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Medicago truncatula]
 gb|ACJ85828.1| unknown [Medicago truncatula]
Length=378

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANF QS+DVL MAKDYAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFNQSLDVLRMAKDYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRA S
Sbjct  334  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAVS  375



>ref|XP_007215533.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica]
 gb|EMJ16732.1| hypothetical protein PRUPE_ppa007143mg [Prunus persica]
Length=380

 Score =   318 bits (816),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKVA SGLDV AHNIETVEELQ  VRDHRANFKQS+DVLMMAKDYAP
Sbjct  213  ALVPDFRGDSSCVEKVATSGLDVLAHNIETVEELQRAVRDHRANFKQSLDVLMMAKDYAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSVMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRA S
Sbjct  333  KYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRATS  374



>ref|XP_010095809.1| Lipoyl synthase [Morus notabilis]
 gb|EXB62277.1| Lipoyl synthase [Morus notabilis]
Length=384

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA SGLDV AHNIETVEELQS VRD RANFKQS+DVLMMAKDYAP
Sbjct  217  ALVPDFRGDSGCVEKVASSGLDVLAHNIETVEELQSSVRDRRANFKQSLDVLMMAKDYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  277  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFD  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+VLGM MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+AS
Sbjct  337  KYRVLGMDMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSAS  378



>ref|XP_007149882.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris]
 gb|ESW21876.1| hypothetical protein PHAVU_005G106700g [Phaseolus vulgaris]
Length=381

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQ+VVRDHRANFKQS+ VLMMAK+YAP
Sbjct  213  ALVPDFRGDDDCVEKVAKSGLDVFAHNIETVEELQNVVRDHRANFKQSLKVLMMAKEYAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP Q+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF 
Sbjct  273  AGTLTKTSIMLGCGETPGQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFN  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR AS
Sbjct  333  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRTAS  374



>ref|XP_004487312.1| PREDICTED: lipoyl synthase 2, mitochondrial-like [Cicer arietinum]
Length=380

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/159 (94%), Positives = 155/159 (97%), Gaps = 0/159 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  212  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKEYAP  271

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  272  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  331

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDR
Sbjct  332  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDR  370



>ref|XP_007043522.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao]
 gb|EOX99353.1| Lipoyl synthase, mitochondrial isoform 1 [Theobroma cacao]
Length=376

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CV KVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS+DVL+MAKD AP
Sbjct  213  ALVPDFRGEAGCVVKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSLDVLVMAKDCAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA+
Sbjct  333  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAA  374



>gb|AFK43632.1| unknown [Medicago truncatula]
Length=378

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/160 (93%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANF QS+DVL MAKDYAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFNQSLDVLRMAKDYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRA
Sbjct  334  KYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRA  373



>ref|XP_011025577.1| PREDICTED: lipoyl synthase, mitochondrial-like [Populus euphratica]
Length=385

 Score =   316 bits (810),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA SGLDVFAHNIETVEELQS VRDHRANFKQS+DVL+MAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVATSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLLMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP+QVVKTMEKVRAAG+DVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  AGTLTKTSIMLGCGETPEQVVKTMEKVRAAGIDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+AS
Sbjct  338  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSAS  379



>ref|XP_008356122.1| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase 2, mitochondrial-like 
[Malus domestica]
Length=380

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKVA SGLDV AHNIETVEELQ  VRDHRANFKQS+DVLMMAKD+AP
Sbjct  213  ALVPDFRGDSSCVEKVATSGLDVLAHNIETVEELQRAVRDHRANFKQSLDVLMMAKDHAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y+ LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIESDRA+S
Sbjct  333  RYRALGMEMGFRYVASGPMVRSSYKAGEYYIKSMIESDRASS  374



>gb|AFK48146.1| unknown [Medicago truncatula]
Length=378

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CVEKV+KSGLDVFAH+IETVEELQS VRDHRANF QS+DVL MAKDYAP
Sbjct  214  ALVPDFRGNAECVEKVSKSGLDVFAHSIETVEELQSAVRDHRANFNQSLDVLRMAKDYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQ+VKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  274  AGTLTKTSIMLGCGETPDQIVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRA S
Sbjct  334  KYQALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAVS  375



>gb|KHG07122.1| Lipoyl synthase, mitochondrial [Gossypium arboreum]
Length=377

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFR D +CVEKVAKSGLDVFAHNIETVEELQ VVRDHRANFKQS+DVLMMAK+Y P
Sbjct  214  ALVPDFRADAACVEKVAKSGLDVFAHNIETVEELQRVVRDHRANFKQSLDVLMMAKEYVP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF 
Sbjct  274  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFG  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+A+
Sbjct  334  KYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSAA  375



>ref|XP_008455341.1| PREDICTED: lipoyl synthase 2, mitochondrial [Cucumis melo]
Length=381

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA+SGLDVFAHNIETVEELQ  VRDHRANFKQS+DVL+MAK+++P
Sbjct  213  ALVPDFRGDSGCVEKVARSGLDVFAHNIETVEELQGAVRDHRANFKQSLDVLVMAKEFSP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  SGTLTKTSIMLGCGETPDQVVQTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  333  KYQNLGMKMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  374



>ref|XP_009357081.1| PREDICTED: lipoyl synthase 2, mitochondrial [Pyrus x bretschneideri]
Length=383

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKVA SGLDV AHNIETVEELQ  VRDHRANFKQS+DVLMMAKD+AP
Sbjct  216  ALVPDFRGDSSCVEKVATSGLDVLAHNIETVEELQRAVRDHRANFKQSLDVLMMAKDHAP  275

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  276  AGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  335

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y+ LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIESDRA+S
Sbjct  336  RYRALGMEMGFRYVASGPMVRSSYKAGEYYIKSMIESDRASS  377



>gb|ABK96318.1| unknown [Populus trichocarpa x Populus deltoides]
Length=385

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVAKSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLMMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGE P+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  PGTLTKTSIMLGCGEAPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+ S
Sbjct  338  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSVS  379



>ref|XP_002306361.1| lipoic acid synthase family protein [Populus trichocarpa]
 sp|B9H5L9.1|LIAS_POPTR RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Populus trichocarpa]
 gb|EEE93357.1| lipoic acid synthase family protein [Populus trichocarpa]
Length=385

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVAKSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLMMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGE P+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  PGTLTKTSIMLGCGEAPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+ S
Sbjct  338  KYKTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSVS  379



>ref|XP_008341911.1| PREDICTED: lipoyl synthase, mitochondrial [Malus domestica]
Length=381

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/162 (91%), Positives = 154/162 (95%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKVA SGLDV AHNIETVEELQ  VRDHRANFKQS+DVLMMAKDYAP
Sbjct  214  ALVPDFRGDSSCVEKVATSGLDVLAHNIETVEELQRAVRDHRANFKQSLDVLMMAKDYAP  273

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF 
Sbjct  274  AGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFX  333

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y+ LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIESDRA S
Sbjct  334  RYRALGMEMGFRYVASGPMVRSSYKAGEYYIKSMIESDRAKS  375



>ref|XP_006447321.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
 ref|XP_006491631.1| PREDICTED: lipoyl synthase, mitochondrial-like [Citrus sinensis]
 gb|ESR60561.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
Length=376

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CV +VAKSGL+VFAHNIETVEELQS VRDHRANFKQS+DVLMMAKDY P
Sbjct  213  ALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA+
Sbjct  333  RYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAT  374



>gb|KDO40564.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=376

 Score =   314 bits (804),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CV +VAKSGL+VFAHNIETVEELQS VRDHRANFKQS+DVLMMAKDY P
Sbjct  213  ALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA+
Sbjct  333  RYRALGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAT  374



>ref|XP_002266132.2| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial 
[Vitis vinifera]
 sp|A5CB81.1|LIAS_VITVI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Vitis vinifera]
 emb|CAN73265.1| hypothetical protein VITISV_021769 [Vitis vinifera]
Length=393

 Score =   314 bits (804),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS++VL +AK+YA 
Sbjct  220  ALVPDFRGDPGCVEKVSKSGLDVFAHNIETVEELQSAVRDHRANFKQSLEVLKLAKEYAD  279

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  280  AGTLTKTSIMLGCGETPDQVVRTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*TS  220
            KY++LGM MGFRYVASGPMVRSSYKAGEFYIKSMI++DRA S A +S
Sbjct  340  KYRILGMDMGFRYVASGPMVRSSYKAGEFYIKSMIDADRAMSWASSS  386



>ref|XP_011021958.1| PREDICTED: lipoyl synthase, mitochondrial [Populus euphratica]
Length=385

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA SGLDVFAHNIETVEELQS VRDHRANFKQS+DVL+MAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVATSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLLMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGE P+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  AGTLTKTSIMLGCGEAPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+ S
Sbjct  338  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSVS  379



>ref|XP_010526527.1| PREDICTED: lipoyl synthase, mitochondrial [Tarenaya hassleriana]
Length=375

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV++SGLDVFAHNIETVEELQS VRDHRANFKQS+DVL  AK+YAP
Sbjct  211  ALVPDFRGDTGCVEKVSRSGLDVFAHNIETVEELQSFVRDHRANFKQSLDVLTRAKEYAP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAF+
Sbjct  271  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFD  330

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+VLGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRA S
Sbjct  331  KYRVLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAVS  372



>ref|XP_004136815.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus]
 ref|XP_004155481.1| PREDICTED: lipoyl synthase, mitochondrial-like [Cucumis sativus]
 gb|KGN43590.1| hypothetical protein Csa_7G047260 [Cucumis sativus]
Length=381

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA+SGLDVFAHNIETVEELQ VVRDHRANFKQS+DVL+MAK+++ 
Sbjct  213  ALVPDFRGDSGCVEKVARSGLDVFAHNIETVEELQGVVRDHRANFKQSLDVLVMAKEFSL  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  SGTLTKTSIMLGCGETPDQVVQTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KYQ +GM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS
Sbjct  333  KYQNIGMKMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  374



>gb|EPS65537.1| lipoyl synthase, mitochondrial, partial [Genlisea aurea]
Length=340

 Score =   311 bits (796),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVE+VAKSGLDVFAHNIETVEELQS VRDHRANF QS+DVL+ AKDYAP
Sbjct  179  ALVPDFRGDSSCVERVAKSGLDVFAHNIETVEELQSFVRDHRANFDQSLDVLVKAKDYAP  238

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETP+QVVKTMEKVRAAGVDVMTFGQYMRPS+RHMPVSEYITPEAFE
Sbjct  239  SGTLTKTSIMLGCGETPEQVVKTMEKVRAAGVDVMTFGQYMRPSRRHMPVSEYITPEAFE  298

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y++LGM MGFRYVASGPMVRSSYKAGEFYIKSMIE+DRAA+
Sbjct  299  TYRILGMDMGFRYVASGPMVRSSYKAGEFYIKSMIEADRAAT  340



>ref|XP_009398165.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128}-like 
[Musa acuminata subsp. malaccensis]
Length=382

 Score =   312 bits (799),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 158/162 (98%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+PSCVEKVAKSGLDVFAHNIETVEELQ++VRDHRANFKQS+DVL +AK++AP
Sbjct  213  ALVPDFRGEPSCVEKVAKSGLDVFAHNIETVEELQNLVRDHRANFKQSIDVLKLAKEHAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TP+AFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPDAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIE+DRA +
Sbjct  333  KYRSLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIEADRATA  374



>ref|XP_006841751.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda]
 gb|ERN03426.1| hypothetical protein AMTR_s00003p00261780 [Amborella trichopoda]
Length=324

 Score =   310 bits (793),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 145/160 (91%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD +CVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS++VL MAKDYAP
Sbjct  156  ALVPDFRGDSTCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSIEVLKMAKDYAP  215

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETP QV+KTME V+AAGVDVMTFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  216  AGTLTKTSIMLGCGETPSQVIKTMENVKAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFQ  275

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            ++Q LGM+MGFRYVASGPMVRSSYKAGE YIKSMIESDRA
Sbjct  276  EFQELGMEMGFRYVASGPMVRSSYKAGELYIKSMIESDRA  315



>ref|XP_006380479.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
 gb|ERP58276.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
Length=385

 Score =   312 bits (799),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA SGLDVFAHNIETVEELQS VRD RANFKQS+DVL+MAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVATSGLDVFAHNIETVEELQSSVRDRRANFKQSLDVLVMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETP+QVVKTMEKVRAAG+DVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  AGTLTKTSVMLGCGETPEQVVKTMEKVRAAGIDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+AS
Sbjct  338  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSAS  379



>ref|XP_009388773.1| PREDICTED: lipoyl synthase, mitochondrial {ECO:0000255|HAMAP-Rule:MF_03128}-like 
[Musa acuminata subsp. malaccensis]
Length=385

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/160 (90%), Positives = 157/160 (98%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQ++VRDHRANF+QS+DVL MAK+YAP
Sbjct  216  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQNMVRDHRANFEQSIDVLKMAKEYAP  275

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETP+QV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  276  SGTLTKTSIMLGCGETPEQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  335

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KY+ LG++MGFRYVASGPMVRSSYKAGEFYIKSMIE+DRA
Sbjct  336  KYRSLGVEMGFRYVASGPMVRSSYKAGEFYIKSMIEADRA  375



>emb|CDX81984.1| BnaC08g36170D [Brassica napus]
Length=374

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/162 (90%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS VRDHRANFKQSMDVL MAK +AP
Sbjct  211  ALVPDFRGDGGCVEKVAKSGLDVFAHNIETVEELQSFVRDHRANFKQSMDVLRMAKQHAP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE
Sbjct  271  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFE  330

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIE+DR +S
Sbjct  331  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVSS  372



>ref|XP_010467759.1| PREDICTED: lipoyl synthase, mitochondrial [Camelina sativa]
Length=372

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVL MAKD+AP
Sbjct  205  ALVPDFRGDGGCVEKVSKSGLDVFAHNIETVEELQSFVRDHRANFKQSLDVLRMAKDHAP  264

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE
Sbjct  265  AGTLTKTSVMLGCGETPDQVVQTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFE  324

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*TS  220
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMI++DR  S + TS
Sbjct  325  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIDADRVVSPSTTS  371



>ref|XP_010278318.1| PREDICTED: lipoyl synthase 2, mitochondrial [Nelumbo nucifera]
Length=409

 Score =   309 bits (792),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKVAKSGLDVFAHNIETVEELQ  VRDHRANF QS++VL MAK YAP
Sbjct  241  ALVPDFRGDPGCVEKVAKSGLDVFAHNIETVEELQRAVRDHRANFNQSIEVLKMAKGYAP  300

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  301  SGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  360

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIE+DR
Sbjct  361  KYRTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIEADR  399



>ref|NP_179682.1| lipoic acid synthase 1 [Arabidopsis thaliana]
 sp|Q9ZWT1.1|LIAS_ARATH RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL11577.1|AF424583_1 At2g20860/F5H14.17 [Arabidopsis thaliana]
 dbj|BAA34701.1| Lipoic acid synthase [Arabidopsis thaliana]
 gb|AAD20909.1| lipoic acid synthase (LIP1) [Arabidopsis thaliana]
 gb|AAK59647.1| putative lipoic acid synthase LIP1 [Arabidopsis thaliana]
 gb|AAL15183.1| putative lipoic acid synthase LIP1 [Arabidopsis thaliana]
 gb|AEC07088.1| lipoic acid synthase 1 [Arabidopsis thaliana]
Length=374

 Score =   308 bits (789),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDV AHNIETVEELQS VRDHRANFKQS+DVL MAK+YAP
Sbjct  208  ALVPDFRGDGGCVEKVSKSGLDVLAHNIETVEELQSFVRDHRANFKQSLDVLRMAKEYAP  267

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TP+AFE
Sbjct  268  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFE  327

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIE+DR AS
Sbjct  328  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVAS  369



>ref|XP_010926267.1| PREDICTED: lipoyl synthase, mitochondrial [Elaeis guineensis]
Length=395

 Score =   308 bits (789),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVE VAKSGLDVFAHNIETVEELQ +VRDHRANFKQS+DVL MAK+YAP
Sbjct  226  ALVPDFRGDPSCVETVAKSGLDVFAHNIETVEELQRMVRDHRANFKQSIDVLKMAKEYAP  285

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF+
Sbjct  286  PGTLTKTSVMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFD  345

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI++DRA
Sbjct  346  KYRSLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDADRA  385



>ref|XP_010488982.1| PREDICTED: lipoyl synthase, mitochondrial-like [Camelina sativa]
Length=372

 Score =   307 bits (787),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/167 (86%), Positives = 159/167 (95%), Gaps = 0/167 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDVFAHNIETVEELQS VRD RANFKQS+DVL MAKD+AP
Sbjct  205  ALVPDFRGDGGCVEKVSKSGLDVFAHNIETVEELQSFVRDRRANFKQSLDVLRMAKDHAP  264

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVV+TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE
Sbjct  265  AGTLTKTSVMLGCGETPDQVVQTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFE  324

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*TS  220
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMI++DR AS + TS
Sbjct  325  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIDADRVASPSTTS  371



>ref|XP_009117465.1| PREDICTED: lipoyl synthase, mitochondrial [Brassica rapa]
 emb|CDY13855.1| BnaA09g43570D [Brassica napus]
Length=374

 Score =   307 bits (786),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS VRDHRANFKQSMDVL MAK +AP
Sbjct  211  ALVPDFRGDGGCVEKVAKSGLDVFAHNIETVEELQSFVRDHRANFKQSMDVLRMAKQHAP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHM V+EY+TPEAFE
Sbjct  271  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMAVAEYVTPEAFE  330

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIE+DR +S
Sbjct  331  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVSS  372



>ref|XP_010239981.1| PREDICTED: lipoyl synthase, mitochondrial [Brachypodium distachyon]
Length=386

 Score =   306 bits (784),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQS VRDHRANFKQSMDVL MAK YAP
Sbjct  217  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQSSVRDHRANFKQSMDVLKMAKKYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQVV TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  PGTLTKTSVMLGCGETPDQVVSTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE DRA S A
Sbjct  337  NYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKSGA  380



>ref|XP_006409024.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
 gb|ESQ50477.1| hypothetical protein EUTSA_v10002016mg [Eutrema salsugineum]
Length=373

 Score =   305 bits (782),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANF+QS+DVL MAK +AP
Sbjct  208  ALVPDFRGDGGCVEKVSKSGLDVFAHNIETVEELQSFVRDHRANFEQSLDVLRMAKHHAP  267

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE
Sbjct  268  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFE  327

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIE+DR A
Sbjct  328  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVA  368



>ref|XP_006653475.1| PREDICTED: lipoyl synthase, mitochondrial-like, partial [Oryza 
brachyantha]
Length=319

 Score =   303 bits (777),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL MAK+YAP
Sbjct  151  ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKMAKEYAP  210

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  211  AGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  270

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+ LG+ MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA +
Sbjct  271  SYRALGVDMGFRYVASGPMVRSSYKAGEFYIKAMIEADRAKT  312



>gb|KFK40464.1| hypothetical protein AALP_AA3G376400 [Arabis alpina]
Length=373

 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/161 (88%), Positives = 154/161 (96%), Gaps = 0/161 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVL MAK +AP
Sbjct  207  ALVPDFRGDGGCVEKVSKSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLRMAKQHAP  266

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE
Sbjct  267  AGTLTKTSVMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFE  326

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMIE+DR A
Sbjct  327  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIEADRVA  367



>ref|XP_004306011.1| PREDICTED: lipoyl synthase 2, mitochondrial [Fragaria vesca subsp. 
vesca]
Length=453

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL+PDFRGD  CV+ VA SGLDV AHNIETVEELQS VRDHRANFKQS+DVLMMAK+YAP
Sbjct  286  ALIPDFRGDSDCVKTVATSGLDVLAHNIETVEELQSAVRDHRANFKQSLDVLMMAKEYAP  345

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAF+
Sbjct  346  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFD  405

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ +GM+MGFRYVASGPMVRSSYKAGE+YIKSMI++DRAAS
Sbjct  406  KYREIGMEMGFRYVASGPMVRSSYKAGEYYIKSMIDADRAAS  447



>dbj|BAJ97232.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   305 bits (781),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQSMDVL MAK+YAP
Sbjct  217  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQRDVRDHRANFKQSMDVLKMAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  277  PGTLTKTSVMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE DRA S
Sbjct  337  NYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKS  378



>ref|XP_004975823.1| PREDICTED: lipoyl synthase, mitochondrial-like [Setaria italica]
Length=385

 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL MAK+YAP
Sbjct  217  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQRSVRDHRANFKQSIDVLKMAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  PGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA +
Sbjct  337  KYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEADRAKT  378



>ref|XP_002884228.1| hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60487.1| hypothetical protein ARALYDRAFT_900465 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 156/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKV+KSGLDV +HNIETVEELQS VRDHRANFKQS+DVL MAK++AP
Sbjct  208  ALVPDFRGDGGCVEKVSKSGLDVLSHNIETVEELQSFVRDHRANFKQSLDVLRMAKEHAP  267

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TP+AFE
Sbjct  268  AGTLTKTSVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPDAFE  327

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            +Y++LGM+MGFRYVASGPMVRSSYKAGE+YIKSMI++DR AS
Sbjct  328  RYRLLGMEMGFRYVASGPMVRSSYKAGEYYIKSMIDADRVAS  369



>dbj|BAK07245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=418

 Score =   305 bits (780),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/162 (88%), Positives = 151/162 (93%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQSMDVL MAK+YAP
Sbjct  249  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQRDVRDHRANFKQSMDVLKMAKEYAP  308

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  309  PGTLTKTSVMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE  368

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE DRA S
Sbjct  369  NYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKS  410



>sp|A2XU53.2|LIAS_ORYSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Oryza sativa Indica Group]
Length=382

 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL +AK+YAP
Sbjct  217  ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKLAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +Y+ LG+ MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA
Sbjct  337  RYRSLGVDMGFRYVASGPMVRSSYKAGEFYIKAMIEADRA  376



>emb|CAH67016.1| H0523F07.4 [Oryza sativa Indica Group]
Length=382

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL +AK+YAP
Sbjct  217  ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKLAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +Y+ LG+ MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA
Sbjct  337  RYRSLGVDMGFRYVASGPMVRSSYKAGEFYIKAMIEADRA  376



>ref|NP_001052964.1| Os04g0455800 [Oryza sativa Japonica Group]
 sp|Q7XRF1.2|LIAS_ORYSJ RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Oryza sativa Japonica Group]
 emb|CAE02573.2| OSJNBa0006M15.16 [Oryza sativa Japonica Group]
 dbj|BAF14878.1| Os04g0455800 [Oryza sativa Japonica Group]
 gb|EAZ30943.1| hypothetical protein OsJ_15022 [Oryza sativa Japonica Group]
 dbj|BAH00110.1| unnamed protein product [Oryza sativa Japonica Group]
Length=382

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL +AK+YAP
Sbjct  217  ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKLAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ T EKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPDQVISTTEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +Y+ LG+ MGFRYVASGPMVRSSYKAGEFYIK+MIE+DRA
Sbjct  337  RYRSLGVDMGFRYVASGPMVRSSYKAGEFYIKAMIEADRA  376



>ref|XP_002447950.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor]
 sp|C5Y9R0.1|LIAS_SORBI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Sorghum bicolor]
 gb|EES12278.1| hypothetical protein SORBIDRAFT_06g018660 [Sorghum bicolor]
Length=386

 Score =   301 bits (771),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQ  VRD+RANFKQS+DVL MAK+YAP
Sbjct  218  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQRNVRDYRANFKQSIDVLKMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  278  PGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYVTPEAFE  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KY+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE+DR+
Sbjct  338  KYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEADRS  377



>dbj|BAB44157.1| lipoic acid synthase [Bruguiera gymnorhiza]
Length=375

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/162 (86%), Positives = 155/162 (96%), Gaps = 0/162 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDF+GD SCVEKVA +GLDVFAHNIETVEELQSVVRD+RANFKQS++VLM A++++P
Sbjct  206  ALTPDFQGDKSCVEKVATAGLDVFAHNIETVEELQSVVRDNRANFKQSLEVLMAAREFSP  265

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQVVK+MEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  266  PGTLTKTSIMLGCGETPDQVVKSMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE  325

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+VLG +MGFRYVASGPMVRSSYKAGEFYIK+MIE DRAA+
Sbjct  326  KYKVLGDEMGFRYVASGPMVRSSYKAGEFYIKNMIERDRAAA  367



>ref|XP_008782125.1| PREDICTED: lipoyl synthase, mitochondrial [Phoenix dactylifera]
Length=389

 Score =   300 bits (769),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCV  VAKSGLDVFAHNIETVEELQS+VRD RANFKQS+DVL MAK+YAP
Sbjct  220  ALVPDFRGDPSCVGTVAKSGLDVFAHNIETVEELQSMVRDRRANFKQSIDVLKMAKEYAP  279

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHM VSEY+TPEAF+
Sbjct  280  PGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMQVSEYVTPEAFD  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI++DRA
Sbjct  340  KYRSLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDADRA  379



>ref|NP_001146235.1| lipoyl synthase, mitochondrial [Zea mays]
 sp|B8A031.1|LIAS_MAIZE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Zea mays]
 gb|ACL53530.1| unknown [Zea mays]
 gb|ACN25811.1| unknown [Zea mays]
 gb|ACR36873.1| unknown [Zea mays]
 tpg|DAA37504.1| TPA: hypothetical protein ZEAMMB73_507372 [Zea mays]
Length=383

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDPSCVEKVA SGL VFAHNIETVEELQ  VRD+RANFKQS+DVL MAK+YAP
Sbjct  215  ALVPDFRGDPSCVEKVATSGLHVFAHNIETVEELQRNVRDYRANFKQSIDVLEMAKEYAP  274

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETPDQV++TMEKVRAA VDV+TFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  275  PGTLTKTSIMLGCGETPDQVIRTMEKVRAADVDVITFGQYMRPSKRHMPVSEYVTPEAFE  334

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            KY+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE++RA   A
Sbjct  335  KYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEAERAKGTA  378



>ref|XP_010671528.1| PREDICTED: lipoyl synthase 2, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=386

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/155 (92%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD SCVEKV+ SGLDVFAHNIETVEELQSVVRD RANFKQS+DVL +AK+YAP
Sbjct  218  ALVPDFRGDQSCVEKVSVSGLDVFAHNIETVEELQSVVRDRRANFKQSIDVLKLAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  278  AGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFD  337

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            KY+VLGM+MGFRYVASGPMVRSSYKAGE+YIKSMI
Sbjct  338  KYRVLGMEMGFRYVASGPMVRSSYKAGEYYIKSMI  372



>gb|EMS61096.1| Lipoyl synthase, mitochondrial [Triticum urartu]
Length=427

 Score =   300 bits (768),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD SCVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQSMDVL MAK+YAP
Sbjct  258  ALVPDFQGDRSCVEKVATSGLHVFAHNIETVEELQRSVRDHRANFKQSMDVLKMAKEYAP  317

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  318  PGTLTKTSVMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE  377

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE DRA S A
Sbjct  378  NYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKSGA  421



>gb|EMT08295.1| Lipoyl synthase, mitochondrial [Aegilops tauschii]
Length=470

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD SCVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQSMDVL MAK+YAP
Sbjct  301  ALVPDFQGDRSCVEKVATSGLHVFAHNIETVEELQRSVRDHRANFKQSMDVLKMAKEYAP  360

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTS+MLGCGETPDQV+ TMEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  361  PGTLTKTSVMLGCGETPDQVISTMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFE  420

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             Y+ LG++MGFRYVASGPMVRSSYKAGEFYIK+MIE DRA S A
Sbjct  421  NYRALGVEMGFRYVASGPMVRSSYKAGEFYIKAMIEDDRAKSGA  464



>ref|XP_006447320.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
 gb|ESR60560.1| hypothetical protein CICLE_v10015632mg [Citrus clementina]
Length=363

 Score =   293 bits (751),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/147 (93%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = -3

Query  675  VAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGE  496
            VAKSGL+VFAHNIETVEELQS VRDHRANFKQS+DVLMMAKDY PAGTLTKTSIMLGCGE
Sbjct  215  VAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVPAGTLTKTSIMLGCGE  274

Query  495  TPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVA  316
            TPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE+Y+ LGM+MGFRYVA
Sbjct  275  TPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFERYRALGMEMGFRYVA  334

Query  315  SGPMVRSSYKAGEFYIKSMIESDRAAS  235
            SGPMVRSSYKAGEFYIKSMIESDRAA+
Sbjct  335  SGPMVRSSYKAGEFYIKSMIESDRAAT  361



>ref|XP_006299291.1| hypothetical protein CARUB_v10015445mg [Capsella rubella]
 gb|EOA32189.1| hypothetical protein CARUB_v10015445mg [Capsella rubella]
Length=208

 Score =   287 bits (735),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 151/163 (93%), Gaps = 2/163 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            +VPDFRGD  CVEKV+K GLDVFAHNIET EELQS VRDHRANFKQS+DVL MAKD+A A
Sbjct  41   VVPDFRGDGRCVEKVSKLGLDVFAHNIETFEELQSSVRDHRANFKQSLDVLRMAKDHAHA  100

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
            GTLTKT +MLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPV+EY+TP+AFE+
Sbjct  101  GTLTKTYVMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVAEYVTPKAFER  160

Query  357  YQVLGMQM--GFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            YQ+LGM+M  GF Y+ASGPMVRSSYKAGE+YIKSMI++DR AS
Sbjct  161  YQLLGMEMILGFMYIASGPMVRSSYKAGEYYIKSMIDADRVAS  203



>sp|A9NNH7.1|LIAS_PICSI RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Picea sitchensis]
 gb|ABK22188.1| unknown [Picea sitchensis]
Length=386

 Score =   285 bits (729),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+G+  CV+KVA SGLDVFAHNIETVEELQ VVRDHRANF QS++VL MAK Y+P
Sbjct  220  ALVPDFQGNSECVQKVATSGLDVFAHNIETVEELQRVVRDHRANFNQSLEVLKMAKTYSP  279

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G LTKTS+MLGCGETP QV++TMEKVR AGVDV+TFGQYMRP+KRHM VSEY+TPEAFE
Sbjct  280  LGVLTKTSVMLGCGETPAQVIETMEKVREAGVDVITFGQYMRPTKRHMAVSEYVTPEAFE  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            KYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIE DR
Sbjct  340  KYQKLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIEDDR  378



>ref|XP_001764819.1| predicted protein [Physcomitrella patens]
 gb|EDQ70518.1| predicted protein [Physcomitrella patens]
Length=396

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 147/159 (92%), Gaps = 0/159 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVE+VA SGLDVFAHNIETVEELQS VRD RANFKQS+DVL MAK +AP
Sbjct  229  ALVPDFRGDPACVERVATSGLDVFAHNIETVEELQSSVRDRRANFKQSLDVLRMAKKFAP  288

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETP QVVK M+ VRAAGVDVMT GQYMRP+KRHMPVSE++TPEAFE
Sbjct  289  PGTLTKTSIMLGCGETPAQVVKAMKSVRAAGVDVMTLGQYMRPTKRHMPVSEFVTPEAFE  348

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            +Y+ LG+++GFRYVASGPMVRSSYKAGE++IKSMI+ DR
Sbjct  349  EYRKLGVELGFRYVASGPMVRSSYKAGEYFIKSMIDEDR  387



>gb|KDO40563.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=375

 Score =   280 bits (717),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CV +VAKSGL+VFAHNIETVEELQS VRDHRANFKQS+DVLMMAKDY P
Sbjct  213  ALVPDFRGNNGCVREVAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQMGFRYVASGPMVRSSYK  286
            +Y+ LGM+MGFRYVASGPMVRSSYK
Sbjct  333  RYRALGMEMGFRYVASGPMVRSSYK  357



>ref|XP_010917111.1| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial-like 
[Elaeis guineensis]
Length=250

 Score =   271 bits (693),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            LVPDFRGDPSCVE+V+KSGLDVFAHNIETVEELQS+VRDH ANFK S+DV  MAK+YA A
Sbjct  82   LVPDFRGDPSCVERVSKSGLDVFAHNIETVEELQSMVRDHHANFKLSIDVRKMAKEYALA  141

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
            GTLTKTSIMLGCGETPDQV+ TMEKVRAA VDVMTFGQY RPSKRHMPVSEY+TP AF++
Sbjct  142  GTLTKTSIMLGCGETPDQVISTMEKVRAAVVDVMTFGQYKRPSKRHMPVSEYVTPGAFDQ  201

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
             + LG++MGF YVASGPMVR SYKAGEF I+SMI++D+A
Sbjct  202  CRSLGLEMGFXYVASGPMVRXSYKAGEFCIESMIDADQA  240



>ref|XP_002985852.1| hypothetical protein SELMODRAFT_123090 [Selaginella moellendorffii]
 gb|EFJ13029.1| hypothetical protein SELMODRAFT_123090 [Selaginella moellendorffii]
Length=357

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKVA SGLDVFAHNIETV+ELQS VRD RANF+QS++VL MAK   P
Sbjct  193  ALVPDFRGDPDCVEKVATSGLDVFAHNIETVQELQSSVRDRRANFQQSINVLKMAKLTGP  252

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G LTKTSIMLGCGET  QV++TM +VR AGVDVMTFGQYMRP+K+HMPVSEY+TPEAFE
Sbjct  253  RGVLTKTSIMLGCGETSSQVLETMARVRDAGVDVMTFGQYMRPTKKHMPVSEYVTPEAFE  312

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             Y+ +GM+MGFRYVASGPMVRSSYKAGEFYIK+M+++DR A++
Sbjct  313  NYRRIGMEMGFRYVASGPMVRSSYKAGEFYIKAMLDADREAAM  355



>ref|XP_002984787.1| hypothetical protein SELMODRAFT_121095 [Selaginella moellendorffii]
 gb|EFJ14037.1| hypothetical protein SELMODRAFT_121095 [Selaginella moellendorffii]
Length=357

 Score =   274 bits (701),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVEKVA SGLDVFAHNIETV+ELQS VRD RANF+QS++VL MAK   P
Sbjct  193  ALVPDFRGDPDCVEKVATSGLDVFAHNIETVQELQSSVRDRRANFQQSINVLKMAKLKGP  252

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G LTKTSIMLGCGET  QV++TM +VR AGVDVMTFGQYMRP+K+HMPVSEY+TPEAFE
Sbjct  253  RGVLTKTSIMLGCGETSSQVLETMARVRDAGVDVMTFGQYMRPTKKHMPVSEYVTPEAFE  312

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             Y+ +GM+MGFRYVASGPMVRSSYKAGEFYIK+M+++DR A++
Sbjct  313  NYRRIGMEMGFRYVASGPMVRSSYKAGEFYIKAMLDADREAAM  355



>gb|EAY94363.1| hypothetical protein OsI_16128 [Oryza sativa Indica Group]
Length=360

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP+CVEKVA SGL VFAHNIETVEELQ  VRDHRANFKQS+DVL +AK+YAP
Sbjct  217  ALVPDFRGDPACVEKVATSGLHVFAHNIETVEELQRNVRDHRANFKQSIDVLKLAKEYAP  276

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQV+ TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  277  AGTLTKTSIMLGCGETPDQVISTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  336

Query  360  KYQVLGMQMGFRYVASGPMVRSSY  289
            +Y+ LG+ MGFRYVASGPMVRSSY
Sbjct  337  RYRSLGVDMGFRYVASGPMVRSSY  360



>ref|XP_007043523.1| Lipoyl synthase, mitochondrial isoform 2 [Theobroma cacao]
 gb|EOX99354.1| Lipoyl synthase, mitochondrial isoform 2 [Theobroma cacao]
Length=344

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/129 (92%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRG+  CV KVAKSGLDVFAHNIETVEELQSVVRDHRANFKQS+DVL+MAKD AP
Sbjct  213  ALVPDFRGEAGCVVKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSLDVLVMAKDCAP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE
Sbjct  273  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  332

Query  360  KYQVLGMQM  334
            KY+ LGM+M
Sbjct  333  KYRTLGMEM  341



>ref|XP_006380478.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
 gb|ERP58275.1| hypothetical protein POPTR_0007s06900g [Populus trichocarpa]
Length=354

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVA SGLDVFAHNIETVEELQS VRD RANFKQS+DVL+MAK+YAP
Sbjct  218  ALVPDFRGDRGCVEKVATSGLDVFAHNIETVEELQSSVRDRRANFKQSLDVLVMAKEYAP  277

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            AGTLTKTS+MLGCGETP+QVVKTMEKVRAAG+DVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  278  AGTLTKTSVMLGCGETPEQVVKTMEKVRAAGIDVMTFGQYMRPSKRHMPVSEYITPDAFE  337

Query  360  KYQVLGMQM  334
            KY+ LGM+M
Sbjct  338  KYRTLGMEM  346



>ref|XP_002517968.1| lipoic acid synthetase, putative [Ricinus communis]
 sp|B9RW49.1|LIAS_RICCO RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Ricinus communis]
 gb|EEF44486.1| lipoic acid synthetase, putative [Ricinus communis]
Length=348

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGDP CVE VAKSGLDVFAHNIETVE+LQSV+RDHRANFKQS+DVLMMAKD+AP
Sbjct  210  ALVPDFRGDPGCVENVAKSGLDVFAHNIETVEDLQSVIRDHRANFKQSLDVLMMAKDHAP  269

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETP+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY+TPEAFE
Sbjct  270  KGTLTKTSIMLGCGETPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYVTPEAFE  329

Query  360  KYQ  352
            +Y+
Sbjct  330  QYR  332



>dbj|BAI58534.1| lipoic acid synthase [Rhizophora mucronata]
 dbj|BAI58535.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58536.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58537.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58538.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58539.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58540.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58486.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58487.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58488.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58489.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58490.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58491.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58492.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58493.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58494.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58495.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58496.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58497.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58498.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58499.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58500.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58501.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58502.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58503.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58504.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58505.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58506.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58507.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58508.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58509.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58510.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58511.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58512.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58513.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58514.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58515.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58516.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58517.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58518.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58519.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58520.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58521.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58522.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58523.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58524.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58525.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58526.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58527.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58528.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58529.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58530.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58531.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58532.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58533.1| lipoic acid synthase, partial [Rhizophora mucronata]
 dbj|BAI58541.1| lipoic acid synthase, partial [Rhizophora mucronata]
Length=213

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/126 (87%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGD SCVEKVA +GLDVFAHNIETVEELQSVVRD+RANFKQS++VLM AK++AP
Sbjct  86   ALTPDFRGDKSCVEKVAMAGLDVFAHNIETVEELQSVVRDNRANFKQSLEVLMAAKEFAP  145

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETP+QVVK+MEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  146  PGTLTKTSIMLGCGETPEQVVKSMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFD  205

Query  360  KYQVLG  343
            KY+VLG
Sbjct  206  KYKVLG  211



>dbj|BAI58440.1| lipoic acid synthase [Rhizophora apiculata]
 dbj|BAI58441.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58442.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58443.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58444.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58445.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58446.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58447.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58448.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58449.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58450.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58451.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58452.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58453.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58454.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58455.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58456.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58457.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58458.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58459.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58460.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58461.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58462.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58463.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58464.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58465.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58466.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58467.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58468.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58469.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58470.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58471.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58472.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58473.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58474.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58475.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58476.1| lipoic acid synthase [Rhizophora apiculata]
 dbj|BAI58477.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58478.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58479.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58480.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58481.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58482.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58483.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58484.1| lipoic acid synthase, partial [Rhizophora apiculata]
 dbj|BAI58485.1| lipoic acid synthase, partial [Rhizophora apiculata]
Length=213

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGD SCVEKVA +GLDVFAHNIETVEELQSVVRD+RANFKQS++VL  AK++AP
Sbjct  86   ALTPDFRGDKSCVEKVAMAGLDVFAHNIETVEELQSVVRDNRANFKQSLEVLKAAKEFAP  145

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             GTLTKTSIMLGCGETP+QVVK+MEKVRAAGVDV+TFGQYMRPSKRHMPVSEYITPEAF+
Sbjct  146  PGTLTKTSIMLGCGETPEQVVKSMEKVRAAGVDVITFGQYMRPSKRHMPVSEYITPEAFD  205

Query  360  KYQVLG  343
            KY+VLG
Sbjct  206  KYKVLG  211



>ref|XP_006382932.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
 gb|ERP60729.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
Length=349

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 121/162 (75%), Gaps = 36/162 (22%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS                        
Sbjct  218  ALVPDFRGDRGCVEKVAKSGLDVFAHNIETVEELQS------------------------  253

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
                        CGE P+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  254  ------------CGEAPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPDAFE  301

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+ S
Sbjct  302  KYKTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRSVS  343



>ref|XP_006382933.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
 gb|ERP60730.1| hypothetical protein POPTR_0005s08840g [Populus trichocarpa]
Length=372

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 120/160 (75%), Gaps = 36/160 (23%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDFRGD  CVEKVAKSGLDVFAHNIETVEELQS                        
Sbjct  218  ALVPDFRGDRGCVEKVAKSGLDVFAHNIETVEELQS------------------------  253

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
                        CGE P+QVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITP+AFE
Sbjct  254  ------------CGEAPEQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPDAFE  301

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            KY+ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMIESDR+
Sbjct  302  KYKTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIESDRS  341



>gb|KDO40565.1| hypothetical protein CISIN_1g017179mg [Citrus sinensis]
Length=334

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 113/123 (92%), Gaps = 3/123 (2%)
 Frame = -3

Query  675  VAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGE  496
            VAKSGL+VFAHNIETVEELQS VRDHRANFKQS+DVLMMAKDY PAGTLTKTSIMLGCGE
Sbjct  215  VAKSGLNVFAHNIETVEELQSAVRDHRANFKQSLDVLMMAKDYVPAGTLTKTSIMLGCGE  274

Query  495  TPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVA  316
            TPDQVV TMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE+Y+ LGM+M      
Sbjct  275  TPDQVVSTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFERYRALGMEM---VSG  331

Query  315  SGP  307
            SGP
Sbjct  332  SGP  334



>gb|AFK36952.1| unknown [Lotus japonicus]
Length=116

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 104/109 (95%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = -3

Query  561  MAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEY  382
            MAKDYAPAGTLTKTSIMLGCGETPDQV+KTMEKVRAAGVDVMTF QYMRPSKRHMPVSEY
Sbjct  1    MAKDYAPAGTLTKTSIMLGCGETPDQVLKTMEKVRAAGVDVMTFVQYMRPSKRHMPVSEY  60

Query  381  ITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
            ITPEAFEKYQ LGM+MGFRYVASGPMVRSSYKAGEFYIKSMI+SDRAAS
Sbjct  61   ITPEAFEKYQTLGMEMGFRYVASGPMVRSSYKAGEFYIKSMIDSDRAAS  109



>ref|XP_006298130.1| hypothetical protein CARUB_v10014173mg [Capsella rubella]
 gb|EOA31028.1| hypothetical protein CARUB_v10014173mg [Capsella rubella]
Length=326

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -3

Query  696  DPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPAGTLTKTS  517
            D  CVEKV+KSGLDVFAHNIETVEELQS VRDHRANFKQS+DVL MAKD+APAGTLTKTS
Sbjct  210  DGGCVEKVSKSGLDVFAHNIETVEELQSSVRDHRANFKQSLDVLRMAKDHAPAGTLTKTS  269

Query  516  IMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
            +MLGCGET DQVVKTMEKVR AGVDVMTFGQYMRPSKRHMPV+EY+TPEAFE+
Sbjct  270  VMLGCGETTDQVVKTMEKVRVAGVDVMTFGQYMRPSKRHMPVAEYVTPEAFER  322



>ref|XP_005847137.1| hypothetical protein CHLNCDRAFT_24051 [Chlorella variabilis]
 gb|EFN55035.1| hypothetical protein CHLNCDRAFT_24051 [Chlorella variabilis]
Length=357

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 123/155 (79%), Gaps = 2/155 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+G   CV+ VA+SGLDVFAHN+ETVE LQ VVRD RA + QS+ VL  AK    
Sbjct  188  ALVPDFQGRRECVDLVARSGLDVFAHNVETVERLQGVVRDRRAGWAQSLGVLAAAKQAG-  246

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGETPD+VV+T++ +R   VDV+T GQYMRP+KRHM V+EY+TPEAFE
Sbjct  247  -ARVTKTSIMLGCGETPDEVVQTLKTLRRYDVDVVTLGQYMRPTKRHMAVAEYVTPEAFE  305

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
             YQ +   MGF Y ASGPMVRSSY+AGEF++K+M+
Sbjct  306  AYQKIAEGMGFLYAASGPMVRSSYRAGEFFLKNML  340



>ref|XP_003062162.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH53874.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 125/156 (80%), Gaps = 2/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRGD   V  VA SG+DVFAHN+ETV ELQ+ VRD RAN+ QS+DVL  AK  A 
Sbjct  135  ALTPDFRGDRDLVTTVATSGVDVFAHNVETVPELQAHVRDRRANWAQSVDVLRTAK--AA  192

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GET +QVV  +E +R A VDV+TFGQYMRP+KRH+PV+EY+TPEAFE
Sbjct  193  GAGITKTSVMLGLGETREQVVNCLELLREADVDVVTFGQYMRPTKRHLPVAEYVTPEAFE  252

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             Y+V+   MGF YVASGPMVRSSYKAGE++++++++
Sbjct  253  AYKVIAEGMGFLYVASGPMVRSSYKAGEYFLENVLK  288



>gb|KDD75330.1| hypothetical protein H632_c740p1 [Helicosporidium sp. ATCC 50920]
Length=375

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 125/158 (79%), Gaps = 2/158 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD +CVE+VA+SGLDV+AHN+ETV  LQSVVRD RAN++QS+  L  AK  A 
Sbjct  214  ALVPDFQGDRACVERVARSGLDVYAHNVETVPRLQSVVRDRRANWEQSLQTLEAAK--AA  271

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLGCGE P++VV+ M ++R  GVDV+T GQYMRPSK HM VSEY+TPEAF 
Sbjct  272  GVRVTKTSLMLGCGERPEEVVEAMRELRRRGVDVVTLGQYMRPSKGHMAVSEYVTPEAFA  331

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESD  247
             YQ +   MGF YVA+GP VRSSY+AGEFY+ +++  +
Sbjct  332  AYQEVAEDMGFLYVAAGPKVRSSYRAGEFYLSNLLRRE  369



>gb|EFX79130.1| hypothetical protein DAPPUDRAFT_304936 [Daphnia pulex]
Length=385

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD  CVE++  SGLDVFAHNIETVEEL  +VRD RA ++QSMDVL  AK   P
Sbjct  224  CLTPDFRGDRDCVERIVLSGLDVFAHNIETVEELTWLVRDPRAKYQQSMDVLRYAKQVRP  283

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TK+SIMLG GET DQV KT+E +RAA VD +T GQYM+P+KRH+ V+EY+TPE F 
Sbjct  284  -DVVTKSSIMLGLGETDDQVRKTLEDLRAANVDCVTLGQYMQPTKRHLKVTEYVTPEKFA  342

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIES  250
            +++ +G ++GF Y ASGP+VRSSYKAGEF+IK++I++
Sbjct  343  QWESVGKELGFLYTASGPLVRSSYKAGEFFIKNIIQN  379



>ref|XP_008608559.1| lipoyl synthase, mitochondrial [Saprolegnia diclina VS20]
 gb|EQC38232.1| lipoyl synthase, mitochondrial [Saprolegnia diclina VS20]
Length=376

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 125/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L PDF G    +E+VA SGLDVFAHN+ETVE +Q  VRDHRAN++QS+ VL  AK   P 
Sbjct  214  LTPDFSGRVDLIEQVALSGLDVFAHNVETVERMQRRVRDHRANYRQSLAVLEAAKKVKPT  273

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
              +TKTSIMLG GE P +V++T++ +R++GVDV+TFGQY+RPS RHMPV+EYI+PEAFE+
Sbjct  274  -LVTKTSIMLGVGEKPAEVLQTLKDLRSSGVDVVTFGQYLRPSTRHMPVAEYISPEAFEE  332

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +Q +G  MGF YVASGPMVRSSYKAGEF++ +++
Sbjct  333  WQKVGESMGFLYVASGPMVRSSYKAGEFFLTNLL  366



>ref|XP_010866875.1| PREDICTED: lipoyl synthase, mitochondrial [Esox lucius]
Length=387

 Score =   209 bits (531),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 131/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +   +L+  N       L PDFRGD + VEK+A+SGLDV+AHN+ETV ELQ  VRD 
Sbjct  206  HIAKTVSNLKERNSHILVECLTPDFRGDLTAVEKIAQSGLDVYAHNVETVRELQRQVRDP  265

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   LTKTSIMLG GET  Q+  TM ++R AGVD +T GQYM
Sbjct  266  RANFDQSISVLRHAKAVKPE-VLTKTSIMLGLGETEQQIHNTMTELREAGVDCLTLGQYM  324

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K+++E  +AA
Sbjct  325  QPTKRHLKVEEYVTPERFAHWEEVGKEMGFIYTASGPLVRSSYKAGEFFLKNLLEKRKAA  384

Query  237  S  235
            +
Sbjct  385  A  385



>ref|XP_011396533.1| Lipoyl synthase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM23659.1| Lipoyl synthase, mitochondrial [Auxenochlorella protothecoides]
Length=385

 Score =   208 bits (530),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF GD +CV++VA SGLDVFAHN+ETV  LQ +VRD RAN++QS+ VL  AK+   
Sbjct  221  ALVPDFSGDQACVDRVAASGLDVFAHNVETVPRLQRLVRDRRANWEQSLRVLRRAKERGV  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGE PD+V   +  +R AGVDV+T GQYMRP+KRHM V+EY+TP+AF+
Sbjct  281  --RVTKTSIMLGCGEAPDEVTAALRLLREAGVDVVTLGQYMRPTKRHMAVAEYVTPQAFQ  338

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             YQ +   MGF YVA+GP VRSSY+AGEFY+   ++  + A  A
Sbjct  339  AYQDIAEGMGFLYVAAGPKVRSSYRAGEFYLTKHLQDGQKADAA  382



>gb|EJK53838.1| hypothetical protein THAOC_26643, partial [Thalassiosira oceanica]
Length=230

 Score =   203 bits (517),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 127/163 (78%), Gaps = 3/163 (2%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDF+GD   +  VA SGLDVFAHN+ETVE L   VRD RA ++Q+MDVL  AK   P
Sbjct  63   ALTPDFQGDRELIANVATSGLDVFAHNVETVERLTPRVRDRRAGYRQTMDVLEHAKAANP  122

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G LTKTSIMLG GET D+V  TME +RA  VDV+TFGQY++P++RH+ V EY+TPE FE
Sbjct  123  -GVLTKTSIMLGLGETDDEVRTTMEDLRARDVDVVTFGQYLQPTRRHLHVKEYVTPEKFE  181

Query  360  KYQVLG-MQMGFRYVASGPMVRSSYKAGEFYIKSMI-ESDRAA  238
            +++V+   +MGFRY ASGP+VRSSYKAGEF++++M+ E +R+A
Sbjct  182  EWRVVAEEEMGFRYCASGPLVRSSYKAGEFFMRNMVRERERSA  224



>gb|KDN45963.1| Lipoyl synthase [Tilletiaria anomala UBC 951]
Length=400

 Score =   208 bits (530),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 126/163 (77%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF G    V++VA SGLDVFAHN+ETVE    +VRD RAN++QS++VL  AK+  P
Sbjct  226  ALVPDFSGKHVDVDRVATSGLDVFAHNVETVERTTPMVRDRRANYRQSLEVLRRAKEAKP  285

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G +TKTSIMLGCGET  +V +T++ +RA  VDV+TFGQYMRP+KRHM VSEY+ PE F 
Sbjct  286  -GLITKTSIMLGCGETDAEVEQTLKDLRAVNVDVVTFGQYMRPTKRHMKVSEYVPPEKFA  344

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
            ++Q     +GF YVASGP+VRSSYKAGEF+IK++IE  R  +L
Sbjct  345  QWQHQAESLGFLYVASGPLVRSSYKAGEFFIKNVIEQRRGTTL  387



>ref|XP_008410916.1| PREDICTED: lipoyl synthase, mitochondrial [Poecilia reticulata]
Length=392

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   SL+  N       L PDFRGD S VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  206  HFAKTVTSLKERNPHILVECLTPDFRGDLSAVEKIALSGLDVYAHNVETVRELQRYVRDP  265

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P G LTKTSIMLG GE+  Q+V T+ ++R AGVD +T GQYM
Sbjct  266  RANFDQSLTVLKHAKQVKP-GVLTKTSIMLGLGESDQQIVNTLTELREAGVDCLTLGQYM  324

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +P+KRH+ V EYI PE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K++++  +A
Sbjct  325  QPTKRHLKVEEYIPPEKFAHWEKVGNKMGFVYTASGPLVRSSYKAGEFFLKNLLKKRKA  383



>gb|KFV80466.1| hypothetical protein N308_07734, partial [Struthio camelus australis]
Length=343

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R AGVD +T GQYM
Sbjct  223  RANFEQSVRVLQHAKEVQP-GIISKTSIMLGLGETDEQVYSTMKLLREAGVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>emb|CDS10851.1| Putative Lipoyl synthase, mitochondrial [Absidia idahoensis var. 
thermophila]
Length=410

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF G   CVE VAKSGLDV+AHNIETVE L   VRD RA F+QS+ VL  AK+  P
Sbjct  238  CLTGDFGGSLDCVETVAKSGLDVYAHNIETVEALTPYVRDRRAGFRQSISVLKHAKETRP  297

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET D+V+  ++++R A VDV+T GQYMRP+KRHM V EY+TPE F+
Sbjct  298  -DLITKTSIMLGCGETDDEVLHALQELRKANVDVVTLGQYMRPTKRHMKVHEYVTPEKFK  356

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             ++  GM+MGF+YVASGP+VRSSYKAGEFYI ++++
Sbjct  357  HWETTGMEMGFKYVASGPLVRSSYKAGEFYISNILK  392



>emb|CDH58810.1| lipoic acid synthetase precursor [Lichtheimia corymbifera JMRC:FSU:9682]
Length=410

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF G   CVE VAKSGLDV+AHNIETVE L   VRD RA F+QS+ VL  AK+  P
Sbjct  238  CLTGDFGGSLDCVETVAKSGLDVYAHNIETVEALTPYVRDRRAGFRQSISVLKHAKETRP  297

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET D+V+  ++++R A VDV+T GQYMRP+KRHM V EY+TPE F+
Sbjct  298  -DLITKTSIMLGCGETDDEVLHALQELRKANVDVVTLGQYMRPTKRHMKVHEYVTPEKFK  356

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             ++  GM+MGF+YVASGP+VRSSYKAGEFYI ++++
Sbjct  357  HWETTGMEMGFKYVASGPLVRSSYKAGEFYISNILK  392



>ref|XP_009671746.1| PREDICTED: lipoyl synthase, mitochondrial [Struthio camelus australis]
Length=363

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  183  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  242

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R AGVD +T GQYM
Sbjct  243  RANFEQSVRVLQHAKEVQP-GIISKTSIMLGLGETDEQVYSTMKLLREAGVDCLTLGQYM  301

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  302  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  361

Query  237  SL  232
            ++
Sbjct  362  AI  363



>ref|XP_005807826.1| PREDICTED: lipoyl synthase, mitochondrial-like [Xiphophorus maculatus]
Length=392

 Score =   206 bits (525),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   SL+  N       L PDFRGD S VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  206  HFAKTVTSLKGRNPHILVECLTPDFRGDLSAVEKIALSGLDVYAHNVETVRELQRYVRDP  265

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P G LTKTSIMLG GE+  Q+V T+ ++R AGVD +T GQYM
Sbjct  266  RANFDQSLTVLKHAKQVKP-GVLTKTSIMLGLGESDQQIVNTLTELREAGVDCLTLGQYM  324

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +P+KRH+ V EYI PE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K++++  +A
Sbjct  325  QPTKRHLKVEEYIPPEKFAYWEKVGNEMGFVYTASGPLVRSSYKAGEFFLKNLLKKRKA  383



>ref|XP_005651902.1| lipoic acid synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE27358.1| lipoic acid synthetase [Coccomyxa subellipsoidea C-169]
Length=314

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 119/155 (77%), Gaps = 2/155 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD   V  VA+SGLDV+AHN+ETVE LQ VVRD RAN+ QS+  L  AK  A 
Sbjct  150  ALVPDFQGDLDSVSMVAQSGLDVYAHNVETVERLQGVVRDRRANWAQSLATLRAAK--AA  207

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGE P +VV  ++++R  GVDV+T GQYMRP+KRHM V+EY+TPEAF 
Sbjct  208  GARITKTSIMLGCGEQPAEVVDALQELRDNGVDVVTLGQYMRPTKRHMAVAEYVTPEAFA  267

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
             ++     MGF YVA+GPMVRSSY+AGEFY+ +++
Sbjct  268  GFETAAKNMGFMYVAAGPMVRSSYRAGEFYLTNVL  302



>ref|XP_009836562.1| lipoyl synthase, mitochondrial [Aphanomyces astaci]
 gb|ETV74049.1| lipoyl synthase, mitochondrial [Aphanomyces astaci]
Length=364

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L PDF G    VE VA+SGLDVFAHNIETVE LQ  VRD+RAN++QS+ VL +AK   P+
Sbjct  200  LTPDFSGRVDLVETVARSGLDVFAHNIETVERLQRRVRDYRANYRQSLAVLELAKAAQPS  259

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
              +TKTSIMLG GETP+ V++T++ +RA+GVDV+TFGQY+RPS +HMPV+ YITP+AF  
Sbjct  260  -LITKTSIMLGVGETPEDVMQTLQDLRASGVDVVTFGQYLRPSTKHMPVAAYITPDAFAH  318

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +Q +   +GF YVASGPMVRSSYKAGE+++ +++
Sbjct  319  WQKVAESLGFLYVASGPMVRSSYKAGEYFLTNLL  352



>ref|XP_007551988.1| PREDICTED: lipoyl synthase, mitochondrial [Poecilia formosa]
Length=393

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   SL+  N       L PDFRGD S VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  206  HFAKTVTSLKERNPHILVECLTPDFRGDLSAVEKIALSGLDVYAHNVETVRELQRYVRDP  265

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P G LTKTSIMLG GE+  Q+V T+ ++R AGVD +T GQYM
Sbjct  266  RANFDQSLTVLKHAKQVKP-GVLTKTSIMLGLGESDQQIVNTLTELREAGVDCLTLGQYM  324

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EYI PE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K++++
Sbjct  325  QPTKRHLKVEEYIPPEKFAHWEKVGNEMGFVYTASGPLVRSSYKAGEFFLKNLLK  379



>gb|KDO24055.1| lipoyl synthase [Saprolegnia parasitica CBS 223.65]
Length=379

 Score =   205 bits (522),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 119/148 (80%), Gaps = 1/148 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L PDF G    +E+VA SGLDVFAHN+ETVE +Q  VRDHRAN++QS+ VL  AK   P 
Sbjct  212  LTPDFSGRVDLIEQVALSGLDVFAHNVETVERMQRRVRDHRANYRQSLAVLEAAKKVKPT  271

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
              +TKTSIMLG GE P +V++T++ +R++GVDV+TFGQY+RPS RHMPV+EYI+PE FE+
Sbjct  272  -LVTKTSIMLGVGEKPAEVLQTLKDLRSSGVDVVTFGQYLRPSTRHMPVAEYISPETFEE  330

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEF  274
            +Q +G  MGF YVASGPMVRSSYKAGEF
Sbjct  331  WQKVGESMGFLYVASGPMVRSSYKAGEF  358



>ref|XP_006630109.1| PREDICTED: lipoyl synthase, mitochondrial-like [Lepisosteus oculatus]
Length=369

 Score =   205 bits (521),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ +VRD RANF QS+ VL  AK   P
Sbjct  206  CLTPDFRGDLQAVEKVALSGLDVYAHNVETVRELQRLVRDPRANFDQSLSVLKHAKKVKP  265

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +  L+KTSIMLG GET  QV   M+++R +GVD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  266  S-LLSKTSIMLGLGETDGQVYAAMKELRESGVDCLTLGQYMQPTKRHLKVEEYVTPEKFQ  324

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K++I+S R
Sbjct  325  HWENIGKELGFMYTASGPLVRSSYKAGEFFLKNLIKSVR  363



>ref|XP_008873914.1| lipoyl synthase, mitochondrial [Aphanomyces invadans]
 gb|ETV97705.1| lipoyl synthase, mitochondrial [Aphanomyces invadans]
Length=360

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L PDF G    VE VA+SGLDVFAHNIETVE LQ  VRD+RAN++QS+ VL +AK   P+
Sbjct  201  LTPDFSGRVDLVETVARSGLDVFAHNIETVERLQRRVRDYRANYRQSLHVLELAKAAQPS  260

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
              +TKTSIMLG GE+P+ +++T++ +R +GVDV+TFGQY+RPS +HMPV+ YITPEAF +
Sbjct  261  -LITKTSIMLGVGESPEDIMQTLKDLRTSGVDVVTFGQYLRPSTKHMPVAAYITPEAFAE  319

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +Q +   MGF YVASGPMVRSSYKAGE+++ +++
Sbjct  320  WQKVAESMGFLYVASGPMVRSSYKAGEYFLTNLL  353



>gb|KFW73063.1| hypothetical protein AS28_12364, partial [Pygoscelis adeliae]
Length=343

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSIRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_004905775.1| PREDICTED: lipoyl synthase, mitochondrial [Heterocephalus glaber]
 ref|XP_004870351.1| PREDICTED: lipoyl synthase, mitochondrial [Heterocephalus glaber]
Length=373

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVRELQGKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL +AK+  PA  ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLKLAKEVQPA-IISKTSIMLGLGENDEQVYATMKALRGADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   R+ 
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKVGHELGFHYTASGPLVRSSYKAGEFFLKNLVAKRRSP  370

Query  237  S  235
            S
Sbjct  371  S  371



>gb|EKC32311.1| Lipoyl synthase, mitochondrial, partial [Crassostrea gigas]
Length=348

 Score =   202 bits (515),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRG+  CV  VA+SGLDV+AHN+ETVE+LQ +VRD RAN++QS++VL   K + P
Sbjct  181  CLTPDFRGNMDCVATVAESGLDVYAHNVETVEDLQWLVRDPRANYQQSLEVLKFVKSHTP  240

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GE+ DQV++ ME +R   VD +T GQYM+P+KRH+ V EY+ P+ F+
Sbjct  241  -DLVTKTSIMLGLGESDDQVMRVMEDLRRIDVDCVTLGQYMQPTKRHLKVKEYVHPDKFQ  299

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA-ASLA  229
             ++ +G ++GF Y ASGP+VRSSYKAGEFY+K++++S R  ASLA
Sbjct  300  HWEDVGNKLGFAYTASGPLVRSSYKAGEFYLKNLLKSRRKEASLA  344



>gb|KFW83864.1| hypothetical protein N305_05087, partial [Manacus vitellinus]
Length=343

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSVRVLKHAKEVQP-GIISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_002507881.1| lipoic acid synthase [Micromonas sp. RCC299]
 gb|ACO69139.1| lipoic acid synthase [Micromonas sp. RCC299]
Length=401

 Score =   204 bits (519),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRG+   V +VA SGLDVFAHN+ETV ELQ+ VRD RAN+ QS+ VL  AK + P
Sbjct  236  ALTPDFRGEAELVREVAASGLDVFAHNVETVPELQAEVRDRRANWDQSVGVLRDAKRFVP  295

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +  +TKTS+MLG GET  QVV  ++ +R AGVDV+TFGQYMRP+KRH+ V EY+TPEAFE
Sbjct  296  S-LITKTSLMLGLGETRPQVVNALKLLREAGVDVVTFGQYMRPTKRHLAVKEYLTPEAFE  354

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
             Y+ +   MGF YVASGPMVRSSY+AGE++++++++  +A
Sbjct  355  AYKKIAEDMGFLYVASGPMVRSSYRAGEYFLENVLKQRKA  394



>ref|XP_009330740.1| PREDICTED: lipoyl synthase, mitochondrial [Pygoscelis adeliae]
Length=365

 Score =   203 bits (516),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  185  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  244

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  245  RANFEQSIRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  303

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  304  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  363

Query  237  SL  232
            ++
Sbjct  364  AI  365



>gb|KFM08116.1| hypothetical protein AS27_09519, partial [Aptenodytes forsteri]
Length=343

 Score =   202 bits (514),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSIRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_011440930.1| PREDICTED: lipoyl synthase, mitochondrial-like [Crassostrea gigas]
Length=372

 Score =   203 bits (516),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 128/165 (78%), Gaps = 2/165 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRG+  CV  VA+SGLDV+AHN+ETVE+LQ +VRD RAN++QS++VL   K + P
Sbjct  205  CLTPDFRGNMDCVATVAESGLDVYAHNVETVEDLQWLVRDPRANYQQSLEVLKFVKSHTP  264

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GE+ DQV++ ME +R   VD +T GQYM+P+KRH+ V EY+ P+ F+
Sbjct  265  -DLVTKTSIMLGLGESDDQVMRVMEDLRRIDVDCVTLGQYMQPTKRHLKVKEYVHPDKFQ  323

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA-ASLA  229
             ++ +G ++GF Y ASGP+VRSSYKAGEFY+K++++S R  ASLA
Sbjct  324  HWEDVGNKLGFAYTASGPLVRSSYKAGEFYLKNLLKSRRKEASLA  368



>gb|ETI37440.1| lipoyl synthase, mitochondrial [Phytophthora parasitica P1569]
 gb|ETM37533.1| lipoyl synthase, mitochondrial [Phytophthora parasitica]
Length=383

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+G  + +++VA SGLDVFAHN+ETVE LQ  VRD+RAN+KQS+ VL  AK  AP
Sbjct  221  CLTPDFQGHDNLIDQVATSGLDVFAHNMETVERLQRRVRDYRANYKQSLHVLERAKVAAP  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GE  + V +T+  +R +GVDV+TFGQY+RPS +HMPV  Y+TPEAF 
Sbjct  281  H-LVTKTSLMLGVGERNEDVFQTLRDLRNSGVDVVTFGQYLRPSTKHMPVKSYVTPEAFA  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            ++Q +  QMGF YVASGPMVRSSYKAGEF++K+++++ +A  +A
Sbjct  340  EWQKVAEQMGFLYVASGPMVRSSYKAGEFFMKNLLKNRKAEVVA  383



>ref|XP_008911775.1| lipoyl synthase, mitochondrial [Phytophthora parasitica INRA-310]
 gb|ETK77651.1| lipoyl synthase, mitochondrial [Phytophthora parasitica]
 gb|ETL31096.1| lipoyl synthase, mitochondrial [Phytophthora parasitica]
 gb|ETN02818.1| lipoyl synthase, mitochondrial [Phytophthora parasitica INRA-310]
 gb|ETO66207.1| lipoyl synthase, mitochondrial [Phytophthora parasitica P1976]
 gb|ETP07290.1| lipoyl synthase, mitochondrial [Phytophthora parasitica CJ01A1]
 gb|ETP35362.1| lipoyl synthase, mitochondrial [Phytophthora parasitica P10297]
Length=383

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+G  + +++VA SGLDVFAHN+ETVE LQ  VRD+RAN+KQS+ VL  AK  AP
Sbjct  221  CLTPDFQGHDNLIDQVATSGLDVFAHNMETVERLQRRVRDYRANYKQSLHVLERAKVAAP  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GE  + V +T+  +R +GVDV+TFGQY+RPS +HMPV  Y+TPEAF 
Sbjct  281  H-LVTKTSLMLGVGERNEDVFQTLRDLRNSGVDVVTFGQYLRPSTKHMPVKSYVTPEAFA  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            ++Q +  QMGF YVASGPMVRSSYKAGEF++K+++++ +A  +A
Sbjct  340  EWQKVAEQMGFLYVASGPMVRSSYKAGEFFMKNLLKNRKAEVVA  383



>ref|XP_008925719.1| PREDICTED: lipoyl synthase, mitochondrial [Manacus vitellinus]
Length=361

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  181  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  240

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  241  RANFEQSVRVLKHAKEVQP-GIISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  299

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  300  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  359

Query  237  SL  232
            ++
Sbjct  360  AI  361



>ref|XP_009531563.1| hypothetical protein PHYSODRAFT_562522 [Phytophthora sojae]
 gb|EGZ14134.1| hypothetical protein PHYSODRAFT_562522 [Phytophthora sojae]
Length=385

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 128/163 (79%), Gaps = 1/163 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L PDF+G  + +++VA SGLDVFAHN+ETVE LQ  VRD+RAN+KQS+ VL  AK  AP 
Sbjct  224  LTPDFQGHDNLIDQVAVSGLDVFAHNLETVERLQRRVRDYRANYKQSLHVLERAKVAAPH  283

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
              +TKTS+MLG GE  + V +T+  +R +GVDV+TFGQY+RPS +HMPV  Y+TPEAF +
Sbjct  284  -LVTKTSLMLGVGERNEDVFQTLRDLRNSGVDVVTFGQYLRPSSKHMPVKSYVTPEAFAE  342

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            +Q +  QMGF YVASGPMVRSSYKAGEF++K+++++ +A  +A
Sbjct  343  WQKVAEQMGFLYVASGPMVRSSYKAGEFFMKNLLKNRKAQVVA  385



>ref|XP_009060732.1| hypothetical protein LOTGIDRAFT_150656 [Lottia gigantea]
 ref|XP_009060734.1| hypothetical protein LOTGIDRAFT_219117 [Lottia gigantea]
 gb|ESO88684.1| hypothetical protein LOTGIDRAFT_150656 [Lottia gigantea]
 gb|ESO88686.1| hypothetical protein LOTGIDRAFT_219117 [Lottia gigantea]
Length=360

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF GD   VE+VA++GLDV+AHN+ETV ELQS VRD RAN+KQS+ VL   KD  P
Sbjct  198  CLTPDFHGDLKAVERVARAGLDVYAHNVETVAELQSQVRDPRANYKQSLSVLKHVKDCDP  257

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GET DQV   ++ +R  GVD +TFGQYM+P++RH+ V EY+TP+ F 
Sbjct  258  -NLITKTSLMLGLGETDDQVHNVLKDLRFIGVDCLTFGQYMQPTRRHLKVKEYVTPDKFN  316

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             ++ +G +MGF Y ASGP+VRSSYKAGEFYIK+++   +  +L+
Sbjct  317  YWKEIGDEMGFAYTASGPLVRSSYKAGEFYIKNLVHKKKVDALS  360



>ref|XP_006895466.1| PREDICTED: lipoyl synthase, mitochondrial [Elephantulus edwardii]
Length=372

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/163 (58%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +E+VA+SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEQVAQSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVQP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -GVISKTSIMLGLGETDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             +  +G ++GF Y ASGP+VRSSYKAGEF++K+++   R+ +L
Sbjct  330  YWGKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRRSKAL  372



>gb|EMC82961.1| Lipoyl synthase, mitochondrial, partial [Columba livia]
Length=339

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  159  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  218

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  219  RANFEQSIRVLKHAKEVQP-GLISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  277

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  278  QPTKRHLKVDEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  337

Query  237  SL  232
            ++
Sbjct  338  AI  339



>ref|XP_005415685.1| PREDICTED: lipoyl synthase, mitochondrial [Geospiza fortis]
Length=373

 Score =   202 bits (514),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +  R L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  193  HFAKTVRHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPALQRKVRDP  252

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  253  RANFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  311

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  312  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  371

Query  237  SL  232
            ++
Sbjct  372  AI  373



>ref|XP_009099697.1| PREDICTED: lipoyl synthase, mitochondrial [Serinus canaria]
Length=446

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +  R L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQS VRD 
Sbjct  266  HFAKTVRHLKERNPKILVECLTPDFRGDLKAVEKVASSGLDVYAHNVETVPALQSKVRDP  325

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  326  RANFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  384

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  385  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  444

Query  237  SL  232
            ++
Sbjct  445  AI  446



>ref|XP_009278445.1| PREDICTED: lipoyl synthase, mitochondrial [Aptenodytes forsteri]
Length=379

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  199  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  258

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  259  RANFEQSIRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  317

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  318  QPTKRHLKVEEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  377

Query  237  SL  232
            ++
Sbjct  378  AI  379



>gb|KGL93190.1| hypothetical protein N301_01854, partial [Charadrius vociferus]
Length=343

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD + VEKVA+SGLDV+AHN+ETV  LQ  VRD 
Sbjct  163  HFAKTVSHLKERNPKILVECLTPDFRGDLAAVEKVARSGLDVYAHNLETVPALQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSIRVLKHAKKVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>gb|KFH64353.1| lipoic acid synthetase [Mortierella verticillata NRRL 6337]
Length=425

 Score =   203 bits (517),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = -3

Query  717  LVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAPA  538
            L  DF+GD  CV +VA SGLDV+AHNIETVE L + VRD RA F+QS+ VL  AK   P 
Sbjct  247  LTGDFQGDMECVARVATSGLDVYAHNIETVEALSAYVRDPRAKFRQSIAVLAHAKKAKP-  305

Query  537  GTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFEK  358
            G LTKTS+MLGCGET  +VV  M+++R A VDV+T GQYMRP+K+HM V EY+ PE FEK
Sbjct  306  GLLTKTSMMLGCGETEAEVVHAMDELRKADVDVLTLGQYMRPTKKHMRVHEYVKPEVFEK  365

Query  357  YQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            YQ L    GF+YVA+GP+VRSSYKAGEFYI ++++ ++
Sbjct  366  YQKLAEARGFKYVAAGPLVRSSYKAGEFYISNILKKEK  403



>ref|XP_005392039.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Chinchilla 
lanigera]
Length=372

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA+SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVAHLKERNPKILVECLTPDFRGDLRAVEKVARSGLDVYAHNVETVPELQRKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  PA  ++KTSIMLG GE+ +QV +TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLRHAKEVQPA-IISKTSIMLGLGESDEQVYETMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKVGGDLGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTL  370

Query  237  SL  232
            SL
Sbjct  371  SL  372



>ref|XP_002189456.1| PREDICTED: lipoyl synthase, mitochondrial [Taeniopygia guttata]
Length=394

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +  R L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  214  HFAKTVRHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPALQRKVRDP  273

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  274  RANFEQSIRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  332

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  333  QPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  392

Query  237  SL  232
            ++
Sbjct  393  AV  394



>gb|KFV64353.1| hypothetical protein N307_06684, partial [Picoides pubescens]
Length=343

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD S VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLSAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK   P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RASFEQSIRVLKHAKAVQP-GVISKTSIMLGLGETDEQVYATMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>emb|CCI49885.1| unnamed protein product [Albugo candida]
Length=399

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/163 (61%), Positives = 123/163 (75%), Gaps = 2/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+G    VE VA SGLDVFAHN+ETVE LQ  VRDHRAN++QS+ VL  AK   P
Sbjct  235  CLTPDFQGQKELVEIVATSGLDVFAHNVETVERLQRRVRDHRANYQQSLAVLQYAKQCVP  294

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GE  D VV T+  +RA  VDV+TFGQY+RPS +HMPV EYITP+ FE
Sbjct  295  T-LVTKTSIMLGLGEKADDVVATLGDLRAHSVDVVTFGQYLRPSVKHMPVKEYITPQQFE  353

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE-SDRAAS  235
            ++Q L  +MGF YVASGP+VRSSYKAGEF++  +++ S++ A+
Sbjct  354  EWQKLAEKMGFLYVASGPLVRSSYKAGEFFMTKLLQKSNKTAN  396



>ref|XP_003452182.2| PREDICTED: lipoyl synthase, mitochondrial-like [Oreochromis niloticus]
Length=410

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 126/179 (70%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  229  HFAKTVTNLKERNPQILVECLTPDFRGDLTAVEKIALSGLDVYAHNVETVRELQRHVRDP  288

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   LTKTSIMLG GET  Q++ TM ++R A VD +T GQYM
Sbjct  289  RANFDQSLSVLKHAKKVKPT-VLTKTSIMLGLGETDQQIINTMTELREAEVDCLTLGQYM  347

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +P+KRH+ V EY+TPE F  ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++  +A
Sbjct  348  QPTKRHLKVEEYVTPERFAHWEKVGSDMGFTYTASGPLVRSSYKAGEFFLKNLLKKRKA  406



>ref|XP_001699662.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
 sp|A8I2V9.1|LISC_CHLRE RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate 
synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|EDP07358.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
Length=430

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/169 (57%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+GD   V  +A+SGLDV+AHN+ETVE LQ  VRD RA + Q++DVL  AK+   
Sbjct  257  CLTPDFKGDLDAVRHLARSGLDVYAHNVETVERLQKRVRDPRAGYMQTLDVLRAAKE---  313

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G  TK+SIMLG GET D+V+ TM  ++A GVD+ T GQY++P+  H+PV+E++TPE FE
Sbjct  314  CGVYTKSSIMLGLGETDDEVIDTMLDLKAVGVDIFTLGQYLQPTPHHLPVTEFVTPEKFE  373

Query  360  KYQVLGM-QMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*TSG  217
             ++  G  ++GFRYVASGPMVRSSYKAGEF++ SMIESDRA + A   G
Sbjct  374  YWRKFGQEEIGFRYVASGPMVRSSYKAGEFFLHSMIESDRAKARAAQEG  422



>emb|CEF98458.1| Radical SAM [Ostreococcus tauri]
Length=332

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRG+   VE VA SGLDV+AHN+ETV ELQ+ VRD RAN+ QS++VL  AK    
Sbjct  166  ALTPDFRGEKHLVELVASSGLDVYAHNVETVPELQADVRDRRANWDQSIEVLKHAKK--S  223

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GET DQV+  ++ +R A VDV+TFGQYMRP+K+H+ V EYITPEAF+
Sbjct  224  GAKITKTSIMLGLGETHDQVINALKLLREADVDVVTFGQYMRPTKKHLAVVEYITPEAFK  283

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +YQ +   MGF YVASG MVRSSYKAGEF++ ++I+  +A
Sbjct  284  RYQEIAEGMGFLYVASGAMVRSSYKAGEFFLANVIKERKA  323



>ref|XP_002956597.1| hypothetical protein VOLCADRAFT_43591 [Volvox carteri f. nagariensis]
 gb|EFJ42364.1| hypothetical protein VOLCADRAFT_43591 [Volvox carteri f. nagariensis]
Length=298

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 127/176 (72%), Gaps = 4/176 (2%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  R  R+L+          L PDFRGD   V  +A+SGLDV+AHN+ETVE LQ  VRD 
Sbjct  126  HFARTVRTLKELRPSILVECLTPDFRGDLDAVRHLARSGLDVYAHNVETVERLQRRVRDP  185

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA + Q+++VL  AK+    G  TK+SIMLG GET D+V+ TM  ++AAGVD+ T GQY+
Sbjct  186  RAGYLQTLNVLRAAKE---CGVYTKSSIMLGLGETDDEVIDTMLDLKAAGVDIFTLGQYL  242

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGM-QMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P++ H+PVSE++TPE FE ++  G  ++GFRYVASGPMVRSSYKAGEF++ SMIE
Sbjct  243  QPTQHHLPVSEFVTPEKFEYWRKFGQEEIGFRYVASGPMVRSSYKAGEFFLHSMIE  298



>ref|XP_010572846.1| PREDICTED: lipoyl synthase, mitochondrial [Haliaeetus leucocephalus]
Length=401

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  221  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  280

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  281  RANFEQSVRVLKHAKEVQP-GIISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  339

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  340  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  399

Query  237  SL  232
            ++
Sbjct  400  AI  401



>ref|XP_002778818.1| lipoic acid synthase precursor, putative [Perkinsus marinus ATCC 
50983]
 gb|EER10613.1| lipoic acid synthase precursor, putative [Perkinsus marinus ATCC 
50983]
Length=299

 Score =   199 bits (505),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD  CV++VA SGLDV+AHNIETVE L   VRD RA ++QS+  L MAK+Y P
Sbjct  136  ALVPDFKGDSFCVKEVATSGLDVYAHNIETVERLTPSVRDRRAGYRQSLRTLEMAKEYCP  195

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               LTK+SIMLG GE   +V   M+ +R +GVDV+TFGQY++P+K HM V+ Y+TPE F 
Sbjct  196  K-LLTKSSIMLGLGEEDVEVEHAMKDLRDSGVDVVTFGQYLQPTKHHMKVTRYVTPEEFN  254

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIES  250
            K++ +  +MGFRY ASGP+VRSSY+AGE+Y++SMI +
Sbjct  255  KWKKIAEKMGFRYCASGPLVRSSYRAGEYYMESMIRN  291



>ref|XP_005501430.1| PREDICTED: lipoyl synthase, mitochondrial [Columba livia]
Length=390

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  210  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  269

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  270  RANFEQSIRVLKHAKEVQP-GLISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  328

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  329  QPTKRHLKVDEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  388

Query  237  SL  232
            ++
Sbjct  389  AI  390



>ref|NP_001085534.1| lipoyl synthase, mitochondrial [Xenopus laevis]
 sp|Q6GQ48.1|LIAS_XENLA RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Xenopus laevis]
 gb|AAH72900.1| MGC80349 protein [Xenopus laevis]
Length=372

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 130/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N+      L PDFRG+   VE VAKSGLDV+AHN+ETV  LQ  VRD 
Sbjct  192  HIAQTVSMLKERNKTILIECLTPDFRGNMKAVETVAKSGLDVYAHNVETVPALQRHVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS++VL  AK+  P   ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM
Sbjct  252  RANFDQSLNVLKHAKNVRP-DLVSKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++  G ++GF Y ASGP+VRSSYKAGEF++K++IE  +  
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKAGNELGFLYTASGPLVRSSYKAGEFFLKNLIEKRKTK  370

Query  237  SL  232
            ++
Sbjct  371  AI  372



>gb|KFO64951.1| hypothetical protein N302_04047, partial [Corvus brachyrhynchos]
Length=343

 Score =   200 bits (508),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  163  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPALQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSVRVLKRAKEVQP-GVISKTSIMLGLGETDEQIYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_006787315.1| PREDICTED: lipoyl synthase, mitochondrial-like [Neolamprologus 
brichardi]
Length=385

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 1/181 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  204  HFAKTVTNLKERNPQILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDP  263

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   LTKTSIMLG GET  Q++ TM ++R A VD +T GQYM
Sbjct  264  RANFDQSLSVLKHAKKVKPT-VLTKTSIMLGLGETDQQIISTMTELREAEVDCLTLGQYM  322

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F  ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++   A 
Sbjct  323  QPTKRHLKVEEYVTPERFAHWEKVGSDMGFTYTASGPLVRSSYKAGEFFLKNLLKKREAE  382

Query  237  S  235
            +
Sbjct  383  A  383



>ref|XP_009883302.1| PREDICTED: lipoyl synthase, mitochondrial [Charadrius vociferus]
Length=377

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD + VEKVA+SGLDV+AHN+ETV  LQ  VRD 
Sbjct  197  HFAKTVSHLKERNPKILVECLTPDFRGDLAAVEKVARSGLDVYAHNLETVPALQRKVRDP  256

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  257  RANFEQSIRVLKHAKKVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  315

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  316  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  375

Query  237  SL  232
            ++
Sbjct  376  AI  377



>ref|XP_004065786.1| PREDICTED: lipoyl synthase, mitochondrial [Oryzias latipes]
Length=390

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VE +A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  207  HFSKTVSNLKERNPQILVECLTPDFRGDLAAVETIALSGLDVYAHNVETVRELQRYVRDP  266

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RAN  QS+ VL  AK   P+  LTKTSIMLG GET +Q++ T+ ++R AGVD +T GQYM
Sbjct  267  RANIDQSLSVLKHAKKVRPS-LLTKTSIMLGLGETDEQILNTLTELREAGVDCLTLGQYM  325

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +P+KRH+ V EYI PE F  ++ +G QMGF Y ASGP+VRSSYKAGE+++K++++S +A
Sbjct  326  QPTKRHLKVEEYIPPEKFAHWEEVGNQMGFVYTASGPLVRSSYKAGEYFLKNLLKSRKA  384



>ref|XP_005490601.1| PREDICTED: lipoyl synthase, mitochondrial [Zonotrichia albicollis]
Length=461

 Score =   203 bits (516),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +  R L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  281  HFAKTVRHLKERNPKILVECLTPDFRGDLKAVEKVASSGLDVYAHNVETVPALQRKVRDP  340

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  341  RANFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  399

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  400  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  459

Query  237  SL  232
            ++
Sbjct  460  AI  461



>ref|XP_005030883.1| PREDICTED: lipoyl synthase, mitochondrial [Anas platyrhynchos]
Length=368

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  188  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  247

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  248  RANFEQSLCVLKHAKKVQP-GVISKTSIMLGLGETDEQVYATMKLLREADVDCLTLGQYM  306

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  307  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVE  361



>ref|XP_006011271.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Latimeria 
chalumnae]
Length=387

 Score =   201 bits (511),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD   VEK+A SGLDV+AHN+ETV ELQ   RD 
Sbjct  207  HFAQTVANLKQRNPKILVECLTPDFRGDLKSVEKIALSGLDVYAHNVETVRELQRKARDP  266

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+++R AGVD +T GQYM
Sbjct  267  RANFDQSLSVLQHAKKVQP-DLISKTSIMLGLGETDEQVYATMKELREAGVDCVTLGQYM  325

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K++IE
Sbjct  326  QPTKRHLKVDEYITPEKFKYWENIGDELGFLYTASGPLVRSSYKAGEFFLKNLIE  380



>gb|KFQ94486.1| hypothetical protein Y956_08279, partial [Nipponia nippon]
Length=343

 Score =   199 bits (507),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RASFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQVHSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_006504257.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Mus musculus]
Length=289

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  107  HIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  166

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GET +QV  T++ +RAA VD +T GQYM
Sbjct  167  RANFDQSLRVLRHAKEVQP-DVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYM  225

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  226  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLV  279



>ref|XP_004910979.1| PREDICTED: lipoyl synthase, mitochondrial-like [Xenopus (Silurana) 
tropicalis]
Length=372

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  NQ      L PDFRG+   VE VA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  192  HIAKTVSLLKERNQTILIECLTPDFRGNLKAVETVAGSGLDVYAHNVETVPALQRHVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS++VL  AK+  P   ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM
Sbjct  252  RANFDQSVNVLKHAKNVRPE-LISKTSIMLGLGETDEQIYSTMKALREAGVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K++IE
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLIE  365



>emb|CCU98976.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=366

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 128/179 (72%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+    + ++H  Q     ALVPDF G   CVE+VA+SGLDV+AHNIETVE    +VRD 
Sbjct  172  HIAATIQKIKHKAQHILVEALVPDFGGALECVEQVARSGLDVYAHNIETVERTTPLVRDR  231

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA ++QS+  L  AK   P   +TKTSIMLGCGET  +V +T+  +RA GVDV+TFGQYM
Sbjct  232  RAAYRQSLATLQHAKHVRP-DLVTKTSIMLGCGETDAEVEQTLHDLRAHGVDVVTFGQYM  290

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            RP+KRHM VSEY+TP+ F  +Q    ++GF YVASGP+VRSSY+AGEF+I++++   R 
Sbjct  291  RPTKRHMKVSEYVTPDKFAAWQARAEELGFLYVASGPLVRSSYRAGEFFIENVLRRRRG  349



>gb|KFP18031.1| hypothetical protein Z169_05668, partial [Egretta garzetta]
Length=343

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK   P
Sbjct  182  CLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFEQSVRVLKHAKAVQP  241

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  242  -GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  300

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  301  YWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVE  336



>ref|XP_001418286.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 sp|A4RZ86.1|LIAS_OSTLU RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO96579.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=399

 Score =   201 bits (511),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 124/164 (76%), Gaps = 2/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDFRG+   VE VA SGLDVFAHN+ETV ELQ  VRD RAN+ QS++VL  AK    
Sbjct  235  ALTPDFRGEKHLVELVATSGLDVFAHNVETVPELQRDVRDRRANWDQSIEVLKHAK--KS  292

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GET +QVV  ++ +R A VDV+TFGQYMRP+K+H+ V EY+TPEAF+
Sbjct  293  GAKITKTSIMLGLGETHEQVVNALKLLREADVDVVTFGQYMRPTKKHLAVVEYVTPEAFK  352

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            +YQ +  +MGF YVASG MVRSSYKAGEF++ ++I+  +A   A
Sbjct  353  RYQEIAEEMGFLYVASGAMVRSSYKAGEFFLANVIKQRKAKEAA  396



>ref|XP_007945361.1| PREDICTED: lipoyl synthase, mitochondrial-like [Orycteropus afer 
afer]
Length=272

 Score =   197 bits (501),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 123/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  92   HFAKTVSHLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDP  151

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GE  DQV  TM+ +R A VD +T GQYM
Sbjct  152  RANFDQSLCVLKHAKEVRP-DVISKTSIMLGLGENDDQVYATMKALREADVDCLTLGQYM  210

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  211  QPTKRHLKVEEYITPEKFKFWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  264



>gb|ETL84350.1| lipoyl synthase, mitochondrial [Phytophthora parasitica]
Length=383

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+G  + +++VA SGLDVFAHN+ETVE LQ  VRD+RAN+KQS+ VL  AK  AP
Sbjct  221  CLTPDFQGHDNLIDQVATSGLDVFAHNMETVERLQRRVRDYRANYKQSLHVLERAKVAAP  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GE  + V +T+  +R +GVDV+TFGQY+RPS +HMPV  Y+ PEAF 
Sbjct  281  H-LVTKTSLMLGVGERNEDVFQTLRDLRNSGVDVVTFGQYLRPSTKHMPVKSYVPPEAFA  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            ++Q +  QMGF YVASGPMVRSSYKAGEF++K+++++ +A  +A
Sbjct  340  EWQKVAEQMGFLYVASGPMVRSSYKAGEFFMKNLLKNRKAEVVA  383



>ref|XP_002899048.1| lipoic acid synthetase, mitochondrial precursor [Phytophthora 
infestans T30-4]
 sp|D0NP70.1|LIPA_PHYIT RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Phytophthora infestans T30-4]
 gb|EEY62412.1| lipoic acid synthetase, mitochondrial precursor [Phytophthora 
infestans T30-4]
Length=383

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDF+G  + +++VA SGLDVFAHN+ETVE LQ  VRD+RAN+KQS+ VL  AK  AP
Sbjct  221  CLTPDFQGHDNLIDQVATSGLDVFAHNMETVERLQRRVRDYRANYKQSLHVLERAKVAAP  280

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GE  + + +T+  +R +GVDV+TFGQY+RPS +HMPV  Y+TPEAF 
Sbjct  281  H-LVTKTSLMLGVGERNEDLFQTLRDLRNSGVDVVTFGQYLRPSTKHMPVKSYVTPEAFA  339

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
            ++Q +  QMGF YVASGPMVRSSYKAGEF++K+++++ +   +A
Sbjct  340  EWQKVAEQMGFLYVASGPMVRSSYKAGEFFMKNLLKNRKTQVVA  383



>ref|XP_010708614.1| PREDICTED: lipoyl synthase, mitochondrial [Meleagris gallopavo]
Length=366

 Score =   200 bits (508),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  +RD 
Sbjct  186  HFAKTVSHLKERNSKIVVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKIRDP  245

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P   ++KTS+MLG GET +QV  TM+ +R AGVD +T GQYM
Sbjct  246  RANFEQSVRVLKHAKEVQPR-VISKTSLMLGLGETDEQVFSTMKLLREAGVDCLTLGQYM  304

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  305  QPTKRHLKVEEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVE  359



>ref|XP_001374049.1| PREDICTED: lipoyl synthase, mitochondrial [Monodelphis domestica]
Length=372

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEK+A+SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HFAKTVSYLKERNSNILVECLTPDFRGDLKAVEKIARSGLDVYAHNVETVPELQRQVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSVQVLKHAKKVQP-NVISKTSIMLGLGETDEQVYSTMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KR++ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  311  QPTKRNLKVEEYVTPEKFKYWEKIGNELGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTR  370

Query  237  SL  232
            +L
Sbjct  371  TL  372



>ref|XP_004564359.1| PREDICTED: lipoyl synthase, mitochondrial-like [Maylandia zebra]
 ref|XP_005928364.1| PREDICTED: lipoyl synthase, mitochondrial-like [Haplochromis 
burtoni]
Length=385

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  204  HFAKTVTNLKERNPQILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDP  263

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   LTKTSIMLG GET  Q++ TM ++R A VD +T GQYM
Sbjct  264  RANFDQSLSVLKHAKKVKPT-VLTKTSIMLGLGETDQQIISTMTELREAEVDCLTLGQYM  322

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F  ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++
Sbjct  323  QPTKRHLKVEEYVTPERFAHWEKVGSDMGFTYTASGPLVRSSYKAGEFFLKNLLK  377



>ref|XP_009894883.1| PREDICTED: lipoyl synthase, mitochondrial [Picoides pubescens]
Length=384

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD S VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  204  HFAKTVSHLKERNSKILVECLTPDFRGDLSAVEKVALSGLDVYAHNVETVPELQRKVRDP  263

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK   P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  264  RASFEQSIRVLKHAKAVQP-GVISKTSIMLGLGETDEQVYATMKLLREADVDCLTLGQYM  322

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  323  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  382

Query  237  SL  232
            ++
Sbjct  383  AI  384



>ref|XP_004396213.1| PREDICTED: lipoyl synthase, mitochondrial [Odobenus rosmarus 
divergens]
Length=373

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFNQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -GVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVDEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   + +S
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKKSS  371



>ref|XP_009460123.1| PREDICTED: lipoyl synthase, mitochondrial [Nipponia nippon]
Length=362

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  182  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  241

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK+  P G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  242  RASFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQVHSTMKLLREADVDCLTLGQYM  300

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  301  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  360

Query  237  SL  232
            ++
Sbjct  361  AI  362



>ref|XP_010400474.1| PREDICTED: lipoyl synthase, mitochondrial [Corvus cornix cornix]
Length=362

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  182  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPALQRKVRDP  241

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM
Sbjct  242  RANFEQSVRVLKHAKEVQP-GVISKTSIMLGLGETDEQIYSTMKLLREADVDCLTLGQYM  300

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  301  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  360

Query  237  SL  232
            ++
Sbjct  361  AI  362



>emb|CBY38287.1| unnamed protein product [Oikopleura dioica]
Length=354

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/178 (51%), Positives = 129/178 (72%), Gaps = 0/178 (0%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H     R ++  N       L+PD+RGD  CV+  AKSGLDV+AHN+ETV+ LQ  VRD 
Sbjct  170  HFAEVVRQVKKENPDLLVECLLPDWRGDLDCVDVTAKSGLDVYAHNVETVKRLQKFVRDP  229

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA ++QSM  L  AK   P G +TKTS+MLG GET +++++TM+ +R+ GVD +TFGQYM
Sbjct  230  RAGYEQSMLTLEEAKKRGPPGLVTKTSLMLGMGETDEEILQTMKDLRSIGVDCVTFGQYM  289

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            +P+KRHM V EY+ P+ F  ++ +G+++GF YV SGP+VRSSYKAGEF++K+ +E ++
Sbjct  290  QPTKRHMKVEEYVHPDKFAMWEKVGLELGFAYVPSGPLVRSSYKAGEFFLKTFVEKNK  347



>emb|CBY20860.1| unnamed protein product [Oikopleura dioica]
Length=354

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L+PD+RGD  CV+  AKSGLDV+AHN+ETV+ LQ  VRD RA ++QSM  L  AK   P
Sbjct  189  CLLPDWRGDLDCVDVTAKSGLDVYAHNVETVKRLQKFVRDPRAGYEQSMLTLEEAKKRGP  248

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G +TKTS+MLG GET +++++TM+ +R+ GVD +TFGQYM+P+KRHM V EY+ P+ F 
Sbjct  249  PGLVTKTSLMLGMGETDEEILQTMKDLRSIGVDCVTFGQYMQPTKRHMKVEEYVHPDKFA  308

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
             ++ +G+++GF YV SGP+VRSSYKAGEF++K+ +E ++
Sbjct  309  MWEKVGLELGFAYVPSGPLVRSSYKAGEFFLKTFVEKNK  347



>ref|XP_005286416.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Chrysemys 
picta bellii]
Length=369

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  189  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  248

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANFKQS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  249  RANFKQSLQVLKHAKKVQP-DVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  307

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TP+ F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  308  QPTKRHLKVEEYVTPDKFKHWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVE  362



>ref|XP_423226.3| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Gallus 
gallus]
Length=385

 Score =   200 bits (508),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD + VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  205  HFAKTVSHLKERNSKIVVECLTPDFRGDLNAVEKVALSGLDVYAHNVETVPELQRKVRDP  264

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P   ++KTS+MLG GET +QV+ TM+ +R AGVD +T GQYM
Sbjct  265  RANFEQSVRVLKHAKAVQPR-VISKTSLMLGLGETDEQVLATMKLLREAGVDCLTLGQYM  323

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  324  QPTKRHLKVEEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVE  378



>gb|EPX74142.1| lipoic acid synthetase [Schizosaccharomyces octosporus yFS286]
Length=371

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL PDF G    V+ VAKSGLDVFAHN+ETVE+L   VRD RA ++QS+ VL  AK   P
Sbjct  206  ALTPDFSGRLDLVDVVAKSGLDVFAHNVETVEDLTRYVRDRRATYRQSLSVLEQAKKSVP  265

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLG GET ++V++T+  +RA GVDV+TFGQYMRP+KRH+ V EY+ P+ FE
Sbjct  266  H-LITKTSIMLGLGETDEEVIRTLRDLRAHGVDVVTFGQYMRPTKRHLKVQEYVHPKKFE  324

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             +Q +  ++GF YVASGP+VRSSYKAGEF+IK++IE
Sbjct  325  YWQEVAEKLGFLYVASGPLVRSSYKAGEFFIKNLIE  360



>gb|ERE87602.1| lipoyl synthase [Cricetulus griseus]
Length=258

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  76   HIAKTVSCLKGRNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  135

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL   K   P   +TKTSIMLG GET +QV  TM+ +RAA VD +T GQYM
Sbjct  136  RANFDQSLCVLKHVKKVQP-DIITKTSIMLGLGETDEQVHATMKALRAADVDCLTLGQYM  194

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  195  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  248



>ref|XP_003972216.1| PREDICTED: lipoyl synthase, mitochondrial-like [Takifugu rubripes]
Length=395

 Score =   200 bits (509),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEK+A SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK   P
Sbjct  224  CLTPDFRGDLVAVEKIALSGLDVYAHNVETVRELQRHVRDPRANFDQSLSVLKHAKKVKP  283

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               L+KTSIMLG GET  Q++ T+ ++R AGVD +T GQYM+P+KRH+ V EYITPE F 
Sbjct  284  T-LLSKTSIMLGLGETDQQILNTLMELREAGVDCLTLGQYMQPTKRHLKVEEYITPERFS  342

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
             ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++  +A
Sbjct  343  YWEKVGNDMGFVYTASGPLVRSSYKAGEFFLKNLLKEKKA  382



>gb|KFO99312.1| hypothetical protein N300_04072, partial [Calypte anna]
Length=343

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSIRVLKHAKKVQPR-VISKTSIMLGLGETDEQVYSTMKLLREAEVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_009639591.1| PREDICTED: lipoyl synthase, mitochondrial [Egretta garzetta]
Length=370

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK   P
Sbjct  209  CLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFEQSVRVLKHAKAVQP  268

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  269  -GVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  327

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  328  YWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVE  363



>ref|XP_005286415.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Chrysemys 
picta bellii]
Length=384

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  204  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  263

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANFKQS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  264  RANFKQSLQVLKHAKKVQP-DVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  322

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TP+ F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  323  QPTKRHLKVEEYVTPDKFKHWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVE  377



>gb|EPB85254.1| lipoyl synthase, mitochondrial [Mucor circinelloides f. circinelloides 
1006PhL]
Length=343

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF GD   VE VA SGLDV+AHNIETVE L   VRD RA F+QS+ VL   K   P
Sbjct  164  CLTGDFGGDLKGVETVALSGLDVYAHNIETVEALTPFVRDRRAGFRQSLGVLQHVKKVKP  223

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET ++V++T++++R A VD +T GQYMRP+KRHM V EY+TPE F+
Sbjct  224  -DMITKTSIMLGCGETDEEVLETLQELRKADVDCVTLGQYMRPTKRHMKVHEYVTPEKFK  282

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             ++  GMQMGF+YVASGP+VRSSYKAGEF+I ++++  +   L 
Sbjct  283  HWETTGMQMGFKYVASGPLVRSSYKAGEFFIGNILKKRKGLPLT  326



>ref|XP_005741202.1| PREDICTED: lipoyl synthase, mitochondrial-like [Pundamilia nyererei]
Length=385

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 123/175 (70%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  204  HFAKTVTNLKERNPQILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDP  263

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   LTKTSIMLG GET  Q+V TM  +R A VD +T GQYM
Sbjct  264  RANFDQSLSVLKHAKKVKPT-VLTKTSIMLGLGETDQQIVSTMTGLREAEVDCLTLGQYM  322

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F  ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++
Sbjct  323  QPTKRHLKVEEYVTPERFAHWEKVGSDMGFTYTASGPLVRSSYKAGEFFLKNLLK  377



>ref|NP_001012037.1| lipoyl synthase, mitochondrial precursor [Rattus norvegicus]
 sp|Q5XIH4.1|LIAS_RAT RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Rattus norvegicus]
 gb|AAH83708.1| Lipoic acid synthetase [Rattus norvegicus]
Length=373

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  191  HIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  250

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GET +QV  TM+ +RAA VD +T GQYM
Sbjct  251  RANFDQSLRVLKHAKEVQP-DVVSKTSIMLGLGETDEQVYATMKALRAADVDCLTLGQYM  309

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  310  QPTKRHLKVEEYVTPEKFKYWEEVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  363



>ref|XP_008490116.1| PREDICTED: lipoyl synthase, mitochondrial [Calypte anna]
Length=359

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  179  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  238

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  239  RANFEQSIRVLKHAKKVQPR-VISKTSIMLGLGETDEQVYSTMKLLREAEVDCLTLGQYM  297

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  298  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  357

Query  237  SL  232
            ++
Sbjct  358  AI  359



>gb|KFO80379.1| hypothetical protein N303_08395, partial [Cuculus canorus]
Length=343

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P+  ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  223  RANFEQSLRVLKHAKQVKPS-IISKTSIMLGLGEMDEQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_001632487.1| predicted protein [Nematostella vectensis]
 gb|EDO40424.1| predicted protein, partial [Nematostella vectensis]
Length=348

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 132/182 (73%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H     R ++  N       L PDFRG+   +  VA+SGLDV+AHN+ETV+ LQ +VRD 
Sbjct  163  HFAETVRQIKKRNPKMLVECLTPDFRGNREHIRTVAESGLDVYAHNVETVKSLQLLVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RAN+KQS+DVL   K+  P   +TKTSIMLG GET D+V++TM+ +R+ GVD +T GQYM
Sbjct  223  RANYKQSLDVLRYVKEVRPE-MVTKTSIMLGVGETDDEVLQTMKDLRSIGVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P++ H+ VSEY+TP  F+ ++ +G ++GF Y ASGP+VRSSYKAGEF+IK++++S R+ 
Sbjct  282  QPTRLHLKVSEYVTPNKFQHWENVGNELGFAYTASGPLVRSSYKAGEFFIKNILKSRRSG  341

Query  237  SL  232
             +
Sbjct  342  PI  343



>ref|XP_008639723.1| PREDICTED: lipoyl synthase, mitochondrial [Corvus brachyrhynchos]
Length=381

 Score =   199 bits (507),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  201  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPALQRKVRDP  260

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P G ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM
Sbjct  261  RANFEQSVRVLKRAKEVQP-GVISKTSIMLGLGETDEQIYSTMKLLREADVDCLTLGQYM  319

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  320  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  379

Query  237  SL  232
            ++
Sbjct  380  AI  381



>gb|KGL80416.1| hypothetical protein N309_03875, partial [Tinamus guttatus]
Length=309

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  129  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRRVRDP  188

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK+  P   ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM
Sbjct  189  RASFEQSLRVLRHAKELRPE-LVSKTSIMLGLGETDEQLHATMKLLREAGVDCLTLGQYM  247

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  248  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFYYTASGPLVRSSYKAGEFFLKNLVEKRKTK  307

Query  237  SL  232
            ++
Sbjct  308  AI  309



>ref|XP_006029302.1| PREDICTED: lipoyl synthase, mitochondrial [Alligator sinensis]
Length=363

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK   P
Sbjct  202  CLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFEQSLCVLKHAKKVQP  261

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  262  -DVISKTSIMLGLGETDEQIHSTMKLLREADVDCLTLGQYMQPTKRHLKVEEYVTPEKFK  320

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K++IE  +  ++
Sbjct  321  YWEKVGKELGFHYTASGPLVRSSYKAGEFFLKNLIEKRKTKAI  363



>gb|EWM28169.1| lipoic acid synthetase [Nannochloropsis gaditana]
Length=400

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 122/175 (70%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +  R L+          L PDFRG  S +E+VA SGLDV+AHN+ETVE LQ  VRDH
Sbjct  210  HFAKTVRGLKARKPTLLVECLTPDFRGQASLIERVALSGLDVYAHNLETVERLQRRVRDH  269

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA + QS+ VL  AK  AP   LTKTS+MLG GE P+ V  T+  +R AGVDV+TFGQY+
Sbjct  270  RAGYSQSLFVLEHAKKRAPK-LLTKTSLMLGVGERPEDVRATLRDLRTAGVDVVTFGQYL  328

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            RP+KRHMPV  YITP  F+ +Q     + F+YVASGP+VRSSYKAGEF++K +++
Sbjct  329  RPTKRHMPVQAYITPAQFQAWQAEAEALNFKYVASGPLVRSSYKAGEFFLKGVLK  383



>ref|XP_008831461.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Nannospalax 
galili]
Length=372

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKSVEKVALSGLDVYAHNVETVPELQRKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R AGVD +T GQYM
Sbjct  252  RANFEQSLHVLKHAKKAQP-DVVSKTSIMLGLGETDEQVYATMKALREAGVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITP  F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTKRHLKVEEYITPAKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  AL  372



>ref|XP_010217486.1| PREDICTED: lipoyl synthase, mitochondrial [Tinamus guttatus]
Length=303

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  123  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRRVRDP  182

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK+  P   ++KTSIMLG GET +Q+  TM+ +R AGVD +T GQYM
Sbjct  183  RASFEQSLRVLRHAKELRPE-LVSKTSIMLGLGETDEQLHATMKLLREAGVDCLTLGQYM  241

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  242  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFYYTASGPLVRSSYKAGEFFLKNLVEKRKTK  301

Query  237  SL  232
            ++
Sbjct  302  AI  303



>ref|XP_007612770.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Cricetulus 
griseus]
 ref|XP_007612772.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Cricetulus 
griseus]
Length=289

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  107  HIAKTVSCLKGRNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  166

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL   K   P   +TKTSIMLG GET +QV  TM+ +RAA VD +T GQYM
Sbjct  167  RANFDQSLCVLKHVKKVQP-DIITKTSIMLGLGETDEQVHATMKALRAADVDCLTLGQYM  225

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  226  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  279



>ref|XP_009564868.1| PREDICTED: lipoyl synthase, mitochondrial [Cuculus canorus]
Length=352

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  172  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  231

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P+  ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  232  RANFEQSLRVLKHAKQVKPS-IISKTSIMLGLGEMDEQVYSTMKLLREADVDCLTLGQYM  290

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  291  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  350

Query  237  SL  232
            ++
Sbjct  351  AI  352



>gb|EDL37740.1| lipoic acid synthetase, isoform CRA_b [Mus musculus]
Length=340

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  158  HIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  217

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GET +QV  T++ +RAA VD +T GQYM
Sbjct  218  RANFDQSLRVLRHAKEVQP-DVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYM  276

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  277  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLV  330



>ref|XP_001659989.1| AAEL009368-PA [Aedes aegypti]
 sp|Q16W22.1|LIAS_AEDAE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Aedes aegypti]
 gb|EAT38774.1| AAEL009368-PA [Aedes aegypti]
Length=393

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+    R ++  N       L PDFRGD  CV+ VA+SGLDV+AHNIETVE L   VRD 
Sbjct  197  HIAATIREIKRQNPRIFVECLAPDFRGDLECVKVVAQSGLDVYAHNIETVEALTPFVRDR  256

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA ++QS+DVL   K+  P+  +TKTSIMLG GET +Q+ +TM+ +R+ GVD +T GQYM
Sbjct  257  RARYRQSLDVLRSIKEINPS-MITKTSIMLGLGETDEQIEQTMKDLRSVGVDCLTLGQYM  315

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIES  250
            +P+KRH+ V EY+TPE F+ ++  G ++GF Y ASGP+VRSSYKAGEF+I S++++
Sbjct  316  QPTKRHLKVIEYVTPEKFKHWETRGNELGFLYTASGPLVRSSYKAGEFFITSILKN  371



>ref|XP_011390992.1| hypothetical protein UMAG_11549 [Ustilago maydis 521]
 gb|KIS67557.1| hypothetical protein UMAG_11549 [Ustilago maydis 521]
Length=795

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF GD +CVEKVA SG+DVFAHN+ETVE    +VRD RA ++QS+ VL+ AK   P
Sbjct  620  ALVPDFSGDMACVEKVAHSGVDVFAHNVETVERTTPMVRDRRAKYRQSLAVLLHAKQANP  679

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            A  +TKTSIMLGCGE  D+V +T+  +R A VDV+TFGQYMRP+KRHM V +Y++P+ F 
Sbjct  680  A-LITKTSIMLGCGERDDEVEQTLRDLRNAHVDVVTFGQYMRPTKRHMKVHQYVSPDMFL  738

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
             +Q     +GF YVASGP+VRSSYKAGEF+IK+++E   +A
Sbjct  739  HWQKRAEHLGFLYVASGPLVRSSYKAGEFFIKNVLEQRNSA  779



>ref|XP_003471593.1| PREDICTED: lipoyl synthase, mitochondrial [Cavia porcellus]
Length=371

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  191  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDP  250

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P G ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  251  RANFDQSLRVLRHAKEVQP-GVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  309

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  310  QPTKRHLKVEEYITPEKFKYWEKVGSELGFHYTASGPLVRSSYKAGEFFLKNLV  363



>ref|XP_004681401.1| PREDICTED: lipoyl synthase, mitochondrial [Condylura cristata]
Length=372

 Score =   198 bits (504),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHNIETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNIETVPELQRKVRDPRANFDQSLRVLKYAKEVQP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGETDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  330  YWEKIGNELGFHYTASGPLVRSSYKAGEFFLKNLV  364



>emb|CCX04952.1| Similar to Lipoyl synthase, mitochondrial; acc. no. B8NUL8 [Pyronema 
omphalodes CBS 100304]
Length=398

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 129/164 (79%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            AL  DF GD + VE VA+SGLDV+AHN+ETVEEL   VRD RA F+QS+ VL  AK+ + 
Sbjct  223  ALTGDFMGDLAQVEIVAQSGLDVYAHNVETVEELTPFVRDRRATFRQSLAVLKKAKE-SK  281

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
             G +TKTS+MLG GET +QV+  ++++R A VDV+TFGQYMRP+KRHM V +Y+TPE FE
Sbjct  282  EGLITKTSMMLGLGETEEQVMDALKELRKADVDVVTFGQYMRPTKRHMKVEKYVTPEEFE  341

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             ++V  ++MGF YVASGP+VRSSYKAGE +I+++++  RAA +A
Sbjct  342  SWRVKALEMGFMYVASGPLVRSSYKAGEAFIENVLKKRRAAGVA  385



>ref|XP_007605726.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Cricetulus 
griseus]
 ref|XP_007605727.1| PREDICTED: lipoyl synthase, mitochondrial isoform X2 [Cricetulus 
griseus]
Length=289

 Score =   196 bits (498),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  107  HIAKTVSCLKGRNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  166

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL   K   P   +TKTSIMLG GET +QV  TM+ +RAA VD +T GQYM
Sbjct  167  RANFDQSLCVLKHVKKVQP-DIVTKTSIMLGLGETDEQVHATMKALRAADVDCLTLGQYM  225

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  226  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  279



>ref|XP_008315124.1| PREDICTED: lipoyl synthase, mitochondrial [Cynoglossus semilaevis]
Length=413

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD + VE+VA SGLDV+AHN+ETV ELQ  VRD +ANF QS+ VL  AK   P
Sbjct  249  CLTPDFRGDLAAVERVALSGLDVYAHNVETVRELQRFVRDPKANFDQSLSVLKHAKKVNP  308

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            A  LTKTSIMLG GE+  Q+  T+ ++R A VD +T GQYM+P+KRH+ V EYITPE F 
Sbjct  309  A-LLTKTSIMLGLGESDQQIHNTLTELREAEVDCLTLGQYMQPTKRHLKVDEYITPEKFS  367

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
             ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++  R A
Sbjct  368  YWEKVGNDMGFAYTASGPLVRSSYKAGEFFLKNLLKKRRTA  408



>ref|XP_005149243.1| PREDICTED: lipoyl synthase, mitochondrial [Melopsittacus undulatus]
Length=367

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV  LQ  VRD 
Sbjct  187  HFAKTVSHLKERNSKILVECLTPDFRGDLQAVEKVALSGLDVYAHNVETVPALQRKVRDP  246

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK+  P   +TKTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  247  RANFEQSVRVLKHAKEVQPR-VITKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  305

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  306  QPTKRHLKVEEYVTPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  365

Query  237  SL  232
            ++
Sbjct  366  AI  367



>ref|XP_005435425.1| PREDICTED: lipoyl synthase, mitochondrial [Falco cherrug]
Length=381

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDVFAHN+ETV ELQ  VRD 
Sbjct  201  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVFAHNVETVPELQRKVRDP  260

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA F+QS+ VL  AK+  P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  261  RAGFEQSVRVLKHAKEVQPR-VISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  319

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  320  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  379

Query  237  SL  232
            ++
Sbjct  380  AI  381



>ref|XP_006732375.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Leptonychotes 
weddellii]
Length=373

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFNQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVDEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   + +S
Sbjct  330  HWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKKSS  371



>ref|NP_077791.1| lipoyl synthase, mitochondrial precursor [Mus musculus]
 sp|Q99M04.1|LIAS_MOUSE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; Short=mLIP1; AltName: 
Full=Lipoic acid synthase; Flags: Precursor [Mus musculus]
 gb|AAH02141.1| Lipoic acid synthetase [Mus musculus]
 dbj|BAB62009.1| lipoic acid synthase [Mus musculus]
 dbj|BAC33443.1| unnamed protein product [Mus musculus]
 dbj|BAC33804.1| unnamed protein product [Mus musculus]
 dbj|BAC36672.1| unnamed protein product [Mus musculus]
 gb|EDL37739.1| lipoic acid synthetase, isoform CRA_a [Mus musculus]
Length=373

 Score =   198 bits (503),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  191  HIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDP  250

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GET +QV  T++ +RAA VD +T GQYM
Sbjct  251  RANFDQSLRVLRHAKEVQP-DVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYM  309

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  310  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLV  363



>ref|XP_005191392.1| PREDICTED: lipoyl synthase, mitochondrial [Musca domestica]
Length=384

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+    R ++  N       LVPDFRGD SCVE +AKSGLDV+AHNIETVE+L   VRD 
Sbjct  199  HIAETVREIKQRNPNIFVECLVPDFRGDLSCVETIAKSGLDVYAHNIETVEKLTPFVRDR  258

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+++Q++ VL  AK + P   LTK+SIMLG GE+  +V +TM+ +R A VD +T GQYM
Sbjct  259  RADYRQTLKVLTEAKKFNPK-LLTKSSIMLGLGESDAEVEQTMQDLRQADVDCLTLGQYM  317

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIES  250
            +P+K+H+ V EY+TPE F+ ++  G ++GF Y ASGP+VRSSYKAGEF I S++++
Sbjct  318  QPTKKHLKVIEYVTPEKFKTWENRGKELGFLYTASGPLVRSSYKAGEFLITSILKT  373



>ref|XP_002181691.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 sp|B7G3Y9.1|LIPA2_PHATC RecName: Full=Lipoyl synthase 2, mitochondrial; AltName: Full=Lipoate 
synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoic 
acid synthase 2; Flags: Precursor [Phaeodactylum 
tricornutum CCAP 1055/1]
 gb|EEC46905.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=314

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/159 (60%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             LV DF+G    VE +A SGLDV+AHN+ETVE LQ  VRD RAN++QS+  L  AK   P
Sbjct  146  CLVSDFQGMLDSVETLALSGLDVYAHNVETVERLQPFVRDARANYQQSLSTLQHAKVVKP  205

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
                TKTSIMLG GET ++V +TM  +RA GVDV+TFGQY+RP++ H+ V EY+TPE F+
Sbjct  206  E-LYTKTSIMLGLGETEEEVTQTMTDLRAIGVDVVTFGQYLRPTEHHLSVVEYVTPEKFD  264

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
             Y+ +G  MGF+YVASGPMVRSSYKAGEFY++ MI+ +R
Sbjct  265  HYRQVGENMGFKYVASGPMVRSSYKAGEFYLEHMIKKER  303



>ref|XP_008580203.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Galeopterus 
variegatus]
Length=364

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  184  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDP  243

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  244  RANFNQSLRVLKHAKEVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  302

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  303  QPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTN  362

Query  237  SL  232
            +L
Sbjct  363  AL  364



>ref|XP_005243299.1| PREDICTED: lipoyl synthase, mitochondrial [Falco peregrinus]
Length=381

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDVFAHN+ETV ELQ  VRD 
Sbjct  201  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVFAHNVETVPELQRKVRDP  260

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA F+QS+ VL  AK+  P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  261  RAGFEQSVRVLKHAKEVQPR-VISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  319

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  320  QPTKRHLKVEEYITPEKFKYWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  379

Query  237  SL  232
            ++
Sbjct  380  AI  381



>ref|XP_007426516.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Python 
bivittatus]
Length=395

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 128/178 (72%), Gaps = 1/178 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQS VRD 
Sbjct  215  HFAKTVSQLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQSKVRDP  274

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF+QS+ VL  AK   P   ++KTSIMLG GET +Q+  T++++R A VD +T GQYM
Sbjct  275  RANFEQSICVLKHAKKVQP-NVISKTSIMLGLGETDEQLHATLKRLREADVDCLTLGQYM  333

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K++I + +
Sbjct  334  QPTKRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLIHTRK  391



>ref|XP_004009824.1| PREDICTED: lipoyl synthase, mitochondrial isoform 1 [Ovis aries]
Length=372

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  DQV  TM+ +R A VD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  271  -DVISKTSIMLGLGENDDQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYVTPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL  372



>ref|XP_005359323.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Microtus 
ochrogaster]
Length=374

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVSCLKERNPKILVECLTPDFRGDLGAVEKVALSGLDVYAHNVETVPELQRKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +RAA VD +T GQYM
Sbjct  252  RANFDQSLRVLKHAKKVQP-DIVSKTSIMLGLGETDEQVHATMKALRAADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  311  QPTKRHLKVEEYVTPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  364



>ref|XP_010978683.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
dromedarius]
Length=372

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RA+F QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRASFDQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +QV  TME +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGETDEQVYATMEALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL  372



>ref|XP_002047613.1| GJ11834 [Drosophila virilis]
 gb|EDW69955.1| GJ11834 [Drosophila virilis]
Length=286

 Score =   195 bits (495),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+    R ++  N       LVPDFRGD  CV+ +A  GLDV+AHNIETVE+L   VRD 
Sbjct  107  HIAETVREIKARNSNIFVECLVPDFRGDLECVKTIATCGLDVYAHNIETVEKLTPFVRDR  166

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+++Q++ VL  AK + P   +TK+SIMLG GET  +V +TM  +R AGV+ +T GQYM
Sbjct  167  RAHYRQTLQVLREAKGFNP-NLITKSSIMLGLGETDAEVEQTMLDLREAGVECLTLGQYM  225

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++V G ++GF Y ASGP+VRSSYKAGEF+I S++ + R +
Sbjct  226  QPTKRHLKVIEYVTPEKFKHWEVRGNELGFLYTASGPLVRSSYKAGEFFITSILANRRKS  285



>ref|XP_536255.1| PREDICTED: lipoyl synthase, mitochondrial isoformX1 [Canis lupus 
familiaris]
Length=373

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHNIETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNIETVPELQRKVRDPRANFSQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   + +S
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKKSS  371



>ref|XP_006129607.1| PREDICTED: lipoyl synthase, mitochondrial, partial [Pelodiscus 
sinensis]
Length=385

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 119/155 (77%), Gaps = 1/155 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK   P
Sbjct  224  CLTPDFRGDLKAVEKVALSGLDVYAHNVETVSELQRKVRDPRANFEQSLQVLKHAKKVQP  283

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  284  -DIISKTSIMLGLGETDEQIYSTMKLLREAAVDCLTLGQYMQPTKRHLKVEEYVTPEKFK  342

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  343  HWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLV  377



>ref|XP_006189037.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
ferus]
 ref|XP_010960960.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Camelus 
bactrianus]
Length=372

 Score =   197 bits (502),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RA+F QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRASFDQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +QV  TME +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGETDEQVYATMEALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL  372



>ref|XP_008276634.1| PREDICTED: lipoyl synthase, mitochondrial [Stegastes partitus]
Length=414

 Score =   198 bits (504),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 126/179 (70%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +L+  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  231  HFAKTVSNLKERNHQILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRYVRDP  290

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RAN  QS+ VL  AK   P   LTKTSIMLG GE+ +Q++ T+ ++R A VD +T GQYM
Sbjct  291  RANIDQSLSVLKHAKKVNPT-VLTKTSIMLGLGESDEQIMNTLTELREARVDCLTLGQYM  349

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
            +P+KRH+ V EY+TPE F  ++ +G  MGF Y ASGP+VRSSYKAGEF++K++++  +A
Sbjct  350  QPTKRHLKVEEYVTPEKFAHWEKVGNDMGFVYTASGPLVRSSYKAGEFFLKNLLKKRKA  408



>ref|XP_004703221.1| PREDICTED: lipoyl synthase, mitochondrial [Echinops telfairi]
Length=372

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VE+V+ SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAVEQVSLSGLDVYAHNVETVPELQRKVRDPRANFEQSLRVLTHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +QV  TM+ +R A VD +TFGQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGETDEQVHATMKALRKADVDCLTFGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWENVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVAKRKLKAL  372



>ref|XP_005319979.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Ictidomys 
tridecemlineatus]
Length=372

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLKHAKEVQP-DLISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKIGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  AL  372



>ref|XP_001702321.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
 sp|A8JGF7.1|LIAS_CHLRE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Chlamydomonas reinhardtii]
 gb|EDO97051.1| lipoic acid synthetase [Chlamydomonas reinhardtii]
Length=318

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF+GD   V+ + ++GLDV+AHNIETVE LQ  VRD RA + QS+  L  AK  + 
Sbjct  134  ALVPDFQGDMGGVQTIVEAGLDVYAHNIETVERLQGQVRDRRAGWAQSLATLSAAKRVSG  193

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               LTK+SIMLGCGE+ ++VV T++ +RA GVDV+T GQYMRP+K+HM V+E++TPEAF 
Sbjct  194  GRLLTKSSIMLGCGESREEVVDTLKALRANGVDVVTLGQYMRPTKKHMAVAEFVTPEAFA  253

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             Y+ +   +GF YVASGPMVRSSY+AGE YI ++++
Sbjct  254  AYEQIAKDLGFLYVASGPMVRSSYRAGELYITNVLK  289



>ref|XP_010382782.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Rhinopithecus 
roxellana]
Length=372

 Score =   197 bits (501),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQS VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLKHAKKVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P++RH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTRRHLKVEEYITPEKFQYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  TL  372



>gb|EIE77277.1| hypothetical protein RO3G_01981 [Rhizopus delemar RA 99-880]
Length=405

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 121/166 (73%), Gaps = 1/166 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF G    VE VAKSGLDV+AHNIETVE L   VRD RA F+QS+ VL  AK   P
Sbjct  230  CLTGDFGGSLEGVETVAKSGLDVYAHNIETVEALTPYVRDRRAGFRQSLKVLEHAKKTRP  289

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET ++V++ ++++R   VD +T GQYMRP+KRHM V EY+TPE F+
Sbjct  290  -DLITKTSIMLGCGETDEEVLEALQELRKVDVDCVTLGQYMRPTKRHMKVHEYVTPEKFK  348

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA*T  223
             ++  GM+MGF+YVASGP+VRSSYKAGEFYI ++++  R   L  T
Sbjct  349  HWETKGMEMGFKYVASGPLVRSSYKAGEFYIGNILKGRRGLPLTPT  394



>ref|XP_010776311.1| PREDICTED: lipoyl synthase, mitochondrial [Notothenia coriiceps]
Length=389

 Score =   197 bits (502),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 118/156 (76%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD RAN  QS+ VL  AK   P
Sbjct  225  CLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRFVRDPRANIDQSLSVLRHAKKVKP  284

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            +  LTKTSIMLG GET  Q+  TM ++R A VD +T GQYM+P+KRH+ V EY+TPE F 
Sbjct  285  S-VLTKTSIMLGLGETDQQIHNTMTELREAEVDCLTLGQYMQPTKRHLKVDEYVTPEKFA  343

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             ++ +G +MGF Y ASGP+VRSSYKAGEF++K++++
Sbjct  344  HWEKVGNEMGFVYTASGPLVRSSYKAGEFFLKNLLK  379



>ref|XP_006169324.1| PREDICTED: lipoyl synthase, mitochondrial [Tupaia chinensis]
Length=401

 Score =   198 bits (503),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHNIETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  240  CLTPDFRGDLKAIEKVALSGLDVYAHNIETVPELQRKVRDPRANFDQSLRVLRHAKEVQP  299

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM+P++RH+ V EYITPE F+
Sbjct  300  E-VISKTSIMLGLGETDEQVYATMKALREANVDCLTLGQYMQPTRRHLKVEEYITPEKFK  358

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  359  CWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVSKRKTKAL  401



>ref|XP_001732059.1| hypothetical protein MGL_0652 [Malassezia globosa CBS 7966]
 gb|EDP44845.1| hypothetical protein MGL_0652 [Malassezia globosa CBS 7966]
Length=336

 Score =   196 bits (498),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF G  + VE+VA SGLDV+AHNIETVE    +VRD RA ++QS+  L  AK   P
Sbjct  145  ALVPDFGGSMANVEQVALSGLDVYAHNIETVERTTPLVRDRRAKYRQSLATLQHAKSVRP  204

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET  +V +T+  +R A VDV+TFGQYMRP+KRHM VSEY+ PE F 
Sbjct  205  E-LVTKTSIMLGCGETDAEVEQTLRDLRDANVDVVTFGQYMRPTKRHMKVSEYVEPEKFT  263

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
             +Q L  Q+GF YVASGP+VRSSY+AGEF+I+++I   R 
Sbjct  264  HWQRLAEQLGFLYVASGPLVRSSYRAGEFFIENVIRKRRG  303



>ref|XP_007066486.1| PREDICTED: lipoyl synthase, mitochondrial [Chelonia mydas]
Length=435

 Score =   199 bits (505),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  255  HFAKTVSHLKERNSKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  314

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANFKQS+ VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  315  RANFKQSLQVLKHAKKVQP-DVISKTSIMLGLGETDEQVYSTMKLLREADVDCLTLGQYM  373

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TP+ F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++++++E
Sbjct  374  QPTKRHLKVEEYVTPDKFKHWEKVGNELGFHYTASGPLVRSSYKAGEFFLRNLVE  428



>ref|XP_003060743.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55512.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=296

 Score =   195 bits (495),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 126/175 (72%), Gaps = 2/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  R  R+L+          LVPDFRGD + V  +A+SGLDVFAHN+ETVE LQ  VRD 
Sbjct  121  HFARTVRTLKALRPDILCECLVPDFRGDAAAVSHLARSGLDVFAHNVETVERLQKRVRDP  180

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA ++QS++VL  AK   P G  TKTS+MLG GET +++ + M   + AGVD+ T GQY+
Sbjct  181  RAGYEQSLNVLREAKVAKP-GLTTKTSVMLGLGETDEEIERVMRDCKDAGVDIFTLGQYL  239

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQ-MGFRYVASGPMVRSSYKAGEFYIKSMI  256
            RP+++H+PV  Y+TPE FE ++  G + +GFRYVASGP+VRSSYKAGEF+I+SM+
Sbjct  240  RPTEKHLPVKAYVTPEKFETWKKYGEEVVGFRYVASGPLVRSSYKAGEFFIESML  294



>ref|XP_007887310.1| PREDICTED: lipoyl synthase, mitochondrial [Callorhinchus milii]
Length=374

 Score =   197 bits (501),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/160 (57%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEK+A SGLDV+AHN+ETV ELQ  +RD RANF QS+ VL  AK   P
Sbjct  213  CLTPDFRGDLKAVEKIAVSGLDVYAHNVETVRELQRRIRDPRANFDQSLSVLKHAKKVKP  272

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               L+KTSIMLG GET ++V  T++++R AGVD +T GQYM+P+KR++ V EY+TPE F+
Sbjct  273  -NLLSKTSIMLGLGETDEEVHSTLKELREAGVDCLTLGQYMQPTKRNLKVEEYVTPEKFQ  331

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRA  241
             ++ +G ++GF Y ASGP+VRSSYKAGE+++K ++ S +A
Sbjct  332  YWETVGNELGFLYTASGPLVRSSYKAGEYFLKKLLHSRQA  371



>ref|XP_005554757.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Macaca 
fascicularis]
Length=372

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQS VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLHVLKHAKKVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P++RH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  AL  372



>ref|XP_003773359.1| PREDICTED: lipoyl synthase, mitochondrial [Sarcophilus harrisii]
Length=372

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VE VA+SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HFAKTVSHLKERNSNILVECLTPDFRGDLKSVEIVAQSGLDVYAHNVETVPELQRKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS++VL  AK   P   ++KTSIMLG GET +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFNQSLEVLKHAKKVQP-DVISKTSIMLGLGETDEQVYSTMKALREAEVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMI  256
            +P+KRH+ V EY+TPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++
Sbjct  311  QPTKRHLKVEEYVTPEKFKYWEKIGKELGFYYTASGPLVRSSYKAGEFFLKNLV  364



>ref|NP_001103871.1| lipoyl synthase, mitochondrial [Danio rerio]
 gb|AAI54782.1| Zgc:66080 protein [Danio rerio]
Length=397

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +++  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  212  HFAKTVSNIKERNSKILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDP  271

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK    +  LTKTSIMLG GET  Q+  T+ ++R +GVD +T GQYM
Sbjct  272  RANFDQSLSVLRHAKK-VKSSVLTKTSIMLGLGETDAQIQATLTELRDSGVDCLTLGQYM  330

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  331  QPTKRHLKVEEYVTPEKFAFWEKVGQEMGFIYTASGPLVRSSYKAGEFFLKNLLE  385



>ref|XP_006258548.1| PREDICTED: lipoyl synthase, mitochondrial [Alligator mississippiensis]
Length=416

 Score =   198 bits (504),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/163 (58%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD RANF+QS+ VL  AK   P
Sbjct  255  CLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFEQSLCVLKHAKKVQP  314

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GET +Q+  TM+ +R A VD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  315  -DVISKTSIMLGLGETDEQIHSTMKLLREADVDCLTLGQYMQPTKRHLKVEEYVTPEKFK  373

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K++IE  +  ++
Sbjct  374  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLIEKRKTKAI  416



>dbj|GAN00642.1| lipoyl synthase, mitochondrial [Mucor ambiguus]
Length=410

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 122/164 (74%), Gaps = 1/164 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF GD   VE VA SGLDV+AHNIETVE L   VRD RA F+QS+ VL   K   P
Sbjct  231  CLTGDFGGDLKGVETVALSGLDVYAHNIETVEALTPFVRDRRAGFRQSLGVLQHVKKVKP  290

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTSIMLGCGET ++V++T++++R A VD +T GQYMRP+KRHM V EY+TPE F+
Sbjct  291  -DMITKTSIMLGCGETDEEVLETLQELRKADVDCVTLGQYMRPTKRHMKVHEYVTPEKFK  349

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASLA  229
             ++  GM+MGF+YVASGP+VRSSYKAGEF+I ++++  +   L+
Sbjct  350  HWETTGMEMGFKYVASGPLVRSSYKAGEFFIGNILKKRKGLPLS  393



>ref|XP_006680624.1| hypothetical protein BATDEDRAFT_13027 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF78478.1| hypothetical protein BATDEDRAFT_13027 [Batrachochytrium dendrobatidis 
JAM81]
Length=330

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 119/156 (76%), Gaps = 1/156 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DFRG+   VE VA SGLDV+AHNIETVE LQ  VRD RA F+QS+ VL  AK   P
Sbjct  150  CLTGDFRGNLDDVETVALSGLDVYAHNIETVENLQPYVRDRRAGFRQSLSVLEHAKKVRP  209

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TKTS+MLG GET ++V+ T+E++R   VDV+TFGQYMRP+ +HM VSEY+ PE F+
Sbjct  210  -DLITKTSMMLGLGETDEEVIHTLEELRKVDVDVVTFGQYMRPTTKHMKVSEYVHPEKFQ  268

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
             +  +  QMGF+YVASGP+VRSSYKAGEFYIK+M++
Sbjct  269  HWADVAKQMGFKYVASGPLVRSSYKAGEFYIKNMLK  304



>ref|NP_001248031.1| lipoyl synthase, mitochondrial [Macaca mulatta]
 gb|EHH25816.1| Lipoyl synthase, mitochondrial [Macaca mulatta]
Length=372

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQS VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLKHAKKVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P++RH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  AL  372



>sp|Q6PHG4.1|LIAS_DANRE RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Danio rerio]
 gb|AAH56561.1| Zgc:66080 [Danio rerio]
Length=399

 Score =   197 bits (502),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 125/175 (71%), Gaps = 1/175 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +   +++  N       L PDFRGD + VEK+A SGLDV+AHN+ETV ELQ  VRD 
Sbjct  214  HFAKTVSNIKERNSKILVECLTPDFRGDLAAVEKIALSGLDVYAHNVETVRELQRHVRDP  273

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK    +  LTKTSIMLG GET  Q+  T+ ++R +GVD +T GQYM
Sbjct  274  RANFDQSLSVLRHAKK-VKSSVLTKTSIMLGLGETDAQIQATLTELRDSGVDCLTLGQYM  332

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIE  253
            +P+KRH+ V EY+TPE F  ++ +G +MGF Y ASGP+VRSSYKAGEF++K+++E
Sbjct  333  QPTKRHLKVEEYVTPEKFAFWEKVGQEMGFIYTASGPLVRSSYKAGEFFLKNLLE  387



>ref|XP_003985482.1| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, mitochondrial 
[Felis catus]
Length=373

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFNQSLRVLQHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  S
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKKPS  371



>emb|CBQ69085.1| related to LIP5-lipoic acid synthase [Sporisorium reilianum SRZ2]
Length=795

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
            ALVPDF GD +CVE +  SGLDVFAHN+ETVE     VRD RA ++QS+ VL  AK  +P
Sbjct  619  ALVPDFSGDTACVETIVHSGLDVFAHNVETVERTTPSVRDRRAKYRQSLAVLAHAKATSP  678

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
            A  +TKTSIMLGCGE   +V +T+  +RAA VDV+TFGQYMRP+KRHM V +Y++P+ F 
Sbjct  679  A-LITKTSIMLGCGEHDHEVEQTLRDLRAANVDVVTFGQYMRPTKRHMKVEQYVSPDKFG  737

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
             +Q    Q+GF YVASGP+VRSSYKAGEF+I+++++  RAA
Sbjct  738  YWQTRAEQLGFLYVASGPLVRSSYKAGEFFIENVLKQRRAA  778



>ref|XP_010623415.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Fukomys 
damarensis]
Length=371

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 129/182 (71%), Gaps = 2/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVRELQGKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK+  PA  ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSVRVLKHAKEVQPA-VISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++ + R  
Sbjct  311  QPTKRHLKVEEYITPEKFKYWEKVGHELGFCYTASGPLVRSSYKAGEFFLKNLV-AKRKK  369

Query  237  SL  232
            SL
Sbjct  370  SL  371



>gb|KFU95968.1| hypothetical protein M959_04245, partial [Chaetura pelagica]
Length=343

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 128/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  +    L+  N       L PDFRGD   VEKVA SGLDV+AHN+ETV ELQ  VRD 
Sbjct  163  HFAKTVSHLKERNPKILVECLTPDFRGDLKAVEKVALSGLDVYAHNVETVPELQRKVRDP  222

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F+QS+ VL  AK+  P G ++KTS+MLG GET  QV  TM+ +R A VD +T GQYM
Sbjct  223  RASFEQSVRVLKRAKEVRP-GLVSKTSLMLGLGETDAQVYSTMKLLREADVDCLTLGQYM  281

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P+KRH+ V EY+TPE F+ ++ +G  +GF Y ASGP+VRSSYKAGEF++K+++E  +  
Sbjct  282  QPTKRHLKVEEYVTPEKFKHWEKVGNDLGFHYTASGPLVRSSYKAGEFFLKNLVEKRKTK  341

Query  237  SL  232
            ++
Sbjct  342  AI  343



>ref|XP_008699635.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Ursus maritimus]
Length=373

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFNQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAAS  235
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   + +S
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKKSS  371



>ref|XP_002504861.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66119.1| predicted protein [Micromonas sp. RCC299]
Length=323

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 124/179 (69%), Gaps = 1/179 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  R  R+L+          L PDF+GD   V+ +A SGLDVFAHNIETVE LQ  VRD 
Sbjct  138  HFARTVRTLKALKPEILAECLTPDFQGDEGAVKHLANSGLDVFAHNIETVERLQKRVRDP  197

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA + QS+ VL  AK   P G +TKTSIMLG GE+ +++ +TM   + AGVD+ T GQY+
Sbjct  198  RAGYDQSLRVLRHAKATGPTGLVTKTSIMLGLGESDEEIAQTMRDCKDAGVDIFTLGQYL  257

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQ-MGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            RP+  H+ V EY+TPE FE ++  G + +GFRYVASGP+VRSSYKAGEF+I++M+  +R
Sbjct  258  RPTPNHLDVMEYVTPEKFEHWKRYGEEVVGFRYVASGPLVRSSYKAGEFFIETMLRDER  316



>ref|XP_006571537.1| PREDICTED: lipoyl synthase, mitochondrial [Apis mellifera]
Length=365

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 120/159 (75%), Gaps = 1/159 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             LVPDFRGD  C+E +  S LDVFAHNIETVE L   VRD RA ++QS+ VL +AK   P
Sbjct  201  CLVPDFRGDKDCIEIIVNSNLDVFAHNIETVERLTPFVRDRRAEYRQSLKVLKIAKKCNP  260

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               +TK+SIMLG GET +++ +TM+ +R  GVD +T GQYM+P+KRH+ V EY+TPE F+
Sbjct  261  E-LITKSSIMLGLGETDEEIEQTMKNLREIGVDALTLGQYMQPTKRHLKVIEYVTPEKFK  319

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            K++ +G ++GF Y ASGP+VRSSYKAGEF++ ++++  R
Sbjct  320  KWENIGNELGFLYTASGPLVRSSYKAGEFFLTNILKRRR  358



>ref|XP_005897411.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Bos mutus]
 gb|ELR55232.1| Lipoyl synthase, mitochondrial [Bos mutus]
Length=372

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL  372



>dbj|GAM18868.1| hypothetical protein SAMD00019534_020430 [Acytostelium subglobosum 
LB1]
Length=432

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 121/159 (76%), Gaps = 1/159 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L  DF+G+  CVE+VA SGL+V+AHNIETVEEL S VRD RA F+QS+ VL  AK   P
Sbjct  263  CLTGDFQGNLECVERVATSGLEVYAHNIETVEELSSYVRDPRAKFRQSLAVLAHAKKVKP  322

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               LTKTS+MLGCGE  D+V+  M+++R   VD++T GQYMRP+K+HM V EY+ PE F 
Sbjct  323  T-LLTKTSMMLGCGEREDEVIHAMDELRKIDVDILTLGQYMRPTKKHMRVHEYVEPEVFA  381

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDR  244
            K+Q +  + GF+YVASGP+VRSSYKAGEFYI ++++ ++
Sbjct  382  KFQKIAEEKGFKYVASGPLVRSSYKAGEFYISNILKREK  420



>ref|XP_003258640.1| PREDICTED: lipoyl synthase, mitochondrial isoform 1 [Nomascus 
leucogenys]
Length=372

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 127/182 (70%), Gaps = 1/182 (1%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H+ +    L+  N       L PDFRGD   +EKVA SGLDV+AHN+ETV ELQS VRD 
Sbjct  192  HIAKTVSYLKERNPKILVECLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQSKVRDP  251

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RANF QS+ VL  AK   P   ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM
Sbjct  252  RANFDQSLRVLKHAKKVQP-DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYM  310

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAA  238
            +P++RH+ V EYITPE F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  
Sbjct  311  QPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTK  370

Query  237  SL  232
            +L
Sbjct  371  AL  372



>ref|XP_007670123.1| PREDICTED: lipoyl synthase, mitochondrial [Ornithorhynchus anatinus]
Length=391

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 131/190 (69%), Gaps = 8/190 (4%)
 Frame = -3

Query  777  HLQRQYRSLRH*NQICS*XALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDH  598
            H  R    L+  N       L PDFRGD   VEKVA SGLDVFAHN+ETV ELQ  VRD 
Sbjct  203  HFARTVSHLKERNSKILVECLTPDFRGDLRAVEKVALSGLDVFAHNVETVPELQRQVRDP  262

Query  597  RANFKQSMDVLMMAKDYAPAGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYM  418
            RA+F QS+ VL  AK+  P   ++KTS+MLG GET +QV  T++ +R A VD +T GQYM
Sbjct  263  RASFAQSVRVLKHAKNVQPR-LVSKTSLMLGLGETDEQVYSTLKALREADVDCLTLGQYM  321

Query  417  RPSKRHMPVSEYITPEAFEKYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSM-------  259
            +P++RH+ V EYITP  F+ ++ +G ++GF Y ASGP+VRSSYKAGEF++K++       
Sbjct  322  QPTRRHLKVEEYITPAKFKHWEKVGEELGFHYTASGPLVRSSYKAGEFFLKNLVTKRKTT  381

Query  258  IESDRAASLA  229
            +ESD++ SLA
Sbjct  382  VESDKSTSLA  391



>ref|NP_001017944.1| lipoyl synthase, mitochondrial precursor [Bos taurus]
 ref|XP_010831871.1| PREDICTED: lipoyl synthase, mitochondrial isoform X1 [Bison bison 
bison]
 sp|Q5BIP7.1|LIAS_BOVIN RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate 
synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic 
acid synthase; Flags: Precursor [Bos taurus]
 gb|AAX31359.1| lipoic acid synthetase isoform 1 precursor [Bos taurus]
 tpg|DAA28724.1| TPA: lipoyl synthase, mitochondrial precursor [Bos taurus]
Length=372

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = -3

Query  720  ALVPDFRGDPSCVEKVAKSGLDVFAHNIETVEELQSVVRDHRANFKQSMDVLMMAKDYAP  541
             L PDFRGD   +EKVA SGLDV+AHN+ETV ELQ  VRD RANF QS+ VL  AK+  P
Sbjct  211  CLTPDFRGDLKAIEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLKHAKEVRP  270

Query  540  AGTLTKTSIMLGCGETPDQVVKTMEKVRAAGVDVMTFGQYMRPSKRHMPVSEYITPEAFE  361
               ++KTSIMLG GE  +QV  TM+ +R A VD +T GQYM+P+KRH+ V EYITPE F+
Sbjct  271  -DVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTKRHLKVEEYITPEKFK  329

Query  360  KYQVLGMQMGFRYVASGPMVRSSYKAGEFYIKSMIESDRAASL  232
             ++ +G ++GF Y ASGP+VRSSYKAGEF++K+++   +  +L
Sbjct  330  YWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKAL  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1507754616730