BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031L12

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011097258.1|  PREDICTED: aspartokinase 2, chloroplastic is...    407   3e-136   Sesamum indicum [beniseed]
gb|KJB11754.1|  hypothetical protein B456_001G275700                    394   9e-134   Gossypium raimondii
ref|XP_010250546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    400   2e-133   Nelumbo nucifera [Indian lotus]
gb|EYU34829.1|  hypothetical protein MIMGU_mgv1a003795mg                400   2e-133   Erythranthe guttata [common monkey flower]
ref|XP_004143759.1|  PREDICTED: aspartokinase 2, chloroplastic-like     397   3e-133   
ref|XP_011097259.1|  PREDICTED: aspartokinase 2, chloroplastic is...    399   4e-133   Sesamum indicum [beniseed]
ref|XP_009607339.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    399   4e-133   Nicotiana tomentosiformis
ref|XP_010096037.1|  Aspartokinase 3                                    397   1e-132   
ref|XP_009781447.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    397   2e-132   Nicotiana sylvestris
gb|KGN51126.1|  hypothetical protein Csa_5G457770                       397   3e-132   Cucumis sativus [cucumbers]
ref|XP_008465546.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    397   3e-132   Cucumis melo [Oriental melon]
gb|KHN00623.1|  Aspartokinase 1, chloroplastic                          391   5e-132   Glycine soja [wild soybean]
gb|KJB11756.1|  hypothetical protein B456_001G275700                    394   2e-131   Gossypium raimondii
ref|XP_004164561.1|  PREDICTED: aspartokinase 3, chloroplastic-like     386   3e-131   
gb|KJB11753.1|  hypothetical protein B456_001G275700                    394   3e-131   Gossypium raimondii
ref|XP_010316459.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    394   5e-131   Solanum lycopersicum
ref|XP_009607337.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    393   6e-131   Nicotiana tomentosiformis
emb|CBI21283.3|  unnamed protein product                                390   7e-131   Vitis vinifera
ref|XP_006364050.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    393   1e-130   Solanum tuberosum [potatoes]
ref|XP_011006143.1|  PREDICTED: aspartokinase 2, chloroplastic-like     384   1e-130   Populus euphratica
ref|XP_004304561.1|  PREDICTED: aspartokinase 2, chloroplastic is...    393   1e-130   Fragaria vesca subsp. vesca
ref|XP_007032011.1|  Aspartate kinase 3 isoform 1                       393   1e-130   
ref|XP_009781445.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    392   2e-130   Nicotiana sylvestris
ref|XP_011024774.1|  PREDICTED: aspartokinase 2, chloroplastic is...    392   2e-130   Populus euphratica
ref|XP_006574470.1|  PREDICTED: precursor monofunctional aspartok...    392   3e-130   Glycine max [soybeans]
ref|XP_010250548.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    392   3e-130   Nelumbo nucifera [Indian lotus]
ref|XP_008231031.1|  PREDICTED: aspartokinase 2, chloroplastic is...    392   4e-130   Prunus mume [ume]
ref|XP_007215316.1|  hypothetical protein PRUPE_ppa003561mg             392   4e-130   Prunus persica
ref|XP_002301756.2|  hypothetical protein POPTR_0002s23800g             391   4e-130   
ref|XP_010660689.1|  PREDICTED: aspartokinase 2, chloroplastic is...    391   7e-130   Vitis vinifera
ref|XP_009607340.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    390   9e-130   Nicotiana tomentosiformis
gb|KJB33204.1|  hypothetical protein B456_006G000400                    384   9e-130   Gossypium raimondii
gb|KDP41849.1|  hypothetical protein JCGZ_26867                         387   1e-129   Jatropha curcas
ref|XP_009781448.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    389   2e-129   Nicotiana sylvestris
emb|CDP16734.1|  unnamed protein product                                389   4e-129   Coffea canephora [robusta coffee]
ref|XP_008465552.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    389   4e-129   Cucumis melo [Oriental melon]
ref|XP_007151723.1|  hypothetical protein PHAVU_004G070100g             386   2e-128   Phaseolus vulgaris [French bean]
ref|XP_002321084.2|  hypothetical protein POPTR_0014s14270g             387   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_008465539.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    387   4e-128   Cucumis melo [Oriental melon]
gb|KDO43558.1|  hypothetical protein CISIN_1g008621mg                   386   4e-128   Citrus sinensis [apfelsine]
ref|XP_006468884.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    386   4e-128   Citrus sinensis [apfelsine]
gb|KHN13387.1|  Aspartokinase 1, chloroplastic                          386   5e-128   Glycine soja [wild soybean]
ref|XP_003548032.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    386   5e-128   
gb|KJB11752.1|  hypothetical protein B456_001G275700                    385   6e-128   Gossypium raimondii
ref|XP_004228743.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    386   7e-128   Solanum lycopersicum
ref|XP_009607338.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    385   9e-128   Nicotiana tomentosiformis
ref|XP_010028950.1|  PREDICTED: aspartokinase 2, chloroplastic-like     385   1e-127   Eucalyptus grandis [rose gum]
ref|XP_006364051.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    385   1e-127   Solanum tuberosum [potatoes]
gb|KEH25641.1|  monofunctional aspartokinase                            385   1e-127   Medicago truncatula
ref|XP_011468211.1|  PREDICTED: aspartokinase 2, chloroplastic is...    385   1e-127   Fragaria vesca subsp. vesca
ref|NP_001238151.1|  precursor monofunctional aspartokinase             385   2e-127   
ref|XP_007032013.1|  Aspartate kinase 3 isoform 3                       385   2e-127   
ref|XP_011006114.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    384   2e-127   Populus euphratica
ref|XP_009781446.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    384   2e-127   Nicotiana sylvestris
ref|XP_006657643.1|  PREDICTED: aspartokinase 1, chloroplastic-like     384   3e-127   Oryza brachyantha
ref|XP_011024777.1|  PREDICTED: aspartokinase 3, chloroplastic is...    384   3e-127   Populus euphratica
emb|CBI35668.3|  unnamed protein product                                381   3e-127   Vitis vinifera
ref|XP_006574471.1|  PREDICTED: precursor monofunctional aspartok...    384   4e-127   
gb|KJB33201.1|  hypothetical protein B456_006G000400                    384   4e-127   Gossypium raimondii
ref|XP_008231032.1|  PREDICTED: aspartokinase 2, chloroplastic is...    384   4e-127   Prunus mume [ume]
ref|XP_004515404.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    383   6e-127   Cicer arietinum [garbanzo]
ref|XP_009378035.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    383   7e-127   Pyrus x bretschneideri [bai li]
ref|XP_011006109.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    384   8e-127   Populus euphratica
ref|XP_002275779.1|  PREDICTED: aspartokinase 2, chloroplastic is...    383   9e-127   Vitis vinifera
ref|XP_007043813.1|  Aspartate kinase 1                                 383   1e-126   
ref|XP_008362086.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    382   2e-126   Malus domestica [apple tree]
gb|EPS64336.1|  hypothetical protein M569_10444                         379   2e-126   Genlisea aurea
ref|NP_001059423.1|  Os07g0300900                                       382   3e-126   
ref|XP_010656841.1|  PREDICTED: aspartokinase 1, chloroplastic is...    381   5e-126   Vitis vinifera
ref|XP_010927771.1|  PREDICTED: aspartokinase 2, chloroplastic-like     374   1e-125   
ref|XP_008379051.1|  PREDICTED: aspartokinase 2, chloroplastic is...    380   2e-125   
ref|XP_007151724.1|  hypothetical protein PHAVU_004G070100g             378   3e-125   Phaseolus vulgaris [French bean]
ref|XP_008379050.1|  PREDICTED: aspartokinase 2, chloroplastic is...    379   5e-125   
ref|XP_006468885.1|  PREDICTED: aspartokinase 3, chloroplastic-li...    378   5e-125   Citrus sinensis [apfelsine]
gb|KDO43559.1|  hypothetical protein CISIN_1g008621mg                   378   6e-125   Citrus sinensis [apfelsine]
ref|XP_006446944.1|  hypothetical protein CICLE_v10014778mg             378   7e-125   Citrus clementina [clementine]
ref|XP_006599412.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    378   8e-125   Glycine max [soybeans]
ref|XP_009131382.1|  PREDICTED: aspartokinase 2, chloroplastic          377   9e-125   Brassica rapa
emb|CDX78557.1|  BnaA03g04690D                                          377   1e-124   
ref|XP_002512848.1|  aspartate kinase, putative                         377   2e-124   
gb|KEH25640.1|  monofunctional aspartokinase                            377   2e-124   Medicago truncatula
emb|CDX70538.1|  BnaC03g06220D                                          376   2e-124   
ref|XP_006399912.1|  hypothetical protein EUTSA_v10013157mg             376   3e-124   Eutrema salsugineum [saltwater cress]
ref|XP_011006115.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    376   3e-124   Populus euphratica
gb|KHM99220.1|  Aspartokinase 1, chloroplastic                          375   5e-124   Glycine soja [wild soybean]
ref|XP_009378037.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    375   8e-124   Pyrus x bretschneideri [bai li]
ref|XP_010100040.1|  Aspartokinase 1                                    376   8e-124   
ref|XP_004515405.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    375   1e-123   Cicer arietinum [garbanzo]
ref|XP_011006113.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    376   1e-123   Populus euphratica
ref|XP_010682652.1|  PREDICTED: aspartokinase 1, chloroplastic is...    375   1e-123   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAC84902.1|  putative precursor monofunctional aspartokinase        375   1e-123   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009125901.1|  PREDICTED: aspartokinase 1, chloroplastic-like     375   1e-123   Brassica rapa
ref|XP_008362087.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    374   2e-123   Malus domestica [apple tree]
gb|EEC76545.1|  hypothetical protein OsI_14341                          374   3e-123   Oryza sativa Indica Group [Indian rice]
ref|XP_010453390.1|  PREDICTED: aspartokinase 1, chloroplastic          374   3e-123   Camelina sativa [gold-of-pleasure]
ref|XP_008790700.1|  PREDICTED: aspartokinase 2, chloroplastic-like     374   3e-123   Phoenix dactylifera
ref|XP_010556239.1|  PREDICTED: aspartokinase 1, chloroplastic          370   5e-123   
pdb|2CDQ|A  Chain A, Crystal Structure Of Arabidopsis Thaliana As...    372   5e-123   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25564.1|  hypothetical protein AALP_AA8G131200                    373   7e-123   Arabis alpina [alpine rockcress]
ref|XP_010492197.1|  PREDICTED: aspartokinase 2, chloroplastic-like     372   1e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010419903.1|  PREDICTED: aspartokinase 1, chloroplastic-like     373   1e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010492075.1|  PREDICTED: aspartokinase 1, chloroplastic-like     372   1e-122   Camelina sativa [gold-of-pleasure]
ref|XP_008369639.1|  PREDICTED: aspartokinase 1, chloroplastic          372   2e-122   
ref|XP_008776937.1|  PREDICTED: aspartokinase 2, chloroplastic-li...    372   2e-122   Phoenix dactylifera
gb|EEE58127.1|  hypothetical protein OsJ_09026                          375   2e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002871599.1|  lysine-sensitive aspartate kinase                  371   3e-122   
gb|EEC74320.1|  hypothetical protein OsI_09598                          374   3e-122   Oryza sativa Indica Group [Indian rice]
ref|XP_010926856.1|  PREDICTED: aspartokinase 2, chloroplastic is...    372   3e-122   Elaeis guineensis
ref|XP_010435684.1|  PREDICTED: aspartokinase 3, chloroplastic-like     371   3e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010530884.1|  PREDICTED: aspartokinase 1, chloroplastic-like     371   4e-122   Tarenaya hassleriana [spider flower]
ref|XP_003553303.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    371   4e-122   Glycine max [soybeans]
ref|XP_003562409.1|  PREDICTED: aspartokinase 1, chloroplastic is...    371   4e-122   Brachypodium distachyon [annual false brome]
ref|XP_006604189.1|  PREDICTED: aspartokinase 1, chloroplastic-li...    371   4e-122   
gb|AAO20063.1|  putative aspartate kinase                               371   5e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010496416.1|  PREDICTED: aspartokinase 3, chloroplastic          371   5e-122   Camelina sativa [gold-of-pleasure]
ref|XP_010453516.1|  PREDICTED: aspartokinase 2, chloroplastic          370   5e-122   Camelina sativa [gold-of-pleasure]
ref|XP_009413004.1|  PREDICTED: aspartokinase 1, chloroplastic-like     364   5e-122   
ref|NP_196832.1|  aspartokinase 1                                       371   5e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002871558.1|  AK-LYS1                                            371   6e-122   Arabidopsis lyrata subsp. lyrata
ref|NP_001051906.1|  Os03g0850400                                       369   7e-122   
ref|XP_008357847.1|  PREDICTED: aspartokinase 2, chloroplastic-like     370   8e-122   
ref|XP_010420027.1|  PREDICTED: aspartokinase 2, chloroplastic-like     369   1e-121   Camelina sativa [gold-of-pleasure]
ref|XP_008379052.1|  PREDICTED: aspartokinase 2, chloroplastic is...    370   1e-121   
ref|XP_006399820.1|  hypothetical protein EUTSA_v10013112mg             370   1e-121   Eutrema salsugineum [saltwater cress]
ref|XP_006652023.1|  PREDICTED: aspartokinase 1, chloroplastic-like     369   2e-121   Oryza brachyantha
ref|NP_196910.1|  aspartokinase 2                                       369   2e-121   Arabidopsis thaliana [mouse-ear cress]
emb|CAC06395.1|  aspartate kinase                                       369   2e-121   Arabidopsis thaliana [mouse-ear cress]
gb|AAB63104.1|  lysine-sensitive aspartate kinase                       369   2e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121776.1|  PREDICTED: aspartokinase 1, chloroplastic          369   2e-121   Brassica rapa
ref|XP_002466095.1|  hypothetical protein SORBIDRAFT_01g001140          369   3e-121   Sorghum bicolor [broomcorn]
emb|CAA67376.1|  aspartate kinase                                       369   4e-121   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010682653.1|  PREDICTED: aspartokinase 1, chloroplastic is...    369   4e-121   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006408563.1|  hypothetical protein EUTSA_v10020441mg             367   1e-120   
gb|ABO09875.1|  monofunctional aspartate kinase 1                       368   1e-120   Zea mays [maize]
ref|NP_001288496.1|  uncharacterized protein LOC103644325               367   1e-120   Zea mays [maize]
ref|XP_006408564.1|  hypothetical protein EUTSA_v10020441mg             367   1e-120   Eutrema salsugineum [saltwater cress]
ref|XP_010234251.1|  PREDICTED: aspartokinase 1, chloroplastic is...    366   3e-120   
ref|XP_004956005.1|  PREDICTED: aspartokinase 2, chloroplastic-like     366   3e-120   Setaria italica
ref|XP_009411806.1|  PREDICTED: aspartokinase 2, chloroplastic-like     367   3e-120   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009359889.1|  PREDICTED: aspartokinase 1, chloroplastic-like     366   4e-120   Pyrus x bretschneideri [bai li]
ref|XP_008669985.1|  PREDICTED: aspartokinase 2, chloroplastic          366   5e-120   
ref|NP_186851.1|  aspartokinase 3                                       365   5e-120   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ28733.1|  monofunctional aspartate kinase 2                       364   9e-120   Zea mays [maize]
ref|XP_008222377.1|  PREDICTED: aspartokinase 1, chloroplastic          365   1e-119   Prunus mume [ume]
ref|XP_004981039.1|  PREDICTED: aspartokinase 1, chloroplastic-like     364   3e-119   Setaria italica
dbj|BAA95630.1|  aspartate kinase                                       356   5e-119   Oryza sativa [red rice]
gb|EMT10312.1|  Aspartokinase 1, chloroplastic                          367   2e-118   
gb|EMS63387.1|  Aspartokinase 1, chloroplastic                          369   2e-118   Triticum urartu
gb|EEE55936.1|  hypothetical protein OsJ_04629                          360   3e-118   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045271.1|  Os01g0927900                                       360   1e-117   
gb|EEC72085.1|  hypothetical protein OsI_05030                          360   1e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_003564987.1|  PREDICTED: aspartokinase 2, chloroplastic-like     359   2e-117   Brachypodium distachyon [annual false brome]
ref|XP_002882151.1|  hypothetical protein ARALYDRAFT_896038             359   2e-117   Arabidopsis lyrata subsp. lyrata
emb|CDM85877.1|  unnamed protein product                                358   3e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006646639.1|  PREDICTED: aspartokinase 1, chloroplastic-like     358   4e-117   Oryza brachyantha
gb|ABK24292.1|  unknown                                                 358   5e-117   Picea sitchensis
ref|XP_004310242.1|  PREDICTED: aspartokinase 1, chloroplastic          357   7e-117   Fragaria vesca subsp. vesca
dbj|BAJ99203.1|  predicted protein                                      355   4e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH23492.1|  monofunctional aspartokinase                            348   1e-114   Medicago truncatula
emb|CDY06621.1|  BnaC02g13450D                                          350   5e-114   
emb|CDY20797.1|  BnaA02g09370D                                          350   6e-114   Brassica napus [oilseed rape]
gb|AES80708.2|  monofunctional aspartokinase                            348   2e-113   Medicago truncatula
ref|XP_006286781.1|  hypothetical protein CARUB_v10003334mg             347   4e-113   Capsella rubella
ref|XP_004971149.1|  PREDICTED: aspartokinase 1, chloroplastic-like     347   5e-113   Setaria italica
ref|XP_011086875.1|  PREDICTED: aspartokinase 2, chloroplastic          347   1e-112   Sesamum indicum [beniseed]
ref|XP_009127042.1|  PREDICTED: aspartokinase 3, chloroplastic-like     347   1e-112   Brassica rapa
gb|ACR35433.1|  unknown                                                 339   5e-112   Zea mays [maize]
ref|XP_002459021.1|  hypothetical protein SORBIDRAFT_03g044650          342   5e-111   Sorghum bicolor [broomcorn]
gb|KHG14818.1|  Aspartokinase 3, chloroplastic -like protein            341   9e-111   Gossypium arboreum [tree cotton]
gb|KJB33203.1|  hypothetical protein B456_006G000400                    341   1e-110   Gossypium raimondii
gb|EYU28463.1|  hypothetical protein MIMGU_mgv1a005583mg                337   4e-110   Erythranthe guttata [common monkey flower]
gb|KCW55774.1|  hypothetical protein EUGRSUZ_I01605                     339   6e-110   Eucalyptus grandis [rose gum]
gb|KHG00746.1|  Aspartokinase 3, chloroplastic -like protein            338   8e-110   Gossypium arboreum [tree cotton]
ref|XP_002992028.1|  hypothetical protein SELMODRAFT_162121             335   2e-109   
ref|XP_002964498.1|  hypothetical protein SELMODRAFT_142417             335   3e-109   
ref|XP_010656844.1|  PREDICTED: aspartokinase 1, chloroplastic is...    336   9e-109   Vitis vinifera
ref|XP_003624490.1|  Aspartokinase                                      337   2e-108   
ref|XP_006287431.1|  hypothetical protein CARUB_v10000635mg             335   3e-108   
gb|KEH25642.1|  monofunctional aspartokinase                            333   5e-108   Medicago truncatula
ref|XP_006300265.1|  hypothetical protein CARUB_v100158420mg            322   6e-108   
ref|XP_006399914.1|  hypothetical protein EUTSA_v10013157mg             332   5e-107   
emb|CDX85659.1|  BnaA02g01540D                                          328   1e-105   
emb|CDX91135.1|  BnaC02g04620D                                          326   8e-105   
emb|CDY09781.1|  BnaC09g43800D                                          324   5e-104   Brassica napus [oilseed rape]
emb|CDX69652.1|  BnaA10g20010D                                          324   6e-104   
ref|XP_007223118.1|  hypothetical protein PRUPE_ppa003770mg             320   1e-102   
ref|NP_001146022.1|  uncharacterized protein LOC100279553               307   5e-102   
gb|EMT09778.1|  Aspartokinase 1, chloroplastic                          312   7e-101   
gb|AFW74642.1|  hypothetical protein ZEAMMB73_320357                    310   3e-99    
ref|XP_006844541.1|  hypothetical protein AMTR_s00016p00169310          309   4e-99    
ref|XP_001773420.1|  predicted protein                                  309   5e-98    
gb|KJB33202.1|  hypothetical protein B456_006G000400                    307   7e-98    Gossypium raimondii
ref|XP_001780779.1|  predicted protein                                  302   1e-95    
gb|KCW55775.1|  hypothetical protein EUGRSUZ_I01605                     301   1e-95    Eucalyptus grandis [rose gum]
gb|ABF99918.1|  aspartate kinase family protein, expressed              292   2e-92    Oryza sativa Japonica Group [Japonica rice]
gb|ACN41167.1|  unknown                                                 259   1e-83    Picea sitchensis
ref|XP_008647236.1|  PREDICTED: aspartokinase 1, chloroplastic-like     258   5e-82    
gb|EMS47783.1|  Aspartokinase 1, chloroplastic                          261   5e-80    Triticum urartu
ref|XP_011399436.1|  Aspartokinase 1, chloroplastic                     255   8e-78    Auxenochlorella protothecoides
ref|XP_005846857.1|  hypothetical protein CHLNCDRAFT_134660             254   9e-78    Chlorella variabilis
ref|XP_003074218.1|  putative precursor monofunctional aspartokin...    246   3e-75    
gb|KJB11755.1|  hypothetical protein B456_001G275700                    245   5e-75    Gossypium raimondii
ref|XP_001415789.1|  predicted protein                                  246   5e-75    Ostreococcus lucimarinus CCE9901
emb|CEF96568.1|  Aspartate kinase, conserved site                       246   3e-74    Ostreococcus tauri
gb|KDD72939.1|  amino acid kinase                                       245   4e-74    Helicosporidium sp. ATCC 50920
ref|XP_002507216.1|  predicted protein                                  244   7e-74    Micromonas commoda
ref|XP_007515683.1|  aspartate kinase                                   242   3e-72    Bathycoccus prasinos
gb|KJB11757.1|  hypothetical protein B456_001G275700                    237   3e-71    Gossypium raimondii
gb|KDO43561.1|  hypothetical protein CISIN_1g008621mg                   236   5e-71    Citrus sinensis [apfelsine]
ref|XP_005650639.1|  aspartate kinase                                   235   1e-70    Coccomyxa subellipsoidea C-169
gb|EKD81471.1|  hypothetical protein ACD_39C01793G0002                  233   3e-70    uncultured bacterium
gb|AFW74641.1|  hypothetical protein ZEAMMB73_320357                    233   7e-70    
ref|XP_009388316.1|  PREDICTED: aspartokinase 2, chloroplastic-like     227   1e-67    
ref|WP_013968408.1|  aspartate kinase                                   226   3e-67    Treponema caldarium
ref|XP_001698576.1|  aspartate kinase                                   228   5e-67    Chlamydomonas reinhardtii
gb|ABC46704.1|  aspartokinase                                           215   6e-67    Arachis hypogaea [goober]
ref|XP_002947347.1|  hypothetical protein VOLCADRAFT_87637              226   3e-66    Volvox carteri f. nagariensis
ref|WP_010253784.1|  aspartate kinase                                   223   4e-66    Treponema primitia
ref|XP_003059042.1|  predicted protein                                  224   1e-65    Micromonas pusilla CCMP1545
tpg|DAA39409.1|  TPA: hypothetical protein ZEAMMB73_358951              212   4e-65    
ref|XP_002459732.1|  hypothetical protein SORBIDRAFT_02g009570          219   2e-64    
ref|WP_015707281.1|  aspartate kinase                                   218   3e-64    Treponema primitia
gb|EWM28259.1|  aspartate kinase                                        221   3e-64    Nannochloropsis gaditana
ref|WP_015710697.1|  aspartate kinase                                   216   1e-63    Treponema azotonutricium
ref|XP_005707902.1|  aspartate kinase                                   209   4e-60    Galdieria sulphuraria
ref|XP_009388108.1|  PREDICTED: aspartokinase 3, chloroplastic-like     196   2e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002182416.1|  predicted protein                                  207   2e-59    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005534774.1|  aspartate kinase                                   208   3e-59    Cyanidioschyzon merolae strain 10D
ref|XP_009035261.1|  hypothetical protein AURANDRAFT_52842              205   1e-58    Aureococcus anophagefferens
ref|WP_013702193.1|  aspartate kinase                                   197   2e-56    Treponema succinifaciens
ref|WP_016525852.1|  aspartate kinase                                   197   4e-56    Treponema maltophilum
ref|XP_002292078.1|  predicted protein                                  200   6e-56    Thalassiosira pseudonana CCMP1335
ref|WP_027728545.1|  aspartate kinase                                   193   9e-55    Treponema sp. C6A8
ref|WP_013758817.1|  aspartate kinase                                   192   3e-54    Treponema brennaborense
ref|WP_038080481.1|  aspartate kinase                                   191   9e-54    Treponema socranskii
ref|WP_016521831.1|  aspartate kinase                                   190   1e-53    
gb|ERF61453.1|  amino acid kinase family protein                        191   1e-53    Treponema socranskii subsp. socranskii VPI DR56BR1116 = ATCC 35536
ref|WP_009104632.1|  aspartate kinase                                   190   1e-53    Treponema sp. JC4
ref|WP_022933427.1|  aspartate kinase                                   189   3e-53    Treponema bryantii
gb|EMS60633.1|  hypothetical protein TRIUR3_25086                       184   6e-53    Triticum urartu
ref|WP_004266577.1|  aspartate kinase                                   186   3e-52    Treponema saccharophilum
ref|XP_005713499.1|  unnamed protein product                            180   7e-49    Chondrus crispus [carageen]
ref|XP_003884193.1|  Aspartokinase/homoserine dehydrogenase, related    175   8e-48    Neospora caninum Liverpool
gb|KFH09919.1|  aspartokinase                                           168   3e-46    Toxoplasma gondii MAS
gb|KFG51953.1|  aspartokinase                                           168   4e-46    Toxoplasma gondii FOU
ref|XP_008882085.1|  aspartokinase                                      169   1e-45    
ref|WP_031497328.1|  aspartate kinase                                   168   3e-45    Bryobacter aggregatus
ref|XP_002366362.1|  aspartate kinase, putative                         167   6e-45    
gb|EPT27208.1|  aspartokinase                                           167   6e-45    Toxoplasma gondii ME49
gb|EPR62313.1|  aspartokinase                                           167   7e-45    Toxoplasma gondii GT1
ref|WP_028992829.1|  MULTISPECIES: hypothetical protein                 166   1e-44    
ref|WP_013313356.1|  aspartate kinase                                   166   2e-44    Spirochaeta thermophila
ref|WP_041908852.1|  hypothetical protein                               165   3e-44    
ref|XP_005773177.1|  hypothetical protein EMIHUDRAFT_75153              166   3e-44    Emiliania huxleyi CCMP1516
ref|XP_005786070.1|  hypothetical protein EMIHUDRAFT_71644              166   3e-44    Emiliania huxleyi CCMP1516
ref|WP_014624232.1|  aspartate kinase                                   163   2e-43    Spirochaeta thermophila
ref|WP_035399852.1|  aspartate kinase                                   162   6e-43    
ref|WP_012499894.1|  aspartate kinase                                   162   7e-43    Chloroherpeton thalassium
ref|WP_042504650.1|  aspartate kinase                                   159   7e-42    Algibacter lectus
ref|WP_042497724.1|  aspartate kinase                                   159   8e-42    Algibacter lectus
ref|WP_034045835.1|  aspartate kinase                                   158   1e-41    Flaviramulus ichthyoenteri
ref|WP_027138278.1|  aspartate kinase                                   157   2e-41    Gaetbulibacter saemankumensis
gb|EEC76544.1|  hypothetical protein OsI_14340                          155   2e-41    Oryza sativa Indica Group [Indian rice]
ref|WP_041856414.1|  aspartate kinase                                   157   3e-41    
ref|WP_033369986.1|  aspartate kinase                                   157   4e-41    
gb|ABF40484.1|  aspartate kinase                                        157   5e-41    Candidatus Koribacter versatilis Ellin345
dbj|GAL87912.1|  aspartokinase                                          155   2e-40    Jejuia pallidilutea
ref|WP_041975355.1|  hypothetical protein                               155   2e-40    Pyrinomonas methylaliphatogenes
ref|WP_020715172.1|  aspartate kinase                                   155   3e-40    Acidobacteriaceae bacterium KBS 89
ref|WP_039745565.1|  aspartate kinase                                   154   5e-40    
ref|WP_019385985.1|  hypothetical protein                               154   6e-40    Arenitalea lutea
ref|WP_011688615.1|  aspartate kinase                                   154   7e-40    Candidatus Solibacter usitatus
ref|WP_036120732.1|  aspartate kinase                                   153   1e-39    Mangrovimonas yunxiaonensis
tpg|DAA39410.1|  TPA: hypothetical protein ZEAMMB73_358951              145   1e-39    
ref|WP_008823040.1|  aspartate kinase                                   152   2e-39    Prevotella histicola
ref|WP_014266852.1|  aspartate kinase                                   152   3e-39    Granulicella mallensis
tpg|DAA56007.1|  TPA: hypothetical protein ZEAMMB73_791722              151   4e-39    
ref|XP_002459733.1|  hypothetical protein SORBIDRAFT_02g009575          143   4e-39    
ref|WP_016193944.1|  Aspartokinase                                      151   4e-39    Arcticibacter svalbardensis
ref|XP_010926857.1|  PREDICTED: aspartokinase 2, chloroplastic is...    152   5e-39    
ref|WP_044637374.1|  aspartate kinase                                   151   5e-39    
ref|WP_028896097.1|  aspartate kinase                                   150   7e-39    
tpg|DAA56008.1|  TPA: hypothetical protein ZEAMMB73_791722              151   7e-39    
ref|WP_044401737.1|  aspartate kinase                                   150   1e-38    
ref|WP_027127596.1|  aspartate kinase                                   150   1e-38    
ref|WP_009346419.1|  aspartate kinase                                   149   2e-38    
ref|WP_041597832.1|  aspartate kinase                                   150   2e-38    
ref|WP_015896597.1|  aspartate kinase                                   150   2e-38    
ref|WP_021847564.1|  aspartokinase                                      146   3e-38    
ref|WP_044194538.1|  hypothetical protein                               149   3e-38    
ref|WP_038532401.1|  aspartate kinase                                   149   3e-38    
ref|WP_020719229.1|  hypothetical protein                               149   3e-38    
ref|WP_022218432.1|  aspartokinase                                      146   3e-38    
ref|WP_008627444.1|  aspartate kinase                                   149   3e-38    
gb|ADW70011.1|  aspartate kinase                                        149   3e-38    
ref|WP_044633084.1|  aspartate kinase                                   149   4e-38    
ref|XP_004348870.2|  aspartokinase                                      150   4e-38    
ref|WP_021909792.1|  lysine-sensitive aspartokinase III                 149   4e-38    
ref|WP_008622278.1|  aspartate kinase                                   148   5e-38    
ref|WP_021980605.1|  aspartokinase                                      148   6e-38    
ref|WP_044626989.1|  aspartate kinase                                   148   7e-38    
ref|WP_028290241.1|  aspartate kinase                                   148   7e-38    
ref|WP_028608180.1|  aspartate kinase                                   148   8e-38    
ref|WP_035177991.1|  aspartate kinase                                   148   8e-38    
ref|WP_010136666.1|  aspartate kinase                                   147   9e-38    
ref|WP_007368775.1|  aspartate kinase                                   147   1e-37    
ref|WP_004352395.1|  aspartate kinase                                   147   1e-37    
ref|WP_028908783.1|  aspartate kinase                                   147   1e-37    
ref|WP_009010472.1|  aspartate kinase                                   147   1e-37    
gb|KGF39695.1|  aspartate kinase                                        147   1e-37    
ref|WP_036894112.1|  aspartate kinase                                   147   1e-37    
gb|EKD92513.1|  hypothetical protein ACD_28C00411G0003                  147   1e-37    
ref|WP_041586414.1|  aspartate kinase                                   147   1e-37    
ref|XP_006392260.1|  hypothetical protein EUTSA_v10024044mg             142   2e-37    
ref|WP_009435032.1|  aspartate kinase                                   147   2e-37    
ref|WP_028282328.1|  aspartate kinase                                   147   2e-37    
ref|WP_022481006.1|  lysine-sensitive aspartokinase III                 147   2e-37    
gb|ADV81692.1|  aspartate kinase                                        147   2e-37    
ref|WP_004381879.1|  aspartate kinase                                   147   2e-37    
ref|WP_018911508.1|  aspartate kinase                                   147   2e-37    
ref|WP_022163052.1|  aspartokinase                                      147   2e-37    
ref|WP_004289964.1|  MULTISPECIES: aspartate kinase                     146   2e-37    
ref|WP_036860440.1|  aspartate kinase                                   146   3e-37    
ref|WP_035348744.1|  aspartate kinase                                   147   3e-37    
ref|WP_022104540.1|  aspartokinase                                      146   3e-37    
ref|WP_022019939.1|  aspartokinase                                      146   3e-37    
ref|WP_022276624.1|  aspartokinase                                      143   3e-37    
ref|WP_021990671.1|  aspartokinase                                      146   3e-37    
ref|WP_018341575.1|  aspartate kinase                                   146   4e-37    
ref|WP_005652628.1|  aspartate kinase                                   146   4e-37    
ref|WP_009121600.1|  aspartate kinase                                   146   4e-37    
ref|WP_026314890.1|  aspartate kinase                                   146   4e-37    
ref|WP_043520109.1|  aspartate kinase                                   146   4e-37    
gb|KJF41876.1|  aspartate kinase                                        146   4e-37    
ref|WP_028974007.1|  hypothetical protein                               146   5e-37    
ref|WP_008762401.1|  aspartate kinase                                   145   5e-37    
ref|WP_013751000.1|  aspartate kinase                                   145   5e-37    
ref|WP_008764912.1|  MULTISPECIES: aspartate kinase                     145   5e-37    
ref|WP_004360361.1|  aspartate kinase                                   145   6e-37    
ref|WP_044046166.1|  aspartate kinase                                   145   6e-37    
gb|ADK97310.1|  amino acid kinase family                                145   6e-37    
gb|ETS98179.1|  amino acid kinase family protein                        145   6e-37    
ref|WP_036923898.1|  aspartate kinase                                   145   6e-37    
ref|WP_024989324.1|  aspartate kinase                                   145   8e-37    
ref|WP_019989196.1|  aspartate kinase                                   145   8e-37    
ref|WP_022121798.1|  aspartokinase                                      145   9e-37    
ref|WP_014454692.1|  aspartate kinase                                   145   9e-37    
ref|WP_009580619.1|  Aspartokinase                                      145   9e-37    
ref|WP_025277479.1|  aspartate kinase                                   145   1e-36    
ref|WP_006846458.1|  aspartate kinase                                   145   1e-36    
ref|WP_019208829.1|  aspartate kinase                                   145   1e-36    
ref|WP_013454628.1|  aspartate kinase                                   145   1e-36    
ref|WP_026445100.1|  aspartate kinase                                   145   1e-36    
ref|WP_044653154.1|  aspartate kinase                                   144   1e-36    
ref|WP_035335568.1|  aspartate kinase                                   144   1e-36    
ref|WP_022402029.1|  aspartokinase                                      142   1e-36    
ref|WP_011363031.1|  aspartate kinase                                   145   1e-36    
ref|WP_013869823.1|  aspartate kinase                                   144   1e-36    
ref|WP_034532896.1|  aspartate kinase                                   139   1e-36    
ref|WP_025076188.1|  aspartate kinase                                   144   1e-36    
ref|WP_022149218.1|  aspartokinase                                      144   2e-36    
ref|WP_026898411.1|  aspartate kinase                                   144   2e-36    
ref|WP_010931789.1|  aspartate kinase                                   144   2e-36    
ref|WP_009437609.1|  amino acid kinase family protein                   144   2e-36    
ref|WP_007665003.1|  MULTISPECIES: aspartate kinase                     144   2e-36    
ref|WP_036873830.1|  MULTISPECIES: aspartate kinase                     144   2e-36    
ref|WP_014680179.1|  aspartate kinase                                   144   2e-36    
ref|WP_044001665.1|  aspartate kinase                                   144   2e-36    
emb|CDA83684.1|  aspartokinase                                          144   2e-36    
ref|WP_004313659.1|  MULTISPECIES: aspartate kinase                     144   2e-36    
gb|ERT58063.1|  amino acid kinase family protein                        144   2e-36    
ref|WP_008025480.1|  aspartate kinase                                   144   2e-36    
ref|WP_025839701.1|  aspartate kinase                                   144   2e-36    
dbj|GAK91704.1|  aspartokinase                                          143   2e-36    
ref|WP_022054382.1|  aspartokinase                                      144   2e-36    
ref|WP_038558226.1|  aspartate kinase                                   144   3e-36    
ref|WP_013616984.1|  aspartate kinase                                   144   3e-36    
ref|WP_024267275.1|  Aspartokinase                                      144   3e-36    
ref|WP_022040193.1|  aspartokinase                                      144   3e-36    
ref|WP_044165132.1|  aspartate kinase                                   144   3e-36    
ref|WP_010151816.1|  aspartate kinase                                   144   3e-36    
ref|WP_012506710.1|  aspartate kinase                                   144   3e-36    
ref|WP_036882607.1|  aspartate kinase                                   143   3e-36    
ref|WP_021947139.1|  aspartokinase                                      143   3e-36    
ref|WP_024993495.1|  aspartate kinase                                   143   3e-36    
ref|WP_012241869.1|  aspartate kinase                                   143   3e-36    
dbj|GAL01950.1|  aspartokinase                                          143   3e-36    
ref|WP_005678111.1|  MULTISPECIES: aspartate kinase                     143   4e-36    
ref|WP_006744371.1|  aspartate kinase                                   143   4e-36    
ref|WP_007561801.1|  aspartate kinase                                   143   4e-36    
ref|WP_022111045.1|  aspartokinase                                      143   4e-36    
ref|WP_007766339.1|  aspartate kinase                                   143   4e-36    
ref|WP_004304027.1|  MULTISPECIES: aspartate kinase                     143   4e-36    
ref|WP_007748065.1|  aspartate kinase                                   143   4e-36    
ref|WP_004297043.1|  aspartate kinase                                   143   4e-36    
ref|WP_021278371.1|  putative aspartate kinase, monofunctional class    143   5e-36    
ref|WP_036862268.1|  aspartate kinase                                   143   5e-36    
ref|WP_012794438.1|  aspartate kinase                                   143   5e-36    
ref|WP_041466196.1|  aspartate kinase                                   143   5e-36    
ref|WP_007172964.1|  aspartate kinase                                   143   5e-36    
ref|WP_036578931.1|  aspartate kinase                                   143   5e-36    
ref|WP_039876725.1|  aspartate kinase                                   143   5e-36    
gb|ERK00008.1|  amino acid kinase family protein                        143   5e-36    
ref|WP_009000030.1|  aspartate kinase                                   143   5e-36    
ref|WP_027952637.1|  aspartate kinase                                   143   5e-36    
ref|WP_005930909.1|  MULTISPECIES: aspartate kinase                     143   5e-36    
gb|ACF12392.1|  aspartate kinase                                        143   5e-36    
ref|WP_005037511.1|  aspartate kinase                                   143   6e-36    
ref|WP_024991243.1|  aspartate kinase                                   142   6e-36    
ref|WP_022384596.1|  aspartokinase                                      142   6e-36    
ref|WP_022252402.1|  aspartokinase                                      142   6e-36    
ref|WP_011587059.1|  aspartate kinase                                   142   6e-36    
ref|WP_022326880.1|  aspartokinase                                      142   6e-36    
ref|WP_007854227.1|  aspartate kinase                                   142   6e-36    
ref|WP_005841213.1|  MULTISPECIES: aspartate kinase                     142   7e-36    
ref|WP_010538616.1|  MULTISPECIES: aspartate kinase                     142   7e-36    
ref|WP_022284655.1|  aspartokinase                                      142   8e-36    
ref|WP_009184147.1|  aspartate kinase                                   142   8e-36    
ref|WP_024996122.1|  aspartate kinase                                   142   8e-36    
ref|WP_019035776.1|  aspartate kinase                                   142   8e-36    
ref|WP_008141737.1|  MULTISPECIES: aspartate kinase                     142   8e-36    
ref|WP_006365733.1|  aspartate kinase                                   142   8e-36    
ref|WP_006795059.1|  aspartate kinase                                   142   8e-36    
ref|WP_044532489.1|  aspartate kinase                                   142   8e-36    
ref|WP_007899600.1|  aspartate kinase                                   142   8e-36    
ref|WP_029328896.1|  aspartate kinase                                   142   9e-36    
ref|WP_007209749.1|  MULTISPECIES: aspartate kinase                     142   9e-36    
ref|WP_022429650.1|  aspartokinase                                      142   9e-36    
ref|WP_005831418.1|  MULTISPECIES: aspartate kinase                     142   9e-36    
ref|WP_027325746.1|  aspartate kinase                                   142   1e-35    
ref|WP_029033274.1|  aspartate kinase                                   142   1e-35    
ref|WP_022391971.1|  MULTISPECIES: aspartokinase                        142   1e-35    
ref|WP_020401930.1|  hypothetical protein                               142   1e-35    
ref|WP_016274338.1|  aspartate kinase                                   142   1e-35    
ref|WP_021853136.1|  aspartokinase                                      142   1e-35    
ref|WP_014710013.1|  aspartate kinase                                   142   1e-35    
ref|WP_028904654.1|  aspartate kinase                                   142   1e-35    
ref|WP_015363880.1|  aspartokinase                                      142   1e-35    
ref|WP_022232574.1|  aspartokinase                                      142   1e-35    
ref|WP_021971993.1|  aspartokinase                                      142   1e-35    
ref|WP_010423559.1|  aspartate kinase                                   142   1e-35    
ref|WP_025799894.1|  aspartate kinase                                   142   1e-35    
ref|WP_021896753.1|  aspartokinase                                      142   1e-35    
ref|WP_025816900.1|  aspartate kinase                                   142   1e-35    
ref|WP_018630016.1|  aspartate kinase                                   142   1e-35    
ref|WP_009124181.1|  aspartate kinase                                   142   1e-35    
ref|WP_021348996.1|  aspartate kinase                                   142   1e-35    
ref|WP_021668361.1|  amino acid kinase family protein                   142   1e-35    
ref|WP_034848862.1|  aspartate kinase                                   142   1e-35    
ref|WP_002697509.1|  aspartate kinase                                   142   1e-35    
ref|WP_040294729.1|  hypothetical protein                               142   1e-35    
ref|WP_008510364.1|  aspartate kinase                                   141   1e-35    
ref|WP_024568822.1|  aspartate kinase                                   141   1e-35    
ref|WP_034543630.1|  aspartate kinase                                   141   1e-35    
ref|WP_027884863.1|  aspartate kinase                                   141   1e-35    
ref|WP_004355471.1|  aspartate kinase                                   141   2e-35    
ref|WP_021266646.1|  putative aspartate kinase, monofunctional class    142   2e-35    
gb|EHB91783.1|  hypothetical protein HMPREF9450_01832                   141   2e-35    
ref|WP_009161488.1|  putative aspartate kinase III                      141   2e-35    
ref|WP_036792454.1|  aspartate kinase                                   141   2e-35    
ref|WP_029464595.1|  aspartate kinase                                   141   2e-35    
ref|WP_021646265.1|  amino acid kinase family protein                   141   2e-35    
ref|WP_016277830.1|  MULTISPECIES: aspartate kinase                     141   2e-35    
ref|WP_008446419.1|  aspartate kinase                                   141   2e-35    
ref|WP_039470980.1|  aspartate kinase                                   141   2e-35    
ref|WP_013547450.1|  aspartate kinase                                   141   2e-35    
ref|WP_022129463.1|  aspartokinase                                      141   2e-35    
ref|WP_015808149.1|  aspartate kinase                                   141   2e-35    
ref|WP_012509435.1|  aspartate kinase                                   142   2e-35    
ref|WP_008246079.1|  aspartate kinase                                   141   2e-35    
ref|WP_041593403.1|  aspartate kinase                                   142   2e-35    
ref|WP_036867097.1|  aspartate kinase                                   141   2e-35    
gb|AFL89503.1|  aspartate kinase                                        142   2e-35    
ref|WP_026763105.1|  aspartate kinase                                   141   2e-35    
ref|WP_010528812.1|  aspartate kinase                                   141   2e-35    
ref|WP_039052857.1|  aspartate kinase                                   141   2e-35    
ref|WP_022353823.1|  aspartokinase                                      141   2e-35    
ref|WP_009132256.1|  aspartate kinase                                   141   2e-35    
ref|WP_018127828.1|  hypothetical protein                               141   2e-35    
ref|WP_024999615.1|  aspartate kinase                                   141   2e-35    
ref|WP_025143515.1|  aspartate kinase                                   141   2e-35    
ref|WP_002561502.1|  MULTISPECIES: aspartate kinase                     141   2e-35    
ref|WP_029275214.1|  aspartate kinase                                   141   3e-35    
ref|WP_004348840.1|  aspartate kinase                                   141   3e-35    
ref|WP_016776018.1|  aspartate kinase                                   141   3e-35    
ref|WP_005843462.1|  aspartate kinase                                   141   3e-35    
ref|WP_022311446.1|  aspartokinase                                      140   3e-35    
ref|WP_006282985.1|  aspartate kinase                                   140   3e-35    
ref|WP_025071803.1|  aspartate kinase                                   140   3e-35    
ref|WP_025789808.1|  aspartate kinase                                   140   3e-35    
ref|WP_022158985.1|  aspartokinase                                      140   4e-35    
ref|WP_044070355.1|  aspartate kinase                                   140   4e-35    
ref|WP_022510671.1|  lysine-sensitive aspartokinase III                 140   4e-35    
ref|WP_005939113.1|  MULTISPECIES: aspartate kinase                     140   4e-35    
gb|KDR53600.1|  putative aspartate kinase III                           140   4e-35    
ref|WP_021964063.1|  aspartokinase                                      140   4e-35    
ref|WP_036928105.1|  aspartate kinase                                   140   4e-35    
ref|WP_008125334.1|  aspartate kinase                                   140   4e-35    
ref|WP_025815073.1|  aspartate kinase                                   140   4e-35    
ref|WP_044514329.1|  aspartate kinase                                   140   4e-35    



>ref|XP_011097258.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Sesamum 
indicum]
Length=556

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 201/208 (97%), Positives = 204/208 (98%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+TRDMSEAVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMSEAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  456  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALHSAFFE
Sbjct  516  ASKVNISLIVNDSEAEQCVRALHSAFFE  543



>gb|KJB11754.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=364

 Score =   394 bits (1012),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  149  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  208

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQ
Sbjct  209  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQ  268

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  269  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  328

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  329  ASKVNISLIVHDTEAEQCVRALHSTFFE  356



>ref|XP_010250546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=578

 Score =   400 bits (1029),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/233 (88%), Positives = 212/233 (91%), Gaps = 3/233 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK+RDMSEAVLTSIVLK
Sbjct  344  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKSRDMSEAVLTSIVLK  403

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  404  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  463

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  464  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  523

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEs---dlsklvsd*kSQNGSSSDFPN  53
            ASKVNISLIVNDSEAEQCV ALH  FFE          S+  S+NGS +  P+
Sbjct  524  ASKVNISLIVNDSEAEQCVRALHYTFFERGVLSDVSSTSNSLSENGSPTPLPD  576



>gb|EYU34829.1| hypothetical protein MIMGU_mgv1a003795mg [Erythranthe guttata]
Length=563

 Score =   400 bits (1027),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/208 (95%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+ RDMSEA+LTSIVLK
Sbjct  339  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRRRDMSEAILTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  399  RNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  458

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL  NGVNVQMISQG
Sbjct  459  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRANGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH AFFE
Sbjct  519  ASKVNISLIVNDSEAEQCVRALHFAFFE  546



>ref|XP_004143759.1| PREDICTED: aspartokinase 2, chloroplastic-like [Cucumis sativus]
Length=474

 Score =   397 bits (1019),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  249  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  309  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  369  QASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  428

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  429  ASKVNISLIVNDNEAEQCVRALHSAFFE  456



>ref|XP_011097259.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Sesamum 
indicum]
Length=554

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 199/208 (96%), Positives = 202/208 (97%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+TRDMSEAVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMSEAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  456  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALHSAFFE
Sbjct  514  ASKVNISLIVNDSEAEQCVRALHSAFFE  541



>ref|XP_009607339.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
tomentosiformis]
Length=554

 Score =   399 bits (1024),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  386  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  445

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  446  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  505

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  506  ASKVNISLIVNDSEAEQCVRALHKTFFE  533



>ref|XP_010096037.1| Aspartokinase 3 [Morus notabilis]
 gb|EXB62843.1| Aspartokinase 3 [Morus notabilis]
Length=552

 Score =   397 bits (1021),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLIT+TRDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLITRTRDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  386  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  445

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQMISQG
Sbjct  446  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQMISQG  505

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALH AFFE
Sbjct  506  ASKVNISLIVNDDEAEQCVRALHQAFFE  533



>ref|XP_009781447.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Nicotiana 
sylvestris]
Length=561

 Score =   397 bits (1021),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  329  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  388

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  389  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  448

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQMISQG
Sbjct  449  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQMISQG  508

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  509  ASKVNISLIVNDSEAEQCVRALHKTFFE  536



>gb|KGN51126.1| hypothetical protein Csa_5G457770 [Cucumis sativus]
Length=560

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  455  QASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDNEAEQCVRALHSAFFE  542



>ref|XP_008465546.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Cucumis 
melo]
Length=566

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  455  QASELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDNEAEQCVRALHSAFFE  542



>gb|KHN00623.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=409

 Score =   391 bits (1004),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  181  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  240

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  241  RNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  300

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQMISQG
Sbjct  301  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQMISQG  360

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  361  ASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  404



>gb|KJB11756.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=529

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  314  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  373

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQ
Sbjct  374  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQ  433

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  434  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  493

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  494  ASKVNISLIVHDTEAEQCVRALHSTFFE  521



>ref|XP_004164561.1| PREDICTED: aspartokinase 3, chloroplastic-like, partial [Cucumis 
sativus]
Length=334

 Score =   386 bits (992),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  111  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  170

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  171  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  230

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  231  Q--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  288

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  289  ASKVNISLIVNDNEAEQCVRALHSAFFE  316



>gb|KJB11753.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=558

 Score =   394 bits (1013),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  463  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  522

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  523  ASKVNISLIVHDTEAEQCVRALHSTFFE  550



>ref|XP_010316459.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
lycopersicum]
Length=567

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQMISQG
Sbjct  452  QASELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMRTNGVNVQMISQG  511

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  512  ASKVNISLIVNDSEAEQCVRALHHSFFE  539



>ref|XP_009607337.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
tomentosiformis]
Length=557

 Score =   393 bits (1010),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 196/211 (93%), Positives = 200/211 (95%), Gaps = 3/211 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  392
            RNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+
Sbjct  386  RNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRE  445

Query  391  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  212
            LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMI
Sbjct  446  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMI  505

Query  211  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            SQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  506  SQGASKVNISLIVNDSEAEQCVRALHKTFFE  536



>emb|CBI21283.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   390 bits (1003),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 213/230 (93%), Gaps = 1/230 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  249  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  309  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQMISQG
Sbjct  369  QASELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQMISQG  428

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  53
            ASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  429  ASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  477



>ref|XP_006364050.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Solanum 
tuberosum]
Length=569

 Score =   393 bits (1010),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 202/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQMISQG
Sbjct  452  QASELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMHTNGVNVQMISQG  511

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  512  ASKVNISLIVNDSEAEQCVRALHHSFFE  539



>ref|XP_011006143.1| PREDICTED: aspartokinase 2, chloroplastic-like [Populus euphratica]
Length=324

 Score =   384 bits (987),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 208/224 (93%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  94   EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVLK  153

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  154  RNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  213

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  214  QASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQMISQG  273

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  274  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  317



>ref|XP_004304561.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011468210.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Fragaria 
vesca subsp. vesca]
Length=562

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 201/208 (97%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+IT+ RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPEAPGTVITRARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQ+SSLILEKAFHVL TNGVNVQMISQG
Sbjct  460  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQKSSLILEKAFHVLRTNGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAEQCV ALH AFF+
Sbjct  520  ASKVNISLVVNDNEAEQCVRALHQAFFD  547



>ref|XP_007032011.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032012.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 ref|XP_007032015.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02937.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02938.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY02941.1| Aspartate kinase 3 isoform 1 [Theobroma cacao]
Length=566

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 195/208 (94%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRFRDMSKAVLTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  402  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  461

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  462  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQMISQG  521

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D EAEQCV ALHSAFFE
Sbjct  522  ASKVNISLIVHDDEAEQCVRALHSAFFE  549



>ref|XP_009781445.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Nicotiana 
sylvestris]
Length=564

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/211 (92%), Positives = 200/211 (95%), Gaps = 3/211 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  329  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  388

Query  562  RNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  392
            RNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+
Sbjct  389  RNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRE  448

Query  391  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  212
            LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQMI
Sbjct  449  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQMI  508

Query  211  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            SQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  509  SQGASKVNISLIVNDSEAEQCVRALHKTFFE  539



>ref|XP_011024774.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011024776.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Populus 
euphratica]
Length=557

 Score =   392 bits (1007),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 200/226 (88%), Positives = 211/226 (93%), Gaps = 0/226 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNV RSSLILEKAFHVL T GVNVQMISQG
Sbjct  451  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVHRSSLILEKAFHVLRTLGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  65
            ASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  511  ASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  556



>ref|XP_006574470.1| PREDICTED: precursor monofunctional aspartokinase isoform X1 
[Glycine max]
Length=564

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 203/224 (91%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQMISQG
Sbjct  456  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  516  ASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  559



>ref|XP_010250548.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nelumbo 
nucifera]
Length=576

 Score =   392 bits (1007),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 202/233 (87%), Positives = 210/233 (90%), Gaps = 5/233 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK+RDMSEAVLTSIVLK
Sbjct  344  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKSRDMSEAVLTSIVLK  403

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  404  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  463

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  464  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  521

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEs---dlsklvsd*kSQNGSSSDFPN  53
            ASKVNISLIVNDSEAEQCV ALH  FFE          S+  S+NGS +  P+
Sbjct  522  ASKVNISLIVNDSEAEQCVRALHYTFFERGVLSDVSSTSNSLSENGSPTPLPD  574



>ref|XP_008231031.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Prunus 
mume]
Length=565

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  463  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQMISQG  522

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  523  ASKVNISLVVNDNEAEQCVRALHQAFFE  550



>ref|XP_007215316.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
 gb|EMJ16515.1| hypothetical protein PRUPE_ppa003561mg [Prunus persica]
Length=565

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  463  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQMISQG  522

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  523  ASKVNISLVVNDNEAEQCVRALHQAFFE  550



>ref|XP_002301756.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
 gb|EEE81029.2| hypothetical protein POPTR_0002s23800g [Populus trichocarpa]
Length=557

 Score =   391 bits (1005),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 200/226 (88%), Positives = 211/226 (93%), Gaps = 0/226 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ RSIISLIGNVQRSSLILEKAFHVL T GVNVQMISQG
Sbjct  451  QASELDHVVEELEKIAVVNLLQRRSIISLIGNVQRSSLILEKAFHVLRTLGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  65
            ASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  511  ASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  556



>ref|XP_010660689.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Vitis vinifera]
Length=569

 Score =   391 bits (1004),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 213/230 (93%), Gaps = 1/230 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  399  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  458

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQMISQG
Sbjct  459  QASELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  53
            ASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  519  ASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  567



>ref|XP_009607340.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
tomentosiformis]
Length=552

 Score =   390 bits (1002),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 194/208 (93%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  386  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  445

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  446  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  503

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  504  ASKVNISLIVNDSEAEQCVRALHKTFFE  531



>gb|KJB33204.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=367

 Score =   384 bits (985),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  149  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  208

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  209  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  268

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  269  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  326

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  327  ASKVNISLVVNDNEAEECVRALHSSFFE  354



>gb|KDP41849.1| hypothetical protein JCGZ_26867 [Jatropha curcas]
Length=463

 Score =   387 bits (993),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 190/208 (91%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDM +AVLTSIVLK
Sbjct  249  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRARDMRKAVLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK+WSR+LIQ
Sbjct  309  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKVWSRELIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQMISQG
Sbjct  369  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQMISQG  428

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV +LH  FFE
Sbjct  429  ASKVNISLIVNDDEAEQCVRSLHKTFFE  456



>ref|XP_009781448.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Nicotiana 
sylvestris]
Length=559

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  329  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  388

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  389  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  448

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQMISQG
Sbjct  449  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQMISQG  506

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  507  ASKVNISLIVNDSEAEQCVRALHKTFFE  534



>emb|CDP16734.1| unnamed protein product [Coffea canephora]
Length=570

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 202/224 (90%), Positives = 209/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLIT+ RDMSEAVLTSIV+K
Sbjct  341  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPKAPGTLITRARDMSEAVLTSIVVK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  401  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEK+AVVNLLQ RSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  461  Q--ELDHVVEELEKVAVVNLLQRRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVNDSEAEQCV ALHSAFFES+LS L    +S NGS
Sbjct  519  ASKVNISLIVNDSEAEQCVRALHSAFFESNLSDLYCGSRSGNGS  562



>ref|XP_008465552.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Cucumis 
melo]
Length=564

 Score =   389 bits (999),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 200/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  455  Q--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  513  ASKVNISLIVNDNEAEQCVRALHSAFFE  540



>ref|XP_007151723.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23717.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=545

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 197/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+A+LTSIVLK
Sbjct  330  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAILTSIVLK  389

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  390  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  449

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ RSIISLIGNVQ+SSLILEKAF VL T GV VQMISQG
Sbjct  450  QASELDHVVEELEKIAVVNLLQSRSIISLIGNVQKSSLILEKAFRVLRTLGVTVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VNDSEAEQCV ALHS FFE
Sbjct  510  ASKVNISLVVNDSEAEQCVRALHSVFFE  537



>ref|XP_002321084.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
 gb|EEE99399.2| hypothetical protein POPTR_0014s14270g [Populus trichocarpa]
Length=561

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 197/223 (88%), Positives = 207/223 (93%), Gaps = 0/223 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIV+K
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVMK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  451  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLHIKGINVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNG  74
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NG
Sbjct  511  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNG  553



>ref|XP_008465539.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Cucumis 
melo]
Length=581

 Score =   387 bits (994),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 194/223 (87%), Positives = 202/223 (91%), Gaps = 15/223 (7%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+ RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRNRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLA+VF+IFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  454

Query  382  QAS---------------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFH  248
            QAS               ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEKAFH
Sbjct  455  QASKIRVLFSVSFERTRDELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKAFH  514

Query  247  VLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            VL TNGVNVQMISQGASKVNISLIVND+EAEQCV ALHSAFFE
Sbjct  515  VLRTNGVNVQMISQGASKVNISLIVNDNEAEQCVRALHSAFFE  557



>gb|KDO43558.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=559

 Score =   386 bits (992),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQMISQG
Sbjct  453  QASELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  68
            ASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  513  ASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  557



>ref|XP_006468884.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X1 [Citrus 
sinensis]
Length=559

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 197/225 (88%), Positives = 206/225 (92%), Gaps = 0/225 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQMISQG
Sbjct  453  QASELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  68
            ASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  513  ASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  557



>gb|KHN13387.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=568

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 210/224 (94%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQMISQG
Sbjct  456  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  516  ASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  559



>ref|XP_003548032.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
Length=567

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 210/224 (94%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQMISQG
Sbjct  455  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  515  ASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  558



>gb|KJB11752.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=556

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/208 (92%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  463  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  520

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  521  ASKVNISLIVHDTEAEQCVRALHSTFFE  548



>ref|XP_004228743.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
lycopersicum]
Length=565

 Score =   386 bits (991),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 200/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQMISQG
Sbjct  452  Q--ELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMRTNGVNVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  510  ASKVNISLIVNDSEAEQCVRALHHSFFE  537



>ref|XP_009607338.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
tomentosiformis]
Length=555

 Score =   385 bits (989),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 194/211 (92%), Positives = 198/211 (94%), Gaps = 5/211 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  392
            RNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+
Sbjct  386  RNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRE  445

Query  391  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  212
            LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMI
Sbjct  446  LIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMI  503

Query  211  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            SQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  504  SQGASKVNISLIVNDSEAEQCVRALHKTFFE  534



>ref|XP_010028950.1| PREDICTED: aspartokinase 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW55773.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=565

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 200/226 (88%), Positives = 210/226 (93%), Gaps = 2/226 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK F+VL TNGVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  65
            ASKVNISLIVND EAEQCV ALHSAFFESDL +L    +S NGS++
Sbjct  518  ASKVNISLIVNDDEAEQCVRALHSAFFESDLPELDHGYRSGNGSAA  563



>ref|XP_006364051.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=567

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 200/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI KTRDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIVKTRDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIASTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVV LLQ+RSIISLIGNVQRSSLILEKAFHV+ TNGVNVQMISQG
Sbjct  452  Q--ELDNVVEELEKIAVVKLLQNRSIISLIGNVQRSSLILEKAFHVMHTNGVNVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV ALH +FFE
Sbjct  510  ASKVNISLIVNDSEAEQCVRALHHSFFE  537



>gb|KEH25641.1| monofunctional aspartokinase [Medicago truncatula]
Length=560

 Score =   385 bits (989),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 196/224 (88%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQMISQG
Sbjct  452  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQMISQG  511

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAE+CV ALH AFFE++ S+L     + NGS
Sbjct  512  ASKVNISLVVNDSEAEECVRALHHAFFETEFSELQIGYTNGNGS  555



>ref|XP_011468211.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   385 bits (988),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+IT+ RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPEAPGTVITRARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQ+SSLILEKAFHVL TNGVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQKSSLILEKAFHVLRTNGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAEQCV ALH AFF+
Sbjct  518  ASKVNISLVVNDNEAEQCVRALHQAFFD  545



>ref|NP_001238151.1| precursor monofunctional aspartokinase [Glycine max]
 gb|AAD41796.1| precursor monofunctional aspartokinase [Glycine max]
Length=564

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 210/224 (94%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILE+   VL T GV VQMISQG
Sbjct  456  QASELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILERLSRVLRTLGVTVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  516  ASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  559



>ref|XP_007032013.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 ref|XP_007032014.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02939.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
 gb|EOY02940.1| Aspartate kinase 3 isoform 3 [Theobroma cacao]
Length=564

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/208 (93%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRFRDMSKAVLTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  402  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  461

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  462  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D EAEQCV ALHSAFFE
Sbjct  520  ASKVNISLIVHDDEAEQCVRALHSAFFE  547



>ref|XP_011006114.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X3 [Populus 
euphratica]
Length=561

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  451  QASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  511  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  554



>ref|XP_009781446.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Nicotiana 
sylvestris]
Length=562

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 193/211 (91%), Positives = 198/211 (94%), Gaps = 5/211 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI + RDMS+AVLTSIVLK
Sbjct  329  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLICRARDMSKAVLTSIVLK  388

Query  562  RNVTMLDIASTRMLGQYGFLAK---VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRD  392
            RNVTMLDI STRMLGQ+GFLAK   VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+
Sbjct  389  RNVTMLDIVSTRMLGQFGFLAKLLQVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRE  448

Query  391  LIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMI  212
            LIQQ  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNG+NVQMI
Sbjct  449  LIQQ--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGINVQMI  506

Query  211  SQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            SQGASKVNISLIVNDSEAEQCV ALH  FFE
Sbjct  507  SQGASKVNISLIVNDSEAEQCVRALHKTFFE  537



>ref|XP_006657643.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=571

 Score =   384 bits (987),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QA+ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  458  QANELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  518  ASKVNISLVVHDSEAKQCVQALHSAFFE  545



>ref|XP_011024777.1| PREDICTED: aspartokinase 3, chloroplastic isoform X2 [Populus 
euphratica]
Length=555

 Score =   384 bits (986),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 198/226 (88%), Positives = 209/226 (92%), Gaps = 2/226 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTLITRARDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ+GFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIASTRMLGQFGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNV RSSLILEKAFHVL T GVNVQMISQG
Sbjct  451  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVHRSSLILEKAFHVLRTLGVNVQMISQG  508

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSS  65
            ASKVNISLIVND EAEQCV++LH AFFE+D+S+L  +  S NGS+S
Sbjct  509  ASKVNISLIVNDDEAEQCVKSLHKAFFETDISELEWECVSGNGSAS  554



>emb|CBI35668.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   381 bits (979),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTSIVLK
Sbjct  249  EAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  309  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQMISQG
Sbjct  369  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQMISQG  426

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV+ALH AFFE
Sbjct  427  ASKVNISLIVNDSEAEQCVKALHHAFFE  454



>ref|XP_006574471.1| PREDICTED: precursor monofunctional aspartokinase isoform X2 
[Glycine max]
Length=562

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 201/224 (90%), Positives = 210/224 (94%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIASTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T GV VQMISQG
Sbjct  456  Q--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGVTVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALHSAFFES+LS+L  D K+ NGS
Sbjct  514  ASKVNISLVVNDSEAEQCVRALHSAFFESELSELEMDYKNGNGS  557



>gb|KJB33201.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=556

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  516  ASKVNISLVVNDNEAEECVRALHSSFFE  543



>ref|XP_008231032.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Prunus 
mume]
Length=563

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  463  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTNGVNVQMISQG  520

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAEQCV ALH AFFE
Sbjct  521  ASKVNISLVVNDNEAEQCVRALHQAFFE  548



>ref|XP_004515404.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Cicer 
arietinum]
Length=560

 Score =   383 bits (984),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 206/224 (92%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKERDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHV EELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL   GV VQMISQG
Sbjct  452  QASELDHVAEELEKIAVVNLLQNRSIISLIGNVQKSSLILEKAFRVLRKLGVTVQMISQG  511

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFE++ S+L  +  + NGS
Sbjct  512  ASKVNISLVVNDSEAEQCVRALHEAFFENEFSELQMEYTNGNGS  555



>ref|XP_009378035.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=568

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQMISQG
Sbjct  460  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTTGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND+EAEQCV ALH AFF
Sbjct  520  ASKVNISLVVNDNEAEQCVRALHQAFF  546



>ref|XP_011006109.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006110.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006111.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
 ref|XP_011006112.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Populus 
euphratica]
Length=586

 Score =   384 bits (986),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 197/224 (88%), Positives = 207/224 (92%), Gaps = 0/224 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  356  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVLK  415

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  416  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  475

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  476  QASELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQMISQG  535

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  536  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  579



>ref|XP_002275779.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Vitis vinifera]
Length=567

 Score =   383 bits (983),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 211/230 (92%), Gaps = 3/230 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRNAPGTLITRTRDMSKAVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  399  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  458

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGN+Q SSLILEKAFHVL T GVNVQMISQG
Sbjct  459  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQMSSLILEKAFHVLRTKGVNVQMISQG  516

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  53
            ASKVNISLIVND +AE+CV ALHSAFFE  LS++  + +S NGS+S F N
Sbjct  517  ASKVNISLIVNDDQAEKCVRALHSAFFE-SLSEVDRECQSDNGSTSAFSN  565



>ref|XP_007043813.1| Aspartate kinase 1 [Theobroma cacao]
 gb|EOX99644.1| Aspartate kinase 1 [Theobroma cacao]
Length=575

 Score =   383 bits (984),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITKTRDMS+AVLTSIVLK
Sbjct  344  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKTRDMSKAVLTSIVLK  403

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  404  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  463

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ RSIISLIGNVQRSSLILEK FHVL T GVNVQMISQG
Sbjct  464  Q--ELDHVVEELEKIAVVNLLQRRSIISLIGNVQRSSLILEKVFHVLRTIGVNVQMISQG  521

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE+CV+ALH +FFE
Sbjct  522  ASKVNISLIVNDGEAEKCVKALHQSFFE  549



>ref|XP_008362086.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Malus 
domestica]
Length=568

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQMISQG
Sbjct  460  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTIGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND+EAEQCV ALH AFF
Sbjct  520  ASKVNISLVVNDNEAEQCVRALHQAFF  546



>gb|EPS64336.1| hypothetical protein M569_10444, partial [Genlisea aurea]
Length=484

 Score =   379 bits (974),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 195/207 (94%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREGGIPVRVKNSYNP+APGTLIT+TRDM EAVLTSIVLK
Sbjct  280  EAAELAYFGAQVLHPLSMRPAREGGIPVRVKNSYNPEAPGTLITRTRDMDEAVLTSIVLK  339

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ GFLA+VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  340  RNVTMLDIVSTRMLGQVGFLARVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  399

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV EELEKIAVVNL QHRSIISLIGNVQRSSLILEKAF VL TNGVNVQMISQG
Sbjct  400  Q--ELDHVEEELEKIAVVNLWQHRSIISLIGNVQRSSLILEKAFRVLRTNGVNVQMISQG  457

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISLIVND EAE+CV ALHSAFF
Sbjct  458  ASKVNISLIVNDDEAEECVRALHSAFF  484



>ref|NP_001059423.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAC84901.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31992.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAF21337.1| Os07g0300900 [Oryza sativa Japonica Group]
 dbj|BAG88180.1| unnamed protein product [Oryza sativa Japonica Group]
Length=575

 Score =   382 bits (981),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/208 (90%), Positives = 200/208 (96%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LI+
Sbjct  402  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIK  461

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QA+ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  462  QANELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  521

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  522  ASKVNISLVVHDSEAKQCVQALHSAFFE  549



>ref|XP_010656841.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Vitis vinifera]
Length=573

 Score =   381 bits (979),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 191/208 (92%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAEQCV+ALH AFFE
Sbjct  518  ASKVNISLIVNDSEAEQCVKALHHAFFE  545



>ref|XP_010927771.1| PREDICTED: aspartokinase 2, chloroplastic-like [Elaeis guineensis]
Length=380

 Score =   374 bits (959),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGT+ITK RDMSEA+LTSIVLK
Sbjct  149  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTVITKARDMSEAILTSIVLK  208

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+L+Q
Sbjct  209  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELVQ  268

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q SELDH+VEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF++L  N VNVQMISQG
Sbjct  269  QESELDHLVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNILRKNKVNVQMISQG  328

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV ALH AFFE
Sbjct  329  ASKVNISLVVHDSEAKQCVRALHLAFFE  356



>ref|XP_008379051.1| PREDICTED: aspartokinase 2, chloroplastic isoform X2 [Malus domestica]
Length=568

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE+AF VL T GVNVQMISQG
Sbjct  460  QASELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILERAFQVLRTIGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND EAEQCV ALH AFF
Sbjct  520  ASKVNISLVVNDDEAEQCVRALHQAFF  546



>ref|XP_007151724.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
 gb|ESW23718.1| hypothetical protein PHAVU_004G070100g [Phaseolus vulgaris]
Length=543

 Score =   378 bits (971),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/208 (91%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+A+LTSIVLK
Sbjct  330  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAILTSIVLK  389

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  390  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  449

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ RSIISLIGNVQ+SSLILEKAF VL T GV VQMISQG
Sbjct  450  Q--ELDHVVEELEKIAVVNLLQSRSIISLIGNVQKSSLILEKAFRVLRTLGVTVQMISQG  507

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VNDSEAEQCV ALHS FFE
Sbjct  508  ASKVNISLVVNDSEAEQCVRALHSVFFE  535



>ref|XP_008379050.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Malus domestica]
Length=568

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQMISQG
Sbjct  460  QASELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND EAEQCV ALH AFF
Sbjct  520  ASKVNISLVVNDDEAEQCVRALHQAFF  546



>ref|XP_006468885.1| PREDICTED: aspartokinase 3, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=557

 Score =   378 bits (971),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 204/225 (91%), Gaps = 2/225 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQMISQG
Sbjct  453  Q--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  68
            ASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  511  ASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>gb|KDO43559.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=557

 Score =   378 bits (971),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 204/225 (91%), Gaps = 2/225 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQMISQG
Sbjct  453  Q--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  68
            ASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  511  ASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>ref|XP_006446944.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
 gb|ESR60184.1| hypothetical protein CICLE_v10014778mg [Citrus clementina]
Length=557

 Score =   378 bits (970),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 195/225 (87%), Positives = 204/225 (91%), Gaps = 2/225 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSSLILEKAF VL  +GVNVQMISQG
Sbjct  453  Q--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSLILEKAFRVLRRSGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSS  68
            ASKVNISLIVND EAEQCV ALH  FFESDL+ L     S+N SS
Sbjct  511  ASKVNISLIVNDDEAEQCVRALHETFFESDLANLDCVCGSENNSS  555



>ref|XP_006599412.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
Length=565

 Score =   378 bits (970),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 198/224 (88%), Positives = 208/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKARDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  395  RNVTMLDIVSTRMLGQYGFLAKVFSIFEELGISVDVVATSEVSVSLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQRSSLILEKAF VL T G+ VQMISQG
Sbjct  455  Q--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQRSSLILEKAFRVLRTLGITVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFES+LS+L  D K+ NGS
Sbjct  513  ASKVNISLVVNDSEAEQCVRALHLAFFESELSELEMDYKNGNGS  556



>ref|XP_009131382.1| PREDICTED: aspartokinase 2, chloroplastic [Brassica rapa]
Length=537

 Score =   377 bits (968),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  327  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTSIVLK  386

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+L+Q
Sbjct  387  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELVQ  446

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            +A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  447  RANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQMISQG  506

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  507  ASKVNISLIVNDEEAEQCVRALHSAFFE  534



>emb|CDX78557.1| BnaA03g04690D [Brassica napus]
Length=537

 Score =   377 bits (967),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  327  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTSIVLK  386

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+L+Q
Sbjct  387  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELVQ  446

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            +A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  447  RANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQMISQG  506

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  507  ASKVNISLIVNDEEAEQCVRALHSAFFE  534



>ref|XP_002512848.1| aspartate kinase, putative [Ricinus communis]
 gb|EEF49351.1| aspartate kinase, putative [Ricinus communis]
Length=556

 Score =   377 bits (967),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 186/199 (93%), Positives = 192/199 (96%), Gaps = 0/199 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRARDMSKAVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  399  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  458

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QASELDHV+EELEKIAVVNLLQHRSIISLIGNVQRSSLILEK F+VL TNGVNVQMISQG
Sbjct  459  QASELDHVLEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCV  146
            ASKVNISLIVND EAEQCV
Sbjct  519  ASKVNISLIVNDDEAEQCV  537



>gb|KEH25640.1| monofunctional aspartokinase [Medicago truncatula]
Length=558

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/224 (87%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQMISQG
Sbjct  452  Q--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAE+CV ALH AFFE++ S+L     + NGS
Sbjct  510  ASKVNISLVVNDSEAEECVRALHHAFFETEFSELQIGYTNGNGS  553



>emb|CDX70538.1| BnaC03g06220D [Brassica napus]
Length=546

 Score =   376 bits (966),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+L+Q
Sbjct  396  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELVQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            +A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  456  RANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFKVLRSNGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  516  ASKVNISLIVNDEEAEQCVRALHSAFFE  543



>ref|XP_006399912.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 ref|XP_006399913.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41365.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41366.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=545

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+++Q
Sbjct  395  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGREIVQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            +A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  455  RANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_011006115.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X4 [Populus 
euphratica]
Length=559

 Score =   376 bits (966),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  391  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  451  Q--ELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQMISQG  508

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  509  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  552



>gb|KHM99220.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=553

 Score =   375 bits (964),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/224 (87%), Positives = 206/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTSIVLK
Sbjct  327  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTSIVLK  386

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  387  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  446

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQRSSLILEKAFHVL T GV VQMISQG
Sbjct  447  Q--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQRSSLILEKAFHVLRTLGVTVQMISQG  504

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFES+L +L ++    NGS
Sbjct  505  ASKVNISLVVNDSEAEQCVRALHKAFFESELFELENECIPGNGS  548



>ref|XP_009378037.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=566

 Score =   375 bits (964),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 193/207 (93%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTTGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND+EAEQCV ALH AFF
Sbjct  518  ASKVNISLVVNDNEAEQCVRALHQAFF  544



>ref|XP_010100040.1| Aspartokinase 1 [Morus notabilis]
 gb|EXB81211.1| Aspartokinase 1 [Morus notabilis]
Length=575

 Score =   376 bits (965),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 191/213 (90%), Positives = 198/213 (93%), Gaps = 5/213 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNPKAPGTLIT+TRDM+EAVLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPLSMRPAREGDIPVRVKNSYNPKAPGTLITRTRDMAEAVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ GFLA VFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  399  RNVTMLDIVSTRMLGQVGFLAMVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  458

Query  382  QAS-----ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  218
            QAS     ELD+V EEL+KIAVV LLQHRSIISLIGNVQRSSLILEKAFHVL TN VNVQ
Sbjct  459  QASMKSYRELDNVEEELKKIAVVKLLQHRSIISLIGNVQRSSLILEKAFHVLRTNDVNVQ  518

Query  217  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            MISQGASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  519  MISQGASKVNISLIVNDSEAERCVKALHQAFFE  551



>ref|XP_004515405.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=558

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/224 (86%), Positives = 204/224 (91%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLITK RDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLITKERDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV EELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL   GV VQMISQG
Sbjct  452  Q--ELDHVAEELEKIAVVNLLQNRSIISLIGNVQKSSLILEKAFRVLRKLGVTVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL+VNDSEAEQCV ALH AFFE++ S+L  +  + NGS
Sbjct  510  ASKVNISLVVNDSEAEQCVRALHEAFFENEFSELQMEYTNGNGS  553



>ref|XP_011006113.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Populus 
euphratica]
Length=584

 Score =   376 bits (965),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 195/224 (87%), Positives = 205/224 (92%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN  APGTLIT+TRDMS+AVLTSIVLK
Sbjct  356  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNSNAPGTLITRTRDMSKAVLTSIVLK  415

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  416  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  475

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVN+LQHRSIISL GNVQRSSLILEK F+VL   G+NVQMISQG
Sbjct  476  Q--ELDHVVEELEKIAVVNVLQHRSIISLNGNVQRSSLILEKVFNVLHIKGINVQMISQG  533

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISLIVND EAEQCV +LHSAFFESD+S+L     S NGS
Sbjct  534  ASKVNISLIVNDDEAEQCVRSLHSAFFESDVSELDGKCVSDNGS  577



>ref|XP_010682652.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=567

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLI +TRDMSE +LTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLINRTRDMSEVLLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            R+VTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  396  RSVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QA ELD VVEEL+ IAVVNLLQ+RSIISLIGNV  SSLILEKAFHVL TN VNVQMISQG
Sbjct  456  QARELDRVVEELQNIAVVNLLQNRSIISLIGNVHYSSLILEKAFHVLRTNNVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE+CV+ALH AFFE
Sbjct  516  ASKVNISLIVNDDEAEKCVKALHYAFFE  543



>dbj|BAC84902.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
 dbj|BAD31993.1| putative precursor monofunctional aspartokinase [Oryza sativa 
Japonica Group]
Length=573

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LI+
Sbjct  402  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIK  461

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  462  Q--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  520  ASKVNISLVVHDSEAKQCVQALHSAFFE  547



>ref|XP_009125901.1| PREDICTED: aspartokinase 1, chloroplastic-like [Brassica rapa]
Length=574

 Score =   375 bits (963),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  463  Q--ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  520

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAE CVEALH +FFE
Sbjct  521  ASKVNISLIVNDAEAEGCVEALHKSFFE  548



>ref|XP_008362087.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Malus 
domestica]
Length=566

 Score =   374 bits (961),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 193/207 (93%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF VL T GVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFQVLRTIGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND+EAEQCV ALH AFF
Sbjct  518  ASKVNISLVVNDNEAEQCVRALHQAFF  544



>gb|EEC76545.1| hypothetical protein OsI_14341 [Oryza sativa Indica Group]
Length=566

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 199/208 (96%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPA+EGGIPVRVKNSYN +APGT+ITKTRD+S+++LTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAKEGGIPVRVKNSYNRRAPGTVITKTRDLSKSILTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R+LIQ
Sbjct  393  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  453  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QC++ALHSAFFE
Sbjct  511  ASKVNISLVVHDSEAKQCIQALHSAFFE  538



>ref|XP_010453390.1| PREDICTED: aspartokinase 1, chloroplastic [Camelina sativa]
Length=573

 Score =   374 bits (961),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  402  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  461

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  462  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  519

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  520  ASKVNISFIVNDAEAEGCVQALHKSFFE  547



>ref|XP_008790700.1| PREDICTED: aspartokinase 2, chloroplastic-like [Phoenix dactylifera]
Length=569

 Score =   374 bits (960),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 198/208 (95%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGT+ITK RDMS+A+LTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTVITKARDMSKAILTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDIASTRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW+R+L+Q
Sbjct  398  SNITMLDIASTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWNRELVQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q SELDH+VEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF++L  N VNVQMISQG
Sbjct  458  QESELDHLVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNILRKNKVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QC+ ALHSAFF+
Sbjct  518  ASKVNISLVVHDSEAKQCIRALHSAFFK  545



>ref|XP_010556239.1| PREDICTED: aspartokinase 1, chloroplastic, partial [Tarenaya 
hassleriana]
Length=452

 Score =   370 bits (949),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITK RDM+  VLTSIVLK
Sbjct  222  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTIITKARDMTGTVLTSIVLK  281

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ GFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  282  RNVTMLDIVSTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSLSLTLDPSKLWSRELIQ  341

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILEKAFHVL T GVNVQMISQG
Sbjct  342  Q--ELDHVVEELEKIAVVNLLRRRAIISLIGNVQHSSLILEKAFHVLRTKGVNVQMISQG  399

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVN+ EAE+C+EALH AFFE
Sbjct  400  ASKVNISLIVNEDEAERCIEALHRAFFE  427



>pdb|2CDQ|A Chain A, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
 pdb|2CDQ|B Chain B, Crystal Structure Of Arabidopsis Thaliana Aspartate 
Kinase Complexed With Lysine And S-Adenosylmethionine
Length=510

 Score =   372 bits (954),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTSIVLK
Sbjct  279  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLK  338

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  339  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  398

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  399  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  456

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  457  ASKVNISFIVNEAEAEGCVQALHKSFFE  484



>gb|KFK25564.1| hypothetical protein AALP_AA8G131200 [Arabis alpina]
Length=572

 Score =   373 bits (958),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++++LTSIVLK
Sbjct  341  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+L ISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  401  RNVTMLDIASTRMLGQVGFLAKVFSIFEELEISVDVVATSEVSISLTLDPSKLWSRELIQ  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  461  Q--ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLFTKGINVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAE CVEALH +FFE
Sbjct  519  ASKVNISLIVNDAEAEGCVEALHKSFFE  546



>ref|XP_010492197.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010492198.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=546

 Score =   372 bits (955),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  396  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  456  RTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  516  ASKVNISLIVNDEEAEQCVRALHSAFFE  543



>ref|XP_010419903.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   373 bits (957),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  463  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  520

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  521  ASKVNISFIVNDAEAEGCVQALHKSFFE  548



>ref|XP_010492075.1| PREDICTED: aspartokinase 1, chloroplastic-like [Camelina sativa]
Length=574

 Score =   372 bits (956),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  462

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  463  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  520

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVND+EAE CV+ALH +FFE
Sbjct  521  ASKVNISFIVNDAEAEGCVQALHKSFFE  548



>ref|XP_008369639.1| PREDICTED: aspartokinase 1, chloroplastic [Malus domestica]
Length=565

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR+LIQ
Sbjct  395  QNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDH+ EELEKIA VNLLQHRSIISLIGNVQ SSLILEKAFHVL TN VNVQMISQG
Sbjct  455  Q--ELDHMEEELEKIAFVNLLQHRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  513  ASKVNISLIVNDSEAEKCVKALHHAFFE  540



>ref|XP_008776937.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776944.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008776949.1| PREDICTED: aspartokinase 2, chloroplastic-like isoform X2 [Phoenix 
dactylifera]
Length=567

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGTLITK RD+SE VLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTLITKARDLSETVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF VL  N VNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFSVLRKNNVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  516  ASKVNISLVVHDSEAKQCVKALHSAFFE  543



>gb|EEE58127.1| hypothetical protein OsJ_09026 [Oryza sativa Japonica Group]
Length=659

 Score =   375 bits (962),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  428  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  487

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LI+
Sbjct  488  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIK  547

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  548  Q--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  605

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  606  ASKVNISLVVHDSEAKQCVQALHSAFFE  633



>ref|XP_002871599.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47858.1| lysine-sensitive aspartate kinase [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  395  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  455  RVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDEEAEQCVRALHSAFFE  542



>gb|EEC74320.1| hypothetical protein OsI_09598 [Oryza sativa Indica Group]
Length=659

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 186/208 (89%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  428  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  487

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LI+
Sbjct  488  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIK  547

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV+EELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  548  Q--ELDHVIEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  605

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  606  ASKVNISLVVHDSEAKQCVQALHSAFFE  633



>ref|XP_010926856.1| PREDICTED: aspartokinase 2, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=567

 Score =   372 bits (954),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP+APGTLITK RD+SE +LTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPQAPGTLITKARDLSETILTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  N VNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRKNKVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV ALHSAFFE
Sbjct  516  ASKVNISLVVHDSEAKQCVRALHSAFFE  543



>ref|XP_010435684.1| PREDICTED: aspartokinase 3, chloroplastic-like [Camelina sativa]
Length=553

 Score =   371 bits (952),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  326  EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  385

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR+LIQ
Sbjct  386  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSRELIQ  445

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  446  Q--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  503

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  504  ASKVNISLIVNDDEAEHCVKALHSAFFE  531



>ref|XP_010530884.1| PREDICTED: aspartokinase 1, chloroplastic-like [Tarenaya hassleriana]
Length=572

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITK RDM+E VLTSIVLK
Sbjct  341  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTIITKARDMTETVLTSIVLK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ GFLAKVFSIFE+LGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  401  RNVTMLDIVSTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSLSLTLDPSKLWSRELIQ  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILEKAFHVL T GVNVQMISQG
Sbjct  461  Q--ELDHVVEELEKIAVVNLLRRRAIISLIGNVQHSSLILEKAFHVLRTKGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVN+ EAE+C+EALH +FFE
Sbjct  519  ASKVNISLIVNEDEAERCIEALHQSFFE  546



>ref|XP_003553303.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X1 [Glycine 
max]
 gb|KHN28578.1| Aspartokinase 1, chloroplastic [Glycine soja]
Length=562

 Score =   371 bits (952),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 208/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  396  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQ+SSLILEKAFHVL T G+ VQMISQG
Sbjct  456  Q--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQKSSLILEKAFHVLRTLGITVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL++NDSEA+QCV ALH AFFES+LS+L ++   +NGS
Sbjct  514  ASKVNISLVINDSEADQCVRALHKAFFESELSELENECIPRNGS  557



>ref|XP_003562409.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Brachypodium 
distachyon]
Length=569

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTSIVLK
Sbjct  334  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTSIVLK  393

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  394  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWSRELIQ  453

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  454  Q--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  511

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  512  ASKVNISLVVHDSEAKQCVQALHSAFFE  539



>ref|XP_006604189.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X2 [Glycine 
max]
 ref|XP_006604190.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X3 [Glycine 
max]
 ref|XP_006604191.1| PREDICTED: aspartokinase 1, chloroplastic-like isoform X4 [Glycine 
max]
Length=571

 Score =   371 bits (953),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 208/224 (93%), Gaps = 2/224 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNPKAPGTLI KTRDMS+A+LTSIVLK
Sbjct  345  EAAELAYFGAQVLHPQSMRPARESDIPVRVKNSYNPKAPGTLIAKTRDMSKALLTSIVLK  404

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  405  RNVTMLDIVSTRMLGQFGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  464

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVVNLL+ RSIISLIGNVQ+SSLILEKAFHVL T G+ VQMISQG
Sbjct  465  Q--ELDYVVEELEKIAVVNLLKTRSIISLIGNVQKSSLILEKAFHVLRTLGITVQMISQG  522

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGS  71
            ASKVNISL++NDSEA+QCV ALH AFFES+LS+L ++   +NGS
Sbjct  523  ASKVNISLVINDSEADQCVRALHKAFFESELSELENECIPRNGS  566



>gb|AAO20063.1| putative aspartate kinase [Oryza sativa Japonica Group]
 gb|ABF99917.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE60306.1| hypothetical protein OsJ_13379 [Oryza sativa Japonica Group]
Length=565

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 206/230 (90%), Gaps = 2/230 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R+LIQ
Sbjct  392  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  452  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  53
            ASKVNISL+V+DSEA+QC++ALHSAFFE+     V +   Q+  S   PN
Sbjct  510  ASKVNISLVVHDSEAKQCIQALHSAFFENGFLSEVEEEDLQHNGSPVSPN  559



>ref|XP_010496416.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
 ref|XP_010496417.1| PREDICTED: aspartokinase 3, chloroplastic [Camelina sativa]
Length=568

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR+LIQ
Sbjct  399  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSRELIQ  458

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQHRSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  459  Q--ELDHVVEELEKIAIVNLLQHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  516

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  517  ASKVNISLIVNDDEAEHCVKALHSAFFE  544



>ref|XP_010453516.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
 ref|XP_010453517.1| PREDICTED: aspartokinase 2, chloroplastic [Camelina sativa]
Length=545

 Score =   370 bits (950),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLA+VF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  395  RNVTMLDIASTRMLGQYGFLARVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  455  RTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_009413004.1| PREDICTED: aspartokinase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   364 bits (935),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 184/216 (85%), Positives = 197/216 (91%), Gaps = 10/216 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGT+ITK RDMS+ VLTSIVLK
Sbjct  149  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTVITKARDMSKVVLTSIVLK  208

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW+R+LIQ
Sbjct  209  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWNRELIQ  268

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  269  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRKNGVNVQMISQG  326

Query  202  ASK--------VNISLIVNDSEAEQCVEALHSAFFE  119
            ASK        VNISL+V+DSEA+QC+ ALHS+FF+
Sbjct  327  ASKVLSNNSGYVNISLVVHDSEAQQCISALHSSFFD  362



>ref|NP_196832.1| aspartokinase 1 [Arabidopsis thaliana]
 sp|Q9LYU8.1|AK1_ARATH RecName: Full=Aspartokinase 1, chloroplastic; AltName: Full=Aspartate 
kinase 1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86635.1| aspartate kinase [Arabidopsis thaliana]
 gb|AAL15305.1| AT5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AAN18062.1| At5g13280/T31B5_100 [Arabidopsis thaliana]
 gb|AED91874.1| aspartokinase 1 [Arabidopsis thaliana]
Length=569

 Score =   371 bits (952),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  516  ASKVNISFIVNEAEAEGCVQALHKSFFE  543



>ref|XP_002871558.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47817.1| AK-LYS1 [Arabidopsis lyrata subsp. lyrata]
Length=570

 Score =   371 bits (952),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++++LTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKSILTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  518  ASKVNISFIVNEAEAEGCVQALHKSFFE  545



>ref|NP_001051906.1| Os03g0850400 [Oryza sativa Japonica Group]
 dbj|BAF13820.1| Os03g0850400, partial [Oryza sativa Japonica Group]
Length=537

 Score =   369 bits (948),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 187/230 (81%), Positives = 206/230 (90%), Gaps = 2/230 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTSIVLK
Sbjct  304  EAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTSIVLK  363

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R+LIQ
Sbjct  364  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCRELIQ  423

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  424  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  481

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvsd*kSQNGSSSDFPN  53
            ASKVNISL+V+DSEA+QC++ALHSAFFE+     V +   Q+  S   PN
Sbjct  482  ASKVNISLVVHDSEAKQCIQALHSAFFENGFLSEVEEEDLQHNGSPVSPN  531



>ref|XP_008357847.1| PREDICTED: aspartokinase 2, chloroplastic-like [Malus domestica]
Length=566

 Score =   370 bits (950),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 190/207 (92%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQMISQG
Sbjct  460  Q--ELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND EAEQCV ALH AFF
Sbjct  518  ASKVNISLVVNDDEAEQCVRALHQAFF  544



>ref|XP_010420027.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
 ref|XP_010420028.1| PREDICTED: aspartokinase 2, chloroplastic-like [Camelina sativa]
Length=545

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLA+VF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  395  RNVTMLDIASTRMLGQYGFLARVFTKFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  455  RTNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_008379052.1| PREDICTED: aspartokinase 2, chloroplastic isoform X3 [Malus domestica]
Length=566

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 190/207 (92%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP APGT+IT  RDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREADIPVRVKNSYNPNAPGTVITHARDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV EELEKIAVVNLLQHRSIISLIGNVQRSSLILE AF VL T GVNVQMISQG
Sbjct  460  Q--ELDHVAEELEKIAVVNLLQHRSIISLIGNVQRSSLILEXAFQVLRTIGVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISL+VND EAEQCV ALH AFF
Sbjct  518  ASKVNISLVVNDDEAEQCVRALHQAFF  544



>ref|XP_006399820.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
 gb|ESQ41273.1| hypothetical protein EUTSA_v10013112mg [Eutrema salsugineum]
Length=571

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 185/208 (89%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAE CVEALH +FFE
Sbjct  518  ASKVNISLIVNDAEAEGCVEALHKSFFE  545



>ref|XP_006652023.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=561

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 198/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPA+EGGIPVRVKNSYN +APGT+ITKTRD+S+++LTSIVLK
Sbjct  328  EAAELAYFGAQVLHPQSMRPAKEGGIPVRVKNSYNRRAPGTVITKTRDLSKSILTSIVLK  387

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R+LIQ
Sbjct  388  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCRELIQ  447

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  448  Q--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  505

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QC++ALHSAFFE
Sbjct  506  ASKVNISLVVHDSEAKQCIQALHSAFFE  533



>ref|NP_196910.1| aspartokinase 2 [Arabidopsis thaliana]
 ref|NP_001078581.1| aspartokinase 2 [Arabidopsis thaliana]
 sp|O23653.2|AK2_ARATH RecName: Full=Aspartokinase 2, chloroplastic; AltName: Full=Aspartate 
kinase 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08285.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
 gb|AED91982.1| aspartokinase 2 [Arabidopsis thaliana]
 gb|AED91983.1| aspartokinase 2 [Arabidopsis thaliana]
Length=544

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  334  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  393

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  394  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  453

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQMISQG
Sbjct  454  RVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  514  ASKVNISLIVNDEEAEQCVRALHSAFFE  541



>emb|CAC06395.1| aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  334  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  393

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  394  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  453

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQMISQG
Sbjct  454  RVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  514  ASKVNISLIVNDEEAEQCVRALHSAFFE  541



>gb|AAB63104.1| lysine-sensitive aspartate kinase [Arabidopsis thaliana]
Length=544

 Score =   369 bits (946),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  334  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  393

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  394  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  453

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD++VEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F V  +NGVNVQMISQG
Sbjct  454  RVNELDNLVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVFRSNGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  514  ASKVNISLIVNDEEAEQCVRALHSAFFE  541



>ref|XP_009121776.1| PREDICTED: aspartokinase 1, chloroplastic [Brassica rapa]
Length=571

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSEVSLSLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CVEALH +FFE
Sbjct  518  ASKVNISLIVNDDEAEGCVEALHKSFFE  545



>ref|XP_002466095.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
 gb|EER93093.1| hypothetical protein SORBIDRAFT_01g001140 [Sorghum bicolor]
Length=566

 Score =   369 bits (947),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  393  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEK +VV+LLQ RSIISLIGNVQRSSL+LEKAF+VL  NGVNVQMISQG
Sbjct  453  Q--ELDHVVEELEKFSVVHLLQRRSIISLIGNVQRSSLVLEKAFNVLRRNGVNVQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  511  ASKVNISLVVNDSEAKQCVQALHSAFFE  538



>emb|CAA67376.1| aspartate kinase [Arabidopsis thaliana]
Length=569

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 197/208 (95%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVK+SYNPKAPGT+ITKTRDM++++LTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKSSYNPKAPGTIITKTRDMTKSILTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  515

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVN++EAE CV+ALH +FFE
Sbjct  516  ASKVNISFIVNEAEAEGCVQALHKSFFE  543



>ref|XP_010682653.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=565

 Score =   369 bits (946),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYNPKAPGTLI +TRDMSE +LTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNPKAPGTLINRTRDMSEVLLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            R+VTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  396  RSVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD VVEEL+ IAVVNLLQ+RSIISLIGNV  SSLILEKAFHVL TN VNVQMISQG
Sbjct  456  Q--ELDRVVEELQNIAVVNLLQNRSIISLIGNVHYSSLILEKAFHVLRTNNVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE+CV+ALH AFFE
Sbjct  514  ASKVNISLIVNDDEAEKCVKALHYAFFE  541



>ref|XP_006408563.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50016.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=549

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  328  EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  387

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  S++LIQ
Sbjct  388  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSKELIQ  447

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQ RSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  448  Q--ELDHVVEELEKIAIVNLLQQRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  505

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  506  ASKVNISLIVNDDEAEHCVKALHSAFFE  533



>gb|ABO09875.1| monofunctional aspartate kinase 1 [Zea mays]
Length=581

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTSIVLK
Sbjct  348  EAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTSIVLK  407

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  408  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  467

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEEL+K AVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  468  Q--ELDHVVEELKKFAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  525

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  526  ASKVNISLVVNDSEAKQCVQALHSAFFE  553



>ref|NP_001288496.1| uncharacterized protein LOC103644325 [Zea mays]
 gb|ACR34218.1| unknown [Zea mays]
 tpg|DAA52504.1| TPA: aspartokinase [Zea mays]
Length=568

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 183/208 (88%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK+RDMS+++LTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKSRDMSKSILTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  395  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEEL+K AVV+LLQ RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  455  Q--ELDHVVEELKKFAVVHLLQRRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  513  ASKVNISLVVNDSEAKQCVQALHSAFFE  540



>ref|XP_006408564.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408565.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 ref|XP_006408566.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 dbj|BAJ33777.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50017.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50018.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
 gb|ESQ50019.1| hypothetical protein EUTSA_v10020441mg [Eutrema salsugineum]
Length=552

 Score =   367 bits (941),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  S++LIQ
Sbjct  391  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSKELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLLQ RSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  451  Q--ELDHVVEELEKIAIVNLLQQRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  508

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  509  ASKVNISLIVNDDEAEHCVKALHSAFFE  536



>ref|XP_010234251.1| PREDICTED: aspartokinase 1, chloroplastic isoform X1 [Brachypodium 
distachyon]
Length=570

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 185/209 (89%), Positives = 198/209 (95%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTSIVLK
Sbjct  334  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTSIVLK  393

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  394  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWSRELIQ  453

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  454  Q--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  511

Query  202  ASK-VNISLIVNDSEAEQCVEALHSAFFE  119
            ASK VNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  512  ASKQVNISLVVHDSEAKQCVQALHSAFFE  540



>ref|XP_004956005.1| PREDICTED: aspartokinase 2, chloroplastic-like [Setaria italica]
Length=568

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYN +APGTLITK RDMS+++LTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNRQAPGTLITKARDMSKSILTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS +L+Q
Sbjct  393  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSCELVQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  453  QKIELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  513  ASKVNISLVVHDSEAKQCVQALHSAFFE  540



>ref|XP_009411806.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009411807.1| PREDICTED: aspartokinase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=579

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 196/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFG+QVLHPQSM PAREG IPVRVKNSYNP+APGT+I K RDMS+AVLTSIVLK
Sbjct  341  EAAELAYFGSQVLHPQSMWPAREGDIPVRVKNSYNPQAPGTVIDKVRDMSKAVLTSIVLK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  401  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDSVATSEVSVSLTLDPSKLWSRELIQ  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEEL+KIAVVNLLQHRSIISL+GNVQRSSLILEKAF+VL  +GVNVQMISQG
Sbjct  461  Q--ELDHVVEELKKIAVVNLLQHRSIISLVGNVQRSSLILEKAFNVLRKSGVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QC+ ALHSAFFE
Sbjct  519  ASKVNISLVVHDSEAKQCIRALHSAFFE  546



>ref|XP_009359889.1| PREDICTED: aspartokinase 1, chloroplastic-like [Pyrus x bretschneideri]
Length=566

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 202/230 (88%), Gaps = 3/230 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNPKAPGTLITKTRDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPQSMRPARDAEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR+LIQ
Sbjct  395  QNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDH+ EELEKIA VNLLQHRSIISLIGNVQ SSLILEK FHVL TN VNVQMISQG
Sbjct  455  Q--ELDHMEEELEKIAFVNLLQHRSIISLIGNVQYSSLILEKVFHVLRTNQVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFEsdlsklvs-d*kSQNGSSSDFP  56
            ASKVNISLIVNDSEAE+CV+ALH AFFES     +  +    NGS+S  P
Sbjct  513  ASKVNISLIVNDSEAEKCVKALHHAFFESGDLSELVPEFGFGNGSASPLP  562



>ref|XP_008669985.1| PREDICTED: aspartokinase 2, chloroplastic [Zea mays]
 gb|ACF79023.1| unknown [Zea mays]
 tpg|DAA39408.1| TPA: aspartokinase [Zea mays]
Length=565

 Score =   366 bits (939),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 195/208 (94%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  330  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  389

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS +L+Q
Sbjct  390  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSCELVQ  449

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              +ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  450  HKNELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QCV+ALHSAFFE
Sbjct  510  ASKVNISLVVHDSEAKQCVQALHSAFFE  537



>ref|NP_186851.1| aspartokinase 3 [Arabidopsis thaliana]
 sp|Q9S702.1|AK3_ARATH RecName: Full=Aspartokinase 3, chloroplastic; AltName: Full=Aspartate 
kinase 3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF03452.1|AC010797_28 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAF14833.1|AC011664_15 putative aspartate kinase [Arabidopsis thaliana]
 gb|AAM65905.1| putative aspartate kinase [Arabidopsis thaliana]
 dbj|BAE98365.1| putative aspartate kinase [Arabidopsis thaliana]
 gb|AEE73750.1| aspartokinase 3 [Arabidopsis thaliana]
Length=559

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 182/208 (88%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR+LIQ
Sbjct  395  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELD VVEELEKIAVVNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  455  H--ELDQVVEELEKIAVVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  513  ASKVNISLIVNDDEAEHCVKALHSAFFE  540



>gb|ABQ28733.1| monofunctional aspartate kinase 2 [Zea mays]
Length=527

 Score =   364 bits (934),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  292  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  351

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS +L+Q
Sbjct  352  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSCELVQ  411

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              +ELD V+EELEKIAVV+LLQ+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQG
Sbjct  412  HKNELDDVIEELEKIAVVHLLQNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQG  471

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+V+DSEA+QC +ALHSAFFE
Sbjct  472  ASKVNISLVVHDSEAKQCFQALHSAFFE  499



>ref|XP_008222377.1| PREDICTED: aspartokinase 1, chloroplastic [Prunus mume]
Length=570

 Score =   365 bits (936),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/208 (88%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR+LIQ
Sbjct  400  QNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAFHVL TN VNVQMISQG
Sbjct  460  Q--ELDKMEEELEKIAFVNLLQRRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  518  ASKVNISLIVNDSEAEKCVKALHHAFFE  545



>ref|XP_004981039.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=565

 Score =   364 bits (934),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 181/208 (87%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYN  APGT+ITK RDMS+++LTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNRHAPGTVITKARDMSKSILTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  392  SNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEK AVV+LLQ RSIISL+GNVQRSSLILEKAF+VL   GVNVQMISQG
Sbjct  452  Q--ELDHVVEELEKFAVVHLLQRRSIISLVGNVQRSSLILEKAFNVLRRQGVNVQMISQG  509

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND EA+QCV+ALHSAFFE
Sbjct  510  ASKVNISLVVNDCEAKQCVQALHSAFFE  537



>dbj|BAA95630.1| aspartate kinase [Oryza sativa]
Length=354

 Score =   356 bits (913),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  134  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  193

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  194  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  253

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVE LEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQMISQG
Sbjct  254  Q--ELDHVVEGLEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQMISQG  311

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  312  ASKVNMSLIVHDSEAKQCIKALHQAFFE  339



>gb|EMT10312.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=748

 Score =   367 bits (942),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 186/213 (87%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTSIVLK
Sbjct  393  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTSIVLK  452

Query  562  RNVTMLDIASTRMLGQYGFL-----AKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  398
             N+TMLDI STRMLGQYGFL     AKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS
Sbjct  453  SNITMLDIVSTRMLGQYGFLAKVFSAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWS  512

Query  397  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  218
            R+LIQQ  ELD+VVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQ
Sbjct  513  RELIQQ--ELDNVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQ  570

Query  217  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            MISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  571  MISQGASKVNISLVVNDSEAKQCVQALHSAFFE  603



>gb|EMS63387.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=814

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/213 (88%), Positives = 198/213 (93%), Gaps = 7/213 (3%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYN  APGT+ITKTRDM +++LTSIVLK
Sbjct  247  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSILTSIVLK  306

Query  562  RNVTMLDIASTRMLGQYGFL-----AKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWS  398
             N+TMLDI STRMLGQYGFL     AKVFSIFEDLGISVD VATSEVSISLTLDPSKLWS
Sbjct  307  SNITMLDIVSTRMLGQYGFLAKVFSAKVFSIFEDLGISVDSVATSEVSISLTLDPSKLWS  366

Query  397  RDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQ  218
            R+LIQQ  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEKAF+VL  NGVNVQ
Sbjct  367  RELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQ  424

Query  217  MISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            MISQGASKVNISL+VNDSEA+QCV+ALHSAFFE
Sbjct  425  MISQGASKVNISLVVNDSEAKQCVQALHSAFFE  457


 Score =   119 bits (299),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 79/122 (65%), Gaps = 27/122 (22%)
 Frame = -2

Query  742  EAAELAYFGAQ----------------------VLHPQSMRPAREGGIPVRVKNSYNPKA  629
            EAAE+AYFGAQ                      +L        REGG+PVRVKNSYN  A
Sbjct  693  EAAEVAYFGAQGVGCVGRDLYSTDNFLLYVFLELLVLLGDLATREGGMPVRVKNSYNCHA  752

Query  628  PGTLITKTRDMSEAVLTSIVLKRNVTMLDIASTRMLGQYGFL-----AKVFSIFEDLGIS  464
            PGT+ITKTRDM +++LT+IVLK N+ MLD+ +TRMLGQYG L     AKVFSIFE LGIS
Sbjct  753  PGTVITKTRDMRKSILTNIVLKSNIAMLDMVNTRMLGQYGVLAKVSSAKVFSIFEHLGIS  812

Query  463  VD  458
            V+
Sbjct  813  VE  814



>gb|EEE55936.1| hypothetical protein OsJ_04629 [Oryza sativa Japonica Group]
Length=552

 Score =   360 bits (925),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/216 (83%), Positives = 196/216 (91%), Gaps = 8/216 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  322  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  381

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  382  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  441

Query  382  QAS--------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGV  227
            QAS        ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GV
Sbjct  442  QASAPIYMQNQELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGV  501

Query  226  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            NVQMISQGASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  502  NVQMISQGASKVNMSLIVHDSEAKQCIKALHQAFFE  537



>ref|NP_001045271.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAD88162.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAD88202.1| putative aspartate kinase [Oryza sativa Japonica Group]
 dbj|BAF07185.1| Os01g0927900 [Oryza sativa Japonica Group]
 dbj|BAG93334.1| unnamed protein product [Oryza sativa Japonica Group]
Length=570

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  350  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  409

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  410  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  469

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQMISQG
Sbjct  470  Q--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQMISQG  527

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  528  ASKVNMSLIVHDSEAKQCIKALHQAFFE  555



>gb|EEC72085.1| hypothetical protein OsI_05030 [Oryza sativa Indica Group]
Length=570

 Score =   360 bits (923),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  350  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  409

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  410  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  469

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  +GVNVQMISQG
Sbjct  470  Q--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSGVNVQMISQG  527

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  528  ASKVNMSLIVHDSEAKQCIKALHQAFFE  555



>ref|XP_003564987.1| PREDICTED: aspartokinase 2, chloroplastic-like [Brachypodium 
distachyon]
Length=567

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 195/208 (94%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTS+VLK
Sbjct  337  EASELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKRREMDKVVLTSLVLK  396

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  397  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  456

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAFHVL  +GVNVQMISQG
Sbjct  457  Q--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFHVLRKSGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  515  ASKVNMSLIVHDSEAKQCMKALHQAFFE  542



>ref|XP_002882151.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58410.1| hypothetical protein ARALYDRAFT_896038 [Arabidopsis lyrata subsp. 
lyrata]
Length=562

 Score =   359 bits (921),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/208 (86%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAY GAQVLHP SMRPA+EG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYIGAQVLHPLSMRPAQEGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE LGISVDVVATSEVSISLTLDPSK  SR+LIQ
Sbjct  395  RNVTMLDITSTRMLGQYGFLAKVFSTFEKLGISVDVVATSEVSISLTLDPSKFCSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELD VVEELEKIA+VNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  455  H--ELDQVVEELEKIAIVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  513  ASKVNISLIVNDDEAEHCVKALHSAFFE  540



>emb|CDM85877.1| unnamed protein product [Triticum aestivum]
Length=563

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 192/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  396  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQMISQG
Sbjct  456  Q--ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QCVEALH AFFE
Sbjct  514  ASKVNMSLIVHDSEAKQCVEALHQAFFE  541



>ref|XP_006646639.1| PREDICTED: aspartokinase 1, chloroplastic-like [Oryza brachyantha]
Length=560

 Score =   358 bits (919),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSRDLIQ
Sbjct  400  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRDLIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ R+IISLIGNV+RSSLILEKAF VL  + VNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVHLLQQRAIISLIGNVRRSSLILEKAFQVLRKSRVNVQMISQG  517

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+QC++ALH AFFE
Sbjct  518  ASKVNMSLIVHDSEAKQCIKALHQAFFE  545



>gb|ABK24292.1| unknown [Picea sitchensis]
Length=568

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 193/208 (93%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP+APGTLIT+TRDMS+AVLTSIVLK
Sbjct  346  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPQAPGTLITRTRDMSKAVLTSIVLK  405

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLA+VFSIFE+LGISVDVVATSEVSISLTLDPSK+W R+LI+
Sbjct  406  RNVTMLDIVSTRMLGQFGFLARVFSIFEELGISVDVVATSEVSISLTLDPSKMWERELIK  465

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD +VEELEK+AVV LLQ+RSIISLIGN+Q SSLILEK F V  T GVNVQMISQG
Sbjct  466  Q--ELDRMVEELEKVAVVKLLQNRSIISLIGNIQYSSLILEKVFCVFRTLGVNVQMISQG  523

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVN+SEAE CV+ALHS FF+
Sbjct  524  ASKVNISLIVNESEAESCVKALHSTFFD  551



>ref|XP_004310242.1| PREDICTED: aspartokinase 1, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=561

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/208 (87%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITK RDM++AVLTSIVLK
Sbjct  331  EAAELAYFGAQVLHPQSMRPARDGDIPVRVKNSYNPKAPGTLITKARDMTKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +N+T+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSK WSR+LIQ
Sbjct  391  QNITLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKFWSRELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAF VL TN VNVQMISQG
Sbjct  451  Q--ELDKMEEELEKIAFVNLLQQRSIISLIGNVQYSSLILEKAFQVLRTNQVNVQMISQG  508

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE CV+ALH AFFE
Sbjct  509  ASKVNISLIVNDSEAEICVKALHHAFFE  536



>dbj|BAJ99203.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 191/208 (92%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  396  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  455

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQMISQG
Sbjct  456  Q--ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQMISQG  513

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+ CVEALH AFFE
Sbjct  514  ASKVNMSLIVHDSEAKLCVEALHQAFFE  541



>gb|KEH23492.1| monofunctional aspartokinase [Medicago truncatula]
Length=450

 Score =   348 bits (892),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTSIVLK
Sbjct  223  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTSIVLK  282

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  283  RNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSRELIQ  342

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKI+VVNLL++RSIISLIGNVQ SS ILEKAF VL + GVNVQMISQG
Sbjct  343  Q--ELDYVVEELEKISVVNLLKNRSIISLIGNVQMSSKILEKAFQVLGSLGVNVQMISQG  400

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VN+ EAEQ V  LH  FFE
Sbjct  401  ASKVNISLVVNNDEAEQSVRTLHKIFFE  428



>emb|CDY06621.1| BnaC02g13450D [Brassica napus]
Length=576

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 4/212 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP +PGTLIT++RDMS+AVLTSIVLK
Sbjct  331  EAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPNSPGTLITRSRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S++LIQ
Sbjct  391  RNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSKELIQ  450

Query  382  QAS---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGVNVQM  215
            QAS   E++HVVEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+NVQM
Sbjct  451  QASFIWEINHVVEELEKIATVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGINVQM  510

Query  214  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  542



>emb|CDY20797.1| BnaA02g09370D [Brassica napus]
Length=578

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 189/212 (89%), Gaps = 4/212 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP APGTLIT++RDMS+AVLTSIVLK
Sbjct  331  EAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPTAPGTLITRSRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S++LIQ
Sbjct  391  RNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSKELIQ  450

Query  382  QAS---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGVNVQM  215
            QAS   E++HVVEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+N+QM
Sbjct  451  QASFIWEINHVVEELEKIATVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGINIQM  510

Query  214  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ISQGASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  511  ISQGASKVNISLIVNDDEAEHCVKALHSAFFE  542



>gb|AES80708.2| monofunctional aspartokinase [Medicago truncatula]
Length=557

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 177/208 (85%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTSIVLK
Sbjct  330  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTSIVLK  389

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  390  RNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSRELIQ  449

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKI+VVNLL++RSIISLIGNVQ SS ILEKAF VL + GVNVQMISQG
Sbjct  450  Q--ELDYVVEELEKISVVNLLKNRSIISLIGNVQMSSKILEKAFQVLGSLGVNVQMISQG  507

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VN+ EAEQ V  LH  FFE
Sbjct  508  ASKVNISLVVNNDEAEQSVRTLHKIFFE  535



>ref|XP_006286781.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
 gb|EOA19679.1| hypothetical protein CARUB_v10003334mg [Capsella rubella]
Length=545

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/208 (86%), Positives = 194/208 (93%), Gaps = 0/208 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+LIQ
Sbjct  395  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +ELD+++EELEKIAVV LLQ RSIISLIGNV++SS ILEK F VL +NGVNVQMISQG
Sbjct  455  RTNELDNLLEELEKIAVVKLLQRRSIISLIGNVKKSSQILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAEQCV ALHSAFFE
Sbjct  515  ASKVNISLIVNDEEAEQCVRALHSAFFE  542



>ref|XP_004971149.1| PREDICTED: aspartokinase 1, chloroplastic-like [Setaria italica]
Length=554

 Score =   347 bits (891),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 190/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK R+M + VLTSIVLK
Sbjct  333  EATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQREMDKVVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLA+VFSIFEDLGISVD VATSEVSIS++LDPSK+WSR+LIQ
Sbjct  393  SNVTMLDIVSTRMLGQFGFLARVFSIFEDLGISVDCVATSEVSISVSLDPSKIWSRELIQ  452

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIA+V+LLQ R+IISLIGNV+RSSLILEK F VL   GVN+QMISQG
Sbjct  453  Q--ELDNVVEELEKIAIVHLLQQRAIISLIGNVKRSSLILEKTFQVLRKCGVNIQMISQG  510

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+ C++ALH AFFE
Sbjct  511  ASKVNMSLIVHDSEAKACIKALHQAFFE  538



>ref|XP_011086875.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
 ref|XP_011086876.1| PREDICTED: aspartokinase 2, chloroplastic [Sesamum indicum]
Length=570

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHP SMRPA +  IPVRVKNSYNPKAPGTLIT+ RDM++A+LTSIVLK
Sbjct  341  EATELAYFGAQVLHPLSMRPAMDASIPVRVKNSYNPKAPGTLITRNRDMTKALLTSIVLK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +N+TMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK+WSR+LI+
Sbjct  401  QNITMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKIWSRELIK  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHV+EEL KIAVV LL HRSIISLIGN+Q SSLILEKAF V     VNVQMISQG
Sbjct  461  Q--ELDHVIEELGKIAVVKLLPHRSIISLIGNIQYSSLILEKAFSVFGRINVNVQMISQG  518

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIVNDSEAEQC++ALH+AFFE
Sbjct  519  ASKVNMSLIVNDSEAEQCIKALHNAFFE  546



>ref|XP_009127042.1| PREDICTED: aspartokinase 3, chloroplastic-like [Brassica rapa]
Length=573

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 173/209 (83%), Positives = 187/209 (89%), Gaps = 3/209 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAA+LAYFGAQVLHP SMRPA EG IPVRVKNSYNP APGTLIT++RDMS+AVLTSIVLK
Sbjct  331  EAAQLAYFGAQVLHPLSMRPASEGNIPVRVKNSYNPTAPGTLITRSRDMSKAVLTSIVLK  390

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI S RMLGQYGFL+KV S FE +GISVDVVATSEVS+SLTLDPSK  S++LIQ
Sbjct  391  RNVTMLDITSNRMLGQYGFLSKVLSTFEKMGISVDVVATSEVSVSLTLDPSKFCSKELIQ  450

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQR-SSLILEKAFHVLLTNGVNVQMISQ  206
            Q  E++H+VEELEKIA VNLLQHRSIISLIGN QR SS ILEK F VL TNG+NVQMISQ
Sbjct  451  Q--EINHMVEELEKIASVNLLQHRSIISLIGNFQRSSSFILEKGFRVLRTNGINVQMISQ  508

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFFE  119
            GASKVNISLIVND EAE CV+ALHSAFFE
Sbjct  509  GASKVNISLIVNDDEAEHCVKALHSAFFE  537



>gb|ACR35433.1| unknown [Zea mays]
Length=380

 Score =   339 bits (869),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 187/208 (90%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLIT+ RDM + VLTSIVLK
Sbjct  160  EATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITRQRDMDKVVLTSIVLK  219

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR+LIQ
Sbjct  220  SNVTMLDIVSTRMLGQYGFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSRELIQ  279

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+V LLQ R+IISLIGNV++SSLILEK   VL  +GVNVQMISQG
Sbjct  280  Q--ELDHVVEELEKIAIVRLLQQRAIISLIGNVEQSSLILEKTGRVLRKSGVNVQMISQG  337

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DS+A+  VEALH AFFE
Sbjct  338  ASKVNMSLIVHDSDAKALVEALHQAFFE  365



>ref|XP_002459021.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
 gb|EES04141.1| hypothetical protein SORBIDRAFT_03g044650 [Sorghum bicolor]
Length=555

 Score =   342 bits (878),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/208 (82%), Positives = 189/208 (91%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLITK RDM + VLTSIVLK
Sbjct  335  EATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLITKQRDMDKVVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLA+VF+IFEDLGISVD VATSEVS+S++LDPSK+WSR+LIQ
Sbjct  395  SNVTMLDIVSTRMLGQYGFLARVFAIFEDLGISVDCVATSEVSVSVSLDPSKIWSRELIQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD+VVEELEKIA+V+LLQ R+IISLIGNV++ SLILEK  HVL  +GVNVQMISQG
Sbjct  455  Q--ELDNVVEELEKIAIVHLLQQRAIISLIGNVRQMSLILEKTGHVLRKSGVNVQMISQG  512

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+  VEALH AFF+
Sbjct  513  ASKVNMSLIVHDSEAKALVEALHQAFFQ  540



>gb|KHG14818.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=536

 Score =   341 bits (874),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 174/208 (84%), Positives = 179/208 (86%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSE                   
Sbjct  403  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSE-------------------  443

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQG
Sbjct  444  ---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQG  500

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIV+D+EAEQCV ALHS FFE
Sbjct  501  ASKVNISLIVHDNEAEQCVRALHSTFFE  528



>gb|KJB33203.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=543

 Score =   341 bits (875),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 176/184 (96%), Gaps = 2/184 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  458  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  515

Query  202  ASKV  191
            ASKV
Sbjct  516  ASKV  519



>gb|EYU28463.1| hypothetical protein MIMGU_mgv1a005583mg [Erythranthe guttata]
Length=478

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 186/208 (89%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELA+FGAQVLHPQSMRPA +G IPVRVKNSYNPKAPGTLIT  RDM++A+LTSIVLK
Sbjct  249  EAAELAFFGAQVLHPQSMRPAMDGNIPVRVKNSYNPKAPGTLITGNRDMTKALLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NV MLDI STRMLGQ+GFLAKVF+IFEDL ISVDVVATSEVSISLTLDPSK+WSR+LI+
Sbjct  309  QNVLMLDIVSTRMLGQFGFLAKVFAIFEDLDISVDVVATSEVSISLTLDPSKIWSRELIK  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELD V EEL KIA+V LL HRSIISLIGN+Q SSLILEKAF+V     VNVQMISQG
Sbjct  369  Q--ELDRVAEELGKIAIVKLLPHRSIISLIGNIQYSSLILEKAFNVFGKINVNVQMISQG  426

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SL+VNDSEAE+CV+ALH  FFE
Sbjct  427  ASKVNMSLVVNDSEAEECVKALHYDFFE  454



>gb|KCW55774.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=539

 Score =   339 bits (869),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/184 (92%), Positives = 176/184 (96%), Gaps = 2/184 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK F+VL TNGVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEKVFNVLRTNGVNVQMISQG  517

Query  202  ASKV  191
            ASKV
Sbjct  518  ASKV  521



>gb|KHG00746.1| Aspartokinase 3, chloroplastic -like protein [Gossypium arboreum]
Length=517

 Score =   338 bits (867),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 172/208 (83%), Positives = 179/208 (86%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  316  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  375

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSE                   
Sbjct  376  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSE-------------------  416

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF+VL TNGVNVQMISQG
Sbjct  417  ---ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFNVLRTNGVNVQMISQG  473

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISL+VND+EAE+CV ALHS+FFE
Sbjct  474  ASKVNISLVVNDNEAEECVRALHSSFFE  501



>ref|XP_002992028.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
 gb|EFJ06877.1| hypothetical protein SELMODRAFT_162121 [Selaginella moellendorffii]
Length=468

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 181/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP  PGTLITK RDMSE +LTSIVLK
Sbjct  249  EATELAYFGAQVLHPQSMRPAREANIPVRVKNSYNPHVPGTLITKKRDMSETLLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RN+TMLDI STRMLGQ GFLAKVFS FE+LGISVDVVATSEVSISLTLDP K+WSRDLIQ
Sbjct  309  RNITMLDIVSTRMLGQVGFLAKVFSTFEELGISVDVVATSEVSISLTLDPIKIWSRDLIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              +ELD++V +L KIA V LLQ RSIISLIGNV+RSSL+L+K F V    GV VQMISQG
Sbjct  369  --TELDNMVTKLRKIAKVKLLQKRSIISLIGNVERSSLVLKKVFSVFEELGVKVQMISQG  426

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE+CV  LHSAFFE
Sbjct  427  ASKVNISLIVNDSEAERCVRELHSAFFE  454



>ref|XP_002964498.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
 gb|EFJ34831.1| hypothetical protein SELMODRAFT_142417 [Selaginella moellendorffii]
Length=468

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 181/208 (87%), Gaps = 2/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPARE  IPVRVKNSYNP  PGTLITK RDMSE +LTSIVLK
Sbjct  249  EATELAYFGAQVLHPQSMRPAREANIPVRVKNSYNPHVPGTLITKKRDMSETLLTSIVLK  308

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RN+TMLDI STRMLGQ GFLAKVFS FE+LGISVDVVATSEVSISLTLDP K+WSRDLIQ
Sbjct  309  RNITMLDIVSTRMLGQVGFLAKVFSTFEELGISVDVVATSEVSISLTLDPIKIWSRDLIQ  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              +ELD++V +L KIA V LLQ RSIISLIGNV+RSSL+L+K F V    G+ VQMISQG
Sbjct  369  --TELDNMVTKLRKIAKVKLLQKRSIISLIGNVERSSLVLKKVFSVFEELGIKVQMISQG  426

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE+CV  LHSAFFE
Sbjct  427  ASKVNISLIVNDSEAERCVRELHSAFFE  454



>ref|XP_010656844.1| PREDICTED: aspartokinase 1, chloroplastic isoform X2 [Vitis vinifera]
Length=534

 Score =   336 bits (861),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 177/186 (95%), Gaps = 2/186 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQ+MRPARE  IPVRVKNSYNP+APGTLI KTRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQAMRPARESDIPVRVKNSYNPEAPGTLINKTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGN+QRSSLILEKAF+VL T GVNVQMISQG
Sbjct  460  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNIQRSSLILEKAFNVLRTIGVNVQMISQG  517

Query  202  ASKVNI  185
            ASK+ I
Sbjct  518  ASKILI  523



>ref|XP_003624490.1| Aspartokinase [Medicago truncatula]
Length=602

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 177/239 (74%), Positives = 189/239 (79%), Gaps = 31/239 (13%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKA GTLITKTRDMS+A+LTSIVLK
Sbjct  342  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKASGTLITKTRDMSKALLTSIVLK  401

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVT LDI STRMLG  GFLAKVFSIFEDLGIS+D+VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  402  RNVTTLDIVSTRMLGTVGFLAKVFSIFEDLGISIDMVATSEVSISLTLDPSKLWSRELIQ  461

Query  382  QA-------------------------------SELDHVVEELEKIAVVNLLQHRSIISL  296
            Q                                 ELD+VVEELEKI+VVNLL++RSIISL
Sbjct  462  QGQDIESRKVGYRVQGSAVIYGVQRHRCFFSETKELDYVVEELEKISVVNLLKNRSIISL  521

Query  295  IGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            IGNVQ SS ILEKAF VL + GVNVQMISQGASKVNISL+VN+ EAEQ V  LH  FFE
Sbjct  522  IGNVQMSSKILEKAFQVLGSLGVNVQMISQGASKVNISLVVNNDEAEQSVRTLHKIFFE  580



>ref|XP_006287431.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
 gb|EOA20329.1| hypothetical protein CARUB_v10000635mg [Capsella rubella]
Length=548

 Score =   335 bits (859),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 167/185 (90%), Positives = 176/185 (95%), Gaps = 2/185 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ +LTSIVLK
Sbjct  341  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTILTSIVLK  400

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFE+LGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  401  RNVTMLDIASTRMLGQVGFLAKVFSIFEELGISVDVVATSEVSISLTLDPSKLWSRELIQ  460

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLL+ R+IISLIGNVQ SSLILE+AFHVL T GVNVQMISQG
Sbjct  461  Q--ELDHVVEELEKIAVVNLLKGRAIISLIGNVQHSSLILERAFHVLYTKGVNVQMISQG  518

Query  202  ASKVN  188
            ASKVN
Sbjct  519  ASKVN  523



>gb|KEH25642.1| monofunctional aspartokinase [Medicago truncatula]
Length=515

 Score =   333 bits (855),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 169/185 (91%), Positives = 175/185 (95%), Gaps = 2/185 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLITK RDMS+AVLTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITKERDMSKAVLTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFSIFEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  392  RNVTMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSVSLTLDPSKLWSRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIAVVNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GV VQMISQG
Sbjct  452  Q--ELDHVVEELEKIAVVNLLQNRSIISLIGNVQQSSLILEKAFRVLRTLGVTVQMISQG  509

Query  202  ASKVN  188
            ASKV+
Sbjct  510  ASKVS  514



>ref|XP_006300265.1| hypothetical protein CARUB_v100158420mg, partial [Capsella rubella]
 gb|EOA33163.1| hypothetical protein CARUB_v100158420mg, partial [Capsella rubella]
Length=209

 Score =   322 bits (826),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 2/183 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  29   EAAELAYFGAQVLHPLSMRPAREGNIPVRVKNSYNPTAPGTVITRSRDMSKAVLTSIVLK  88

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FE+LGISVDVVATSEVSISLTLDPSK  SR+LIQ
Sbjct  89   RNVTMLDITSTRMLGQYGFLAKVFSTFENLGISVDVVATSEVSISLTLDPSKFCSRELIQ  148

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            Q  ELDHVVEELEKIA+VNLL+HRSIISLIGNVQRSS ILEK F VL TNG+NVQMISQG
Sbjct  149  Q--ELDHVVEELEKIAIVNLLRHRSIISLIGNVQRSSFILEKGFRVLRTNGINVQMISQG  206

Query  202  ASK  194
            ASK
Sbjct  207  ASK  209



>ref|XP_006399914.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
 gb|ESQ41367.1| hypothetical protein EUTSA_v10013157mg [Eutrema salsugineum]
Length=554

 Score =   332 bits (851),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/187 (86%), Positives = 175/187 (94%), Gaps = 0/187 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAR+G IPVRVKNSYNP APGT+IT++RDMS+AVLTSIVLK
Sbjct  335  EAAELAYFGAQVLHPLSMRPARDGDIPVRVKNSYNPNAPGTVITRSRDMSKAVLTSIVLK  394

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQYGFLAKVF+ FEDLGISVDVVATSEVSISLTLDP+KLW R+++Q
Sbjct  395  RNVTMLDIASTRMLGQYGFLAKVFTTFEDLGISVDVVATSEVSISLTLDPAKLWGREIVQ  454

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            +A+ELDHVVEELEKIAVV LLQ RSIISLIGNVQ+SSLILEK F VL +NGVNVQMISQG
Sbjct  455  RANELDHVVEELEKIAVVKLLQRRSIISLIGNVQKSSLILEKVFQVLRSNGVNVQMISQG  514

Query  202  ASKVNIS  182
            ASKV I 
Sbjct  515  ASKVEIC  521



>emb|CDX85659.1| BnaA02g01540D [Brassica napus]
Length=554

 Score =   328 bits (841),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 176/208 (85%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE                   
Sbjct  403  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE-------------------  443

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  444  ---ELDHVVEELEKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  500

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAE CVEALH +FFE
Sbjct  501  ASKVNISLIVNDAEAEGCVEALHKSFFE  528



>emb|CDX91135.1| BnaC02g04620D [Brassica napus]
Length=555

 Score =   326 bits (836),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 176/208 (85%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  344  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  403

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE                   
Sbjct  404  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE-------------------  444

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEEL+KIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  445  ---ELDHVVEELKKIAVVNLAKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  501

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND+EAE CVEALH +FFE
Sbjct  502  ASKVNISLIVNDAEAEGCVEALHKSFFE  529



>emb|CDY09781.1| BnaC09g43800D [Brassica napus]
Length=550

 Score =   324 bits (831),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 174/208 (84%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  339  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  398

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE                   
Sbjct  399  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE-------------------  439

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  440  ---ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  496

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CVEALH +FFE
Sbjct  497  ASKVNISLIVNDDEAEGCVEALHKSFFE  524



>emb|CDX69652.1| BnaA10g20010D [Brassica napus]
Length=551

 Score =   324 bits (830),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 174/208 (84%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGT+ITKTRDM++ VLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGEIPVRVKNSYNPKAPGTIITKTRDMTKTVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDIASTRMLGQ GFLAKVFSIFEDL ISVDVVATSE                   
Sbjct  400  RNVTMLDIASTRMLGQVGFLAKVFSIFEDLEISVDVVATSE-------------------  440

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIAVVNL + R+IISLIGNVQ SSLILE+AFHVL T G+NVQMISQG
Sbjct  441  ---ELDHVVEELEKIAVVNLSKGRAIISLIGNVQHSSLILERAFHVLWTKGINVQMISQG  497

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVND EAE CVEALH +FFE
Sbjct  498  ASKVNISLIVNDDEAEGCVEALHKSFFE  525



>ref|XP_007223118.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
 gb|EMJ24317.1| hypothetical protein PRUPE_ppa003770mg [Prunus persica]
Length=550

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 174/208 (84%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAR+G IPVRVKNSYNPKAPGTLITKTRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPARDGEIPVRVKNSYNPKAPGTLITKTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT+LDI STRMLGQ GFLAKVFS FEDLGISVDVVATSE                   
Sbjct  400  QNVTLLDIVSTRMLGQVGFLAKVFSTFEDLGISVDVVATSE-------------------  440

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELD + EELEKIA VNLLQ RSIISLIGNVQ SSLILEKAFHVL TN VNVQMISQG
Sbjct  441  ---ELDKMEEELEKIAFVNLLQRRSIISLIGNVQYSSLILEKAFHVLRTNQVNVQMISQG  497

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNISLIVNDSEAE+CV+ALH AFFE
Sbjct  498  ASKVNISLIVNDSEAEKCVKALHHAFFE  525



>ref|NP_001146022.1| uncharacterized protein LOC100279553 [Zea mays]
 gb|ACL53049.1| unknown [Zea mays]
Length=204

 Score =   307 bits (786),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 171/191 (90%), Gaps = 2/191 (1%)
 Frame = -2

Query  691  MRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIASTRMLGQY  512
            MRPAREG IPVRVKNSYNPKAPGTLIT+ RDM + VLTSIVLK NVTMLDI STRMLGQY
Sbjct  1    MRPAREGDIPVRVKNSYNPKAPGTLITRQRDMDKVVLTSIVLKSNVTMLDIVSTRMLGQY  60

Query  511  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  332
            GFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR+LIQQ  ELDHVVEELEKIA+
Sbjct  61   GFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSRELIQQ--ELDHVVEELEKIAI  118

Query  331  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  152
            V LLQ R+IISLIGNV++SSLILEK   VL  +GVNVQMISQGASKVN+SLIV+DS+A+ 
Sbjct  119  VRLLQQRAIISLIGNVEQSSLILEKTGRVLRKSGVNVQMISQGASKVNMSLIVHDSDAKA  178

Query  151  CVEALHSAFFE  119
             VEALH AFFE
Sbjct  179  LVEALHQAFFE  189



>gb|EMT09778.1| Aspartokinase 1, chloroplastic [Aegilops tauschii]
Length=418

 Score =   312 bits (799),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 171/208 (82%), Gaps = 22/208 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTSIVLK
Sbjct  209  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTSIVLK  268

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVD VATSE                   
Sbjct  269  SNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDCVATSE-------------------  309

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILEKAFHVL   GVNVQMISQG
Sbjct  310  ---ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKAFHVLRRIGVNVQMISQG  366

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVN+SLIV+DSEA+ CVEALH AFFE
Sbjct  367  ASKVNMSLIVHDSEAKLCVEALHQAFFE  394



>gb|AFW74642.1| hypothetical protein ZEAMMB73_320357 [Zea mays]
Length=487

 Score =   310 bits (793),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/198 (78%), Positives = 177/198 (89%), Gaps = 2/198 (1%)
 Frame = -2

Query  712  QVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIAS  533
            QVLHPQSMRPAREG IPV VKNSYN KAPGT+IT+ RDM + VLTSIVLK NVTMLDI S
Sbjct  277  QVLHPQSMRPAREGDIPVMVKNSYNAKAPGTIITRQRDMDKVVLTSIVLKSNVTMLDIVS  336

Query  532  TRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVE  353
            TRMLGQYGFLA+VF+IFEDL I VD VATSEVS+S++LDPSK+WSR+LIQQ  ELDHVVE
Sbjct  337  TRMLGQYGFLARVFAIFEDLCIYVDCVATSEVSVSVSLDPSKIWSRELIQQ--ELDHVVE  394

Query  352  ELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIV  173
            ELEKIA+V LLQ R+IISLIGNV++SSLIL+K  HVL  +G+NVQMISQGASKVN+SLIV
Sbjct  395  ELEKIAIVRLLQQRAIISLIGNVEQSSLILQKMGHVLRKSGINVQMISQGASKVNMSLIV  454

Query  172  NDSEAEQCVEALHSAFFE  119
            +DS+A++ VEALH AFF+
Sbjct  455  HDSDAKELVEALHQAFFK  472



>ref|XP_006844541.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
 gb|ERN06216.1| hypothetical protein AMTR_s00016p00169310 [Amborella trichopoda]
Length=464

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/164 (95%), Positives = 156/164 (95%), Gaps = 2/164 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSY PKAPGTLITK RDMSEAVLTSIVLK
Sbjct  293  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYKPKAPGTLITKARDMSEAVLTSIVLK  352

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ
Sbjct  353  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  412

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAF  251
            Q  ELDHVVEELEKIAVV LLQHRSIISLIGNVQRSSLILEK F
Sbjct  413  Q--ELDHVVEELEKIAVVKLLQHRSIISLIGNVQRSSLILEKDF  454



>ref|XP_001773420.1| predicted protein [Physcomitrella patens]
 gb|EDQ61793.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 177/214 (83%), Gaps = 7/214 (3%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNP+APGTLIT  RDMSEA +TSIVLK
Sbjct  352  EASELAYFGAQVLHPQSMRPARDANIPVRVKNSYNPQAPGTLITGERDMSEAEMTSIVLK  411

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VTMLDI STRMLGQ GFLAKVF+ FE LGISVDVVATSEVSISLTLDPSKLW R+LI+
Sbjct  412  KDVTMLDIQSTRMLGQVGFLAKVFTTFEHLGISVDVVATSEVSISLTLDPSKLWERELIE  471

Query  382  QAS-------ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVN  224
            QAS       ELD +  EL KIA V LL+ +SIISLI NV++SS +LEK F V   N +N
Sbjct  472  QASQCLWLQQELDKMKSELSKIANVQLLKKKSIISLISNVKQSSAVLEKVFRVFKKNDIN  531

Query  223  VQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            VQMISQGASKVNIS++V+D +A +CV+ LH  F+
Sbjct  532  VQMISQGASKVNISMVVDDDDAPKCVQELHKVFW  565



>gb|KJB33202.1| hypothetical protein B456_006G000400 [Gossypium raimondii]
Length=511

 Score =   307 bits (786),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 159/169 (94%), Gaps = 2/169 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT  RDMS+AVLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITGNRDMSKAVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLT  236
            Q  ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  H L++
Sbjct  458  Q--ELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKVLHHLVS  504



>ref|XP_001780779.1| predicted protein [Physcomitrella patens]
 gb|EDQ54418.1| predicted protein [Physcomitrella patens]
Length=527

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 176/207 (85%), Gaps = 3/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGAQVLHPQSMRPAR+  IPVRVKNSYNPKAPGTLIT+ RDMS+  +TSIVLK
Sbjct  311  EASELAYFGAQVLHPQSMRPARDANIPVRVKNSYNPKAPGTLITRERDMSQVEMTSIVLK  370

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VTMLDI STRMLGQ GFLAKVF+ FE+LGISVDVVATSEVSISLTLDP+KLW R LI+
Sbjct  371  KDVTMLDIQSTRMLGQVGFLAKVFTTFEELGISVDVVATSEVSISLTLDPAKLWERALIE  430

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            QA+++     EL +IA V LL+ ++IISLI NV++SS +LEK F V  +N +NVQMISQG
Sbjct  431  QANKMKS---ELSRIANVQLLKKKAIISLISNVKQSSAVLEKVFSVFKSNNINVQMISQG  487

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS++V+D +  +CV+ LH AF+
Sbjct  488  ASKVNISMVVDDDDGPKCVQELHQAFW  514



>gb|KCW55775.1| hypothetical protein EUGRSUZ_I01605 [Eucalyptus grandis]
Length=525

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 156/162 (96%), Gaps = 2/162 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+TRDMS+AVLTSIVLK
Sbjct  340  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRTRDMSKAVLTSIVLK  399

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR+LIQ
Sbjct  400  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRELIQ  459

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  257
            Q  ELDHVVEELEKIAVV+LLQ RSIISLIGNVQRSSLILEK
Sbjct  460  Q--ELDHVVEELEKIAVVHLLQRRSIISLIGNVQRSSLILEK  499



>gb|ABF99918.1| aspartate kinase family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/162 (89%), Positives = 154/162 (95%), Gaps = 2/162 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPA+EG IPVRVKNSYN +APGT+ITKTRD+S+++LTSIVLK
Sbjct  332  EAAELAYFGAQVLHPQSMRPAKEGDIPVRVKNSYNRRAPGTVITKTRDLSKSILTSIVLK  391

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFEDLGISVD VATSEVSISLTLDPSKLW R+LIQ
Sbjct  392  SNITMLDIVSTRMLGQYGFLAKVFSIFEDLGISVDCVATSEVSISLTLDPSKLWCRELIQ  451

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEK  257
            Q  ELDHVVEELEKIAVV+LLQHRSIISLIGNVQRSSLILEK
Sbjct  452  Q--ELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEK  491



>gb|ACN41167.1| unknown [Picea sitchensis]
Length=175

 Score =   259 bits (662),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/160 (83%), Positives = 146/160 (91%), Gaps = 2/160 (1%)
 Frame = -2

Query  598  MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTL  419
            MS+AVLTSIVLKRNVTMLDI STRMLGQ+GFLA+VFSIFE+LGISVDVVATSEVSISLTL
Sbjct  1    MSKAVLTSIVLKRNVTMLDIVSTRMLGQFGFLARVFSIFEELGISVDVVATSEVSISLTL  60

Query  418  DPSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLL  239
            DPSK+W R+LI+Q  ELD +VEELEK+AVV LLQ+RSIISLIGN+Q SSLILEK F V  
Sbjct  61   DPSKMWERELIKQ--ELDRMVEELEKVAVVKLLQNRSIISLIGNIQYSSLILEKVFCVFR  118

Query  238  TNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            T GVNVQMISQGASKVNISLIVN+SEAE CV+ALHS FF+
Sbjct  119  TLGVNVQMISQGASKVNISLIVNESEAESCVKALHSTFFD  158



>ref|XP_008647236.1| PREDICTED: aspartokinase 1, chloroplastic-like, partial [Zea 
mays]
Length=270

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 144/161 (89%), Gaps = 3/161 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI+  +     VLTSIVLK
Sbjct  113  EATELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLISYYQTKG-IVLTSIVLK  171

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQYGFLA+VF+IFEDL ISVD VATSEVS+S++LDPSK+WSR+LIQ
Sbjct  172  SNVTMLDIVSTRMLGQYGFLARVFAIFEDLCISVDCVATSEVSVSVSLDPSKIWSRELIQ  231

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILE  260
            Q  ELDHVVEELEKIA+V LLQ R+IISLIGNV++SSLILE
Sbjct  232  Q--ELDHVVEELEKIAIVRLLQQRAIISLIGNVEQSSLILE  270



>gb|EMS47783.1| Aspartokinase 1, chloroplastic [Triticum urartu]
Length=534

 Score =   261 bits (668),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 152/215 (71%), Gaps = 49/215 (23%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNPKAPGTLI K RDM + VLTSIVLK
Sbjct  336  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPKAPGTLIAKGRDMDKVVLTSIVLK  395

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVTMLDI STRMLGQ+GFLAK                                      
Sbjct  396  SNVTMLDIVSTRMLGQFGFLAK--------------------------------------  417

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILE--------KAFHVLLTNGV  227
               ELDHVVEELEKIA V+LLQ R+I+SLIGNV++SSLILE        KAFHVL   GV
Sbjct  418  ---ELDHVVEELEKIAFVHLLQQRAIVSLIGNVRKSSLILEKTNPYSHLKAFHVLRRIGV  474

Query  226  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            NVQMISQGASKVN+SLIV+DSEA+ CVEALH AFF
Sbjct  475  NVQMISQGASKVNMSLIVHDSEAKLCVEALHQAFF  509



>ref|XP_011399436.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM26498.1| Aspartokinase 1, chloroplastic [Auxenochlorella protothecoides]
Length=501

 Score =   255 bits (651),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 163/210 (78%), Gaps = 4/210 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPARE-GGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  566
            EA ELA+FGA VLHPQ+M+PA+E GG+ VRVKNSYN  APGTLI+  RDM++A+ T+IVL
Sbjct  294  EATELAFFGATVLHPQAMQPAQEVGGMGVRVKNSYNRLAPGTLISAERDMADALCTAIVL  353

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK-LWSRDL  389
            K NVTM+DI+STRMLGQYGFLA+VF +F    +SVDVVATSE+S+SLTLDP++ LW RDL
Sbjct  354  KSNVTMVDISSTRMLGQYGFLARVFDVFARQKLSVDVVATSEISVSLTLDPARTLWERDL  413

Query  388  IQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMIS  209
            I+   EL+ ++     IA  +  +  SII LI NVQR+S ILE+ F+VL    VNVQM+S
Sbjct  414  IED--ELEGLMAAFAGIAKASYRRGMSIICLICNVQRTSTILERVFNVLGREAVNVQMMS  471

Query  208  QGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            QGASK NISLIV D EA + V ALH+ FFE
Sbjct  472  QGASKTNISLIVRDGEAPRAVAALHAEFFE  501



>ref|XP_005846857.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
 gb|EFN54755.1| hypothetical protein CHLNCDRAFT_134660 [Chlorella variabilis]
Length=477

 Score =   254 bits (649),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 126/207 (61%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA+FGA VLHP +M+PA E  + VRVKNSYN +APGTLI++ RDMS +++TSIV+K
Sbjct  268  EATELAFFGATVLHPLAMQPAHECNVGVRVKNSYNRQAPGTLISEVRDMSTSLMTSIVMK  327

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             NVT++D+ STRM+GQ+GFLAKVF +F D  ISVDVVATSEVSISLTLDP+K+W RDLI 
Sbjct  328  SNVTLVDVVSTRMMGQFGFLAKVFKVFSDNKISVDVVATSEVSISLTLDPAKIWERDLI-  386

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
             A EL+ ++++ E +A  +  +  +IISLI NVQR+S ILE+ F VL    + VQM+SQG
Sbjct  387  -AEELEGLMQDFEGVAKAHYRRGMAIISLICNVQRTSQILERTFRVLNRENIRVQMMSQG  445

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASK NI+LIV DSEA+  +  LH  FF
Sbjct  446  ASKTNIALIVEDSEAKHALRVLHDEFF  472



>ref|XP_003074218.1| putative precursor monofunctional aspartokina (ISS) [Ostreococcus 
tauri]
Length=423

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTR--DM-SEAVLTS  575
            EA ELAYFGAQVLHP SMRPA + G + VRVKNSYN +APGT+I   R  D+  + +LTS
Sbjct  212  EATELAYFGAQVLHPHSMRPAMDSGKLAVRVKNSYNIRAPGTVIGHKRAEDLHKDWLLTS  271

Query  574  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  395
            IV K+NVTMLDI STRMLGQYGFLAKVF+I    GISVDVVATSEVS+SLTLDPSKLW R
Sbjct  272  IVRKKNVTMLDITSTRMLGQYGFLAKVFNIMATNGISVDVVATSEVSVSLTLDPSKLWER  331

Query  394  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  215
            DL ++  E   +  E + IA V +    SIISLIGNV+R++ I+E+AF  L +  + V+M
Sbjct  332  DLAKEELEKLKLDFENDGIANVAVSSGHSIISLIGNVERNNEIMERAFRALGSKDIKVKM  391

Query  214  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            +SQGASK NISL+VNDS+      A+H+ FFE
Sbjct  392  VSQGASKTNISLLVNDSQGADAARAIHAEFFE  423



>gb|KJB11755.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=416

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/131 (94%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = -2

Query  511  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  332
            GFL KVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQQASELDHVVEELEKIAV
Sbjct  278  GFLGKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQQASELDHVVEELEKIAV  337

Query  331  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  152
            VNLLQHRSIISLIGNVQRSSLILEKAFHVL TNGVNVQMISQGASKVNISLIV+D+EAEQ
Sbjct  338  VNLLQHRSIISLIGNVQRSSLILEKAFHVLRTNGVNVQMISQGASKVNISLIVHDTEAEQ  397

Query  151  CVEALHSAFFE  119
            CV ALHS FFE
Sbjct  398  CVRALHSTFFE  408



>ref|XP_001415789.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94081.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=463

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTRDMSEA---VLTS  575
            EA ELAYFGAQVLHP SMRPA +   + VRVKNSYN +APGT+I   RD  E    +LTS
Sbjct  251  EATELAYFGAQVLHPHSMRPAMDSSDLCVRVKNSYNIRAPGTVIGHVRDEDEHKNWLLTS  310

Query  574  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  395
            IV K+NVTMLDI STRMLGQYGFLAKVFS+    GISVDVVATSEVS+SLTLDPSKLWSR
Sbjct  311  IVQKKNVTMLDITSTRMLGQYGFLAKVFSVMASNGISVDVVATSEVSVSLTLDPSKLWSR  370

Query  394  DLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  221
            DL ++  EL+ +V++ E   IA V +    SIISLIGNV+R++ I+E++F  L +  + V
Sbjct  371  DLAKE--ELEKLVQDFENEGIAHVTVSSGHSIISLIGNVERNNEIMERSFRALGSEDIKV  428

Query  220  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            +M+SQGASK NISL+V+  +    V A+HS FF
Sbjct  429  KMVSQGASKTNISLLVDQEQGSDAVRAIHSEFF  461



>emb|CEF96568.1| Aspartate kinase, conserved site [Ostreococcus tauri]
Length=520

 Score =   246 bits (628),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 159/212 (75%), Gaps = 4/212 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLITKTR--DM-SEAVLTS  575
            EA ELAYFGAQVLHP SMRPA + G + VRVKNSYN +APGT+I   R  D+  + +LTS
Sbjct  309  EATELAYFGAQVLHPHSMRPAMDSGKLAVRVKNSYNIRAPGTVIGHKRAEDLHKDWLLTS  368

Query  574  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  395
            IV K+NVTMLDI STRMLGQYGFLAKVF+I    GISVDVVATSEVS+SLTLDPSKLW R
Sbjct  369  IVRKKNVTMLDITSTRMLGQYGFLAKVFNIMATNGISVDVVATSEVSVSLTLDPSKLWER  428

Query  394  DLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQM  215
            DL ++  E   +  E + IA V +    SIISLIGNV+R++ I+E+AF  L +  + V+M
Sbjct  429  DLAKEELEKLKLDFENDGIANVAVSSGHSIISLIGNVERNNEIMERAFRALGSKDIKVKM  488

Query  214  ISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            +SQGASK NISL+VNDS+      A+H+ FFE
Sbjct  489  VSQGASKTNISLLVNDSQGADAARAIHAEFFE  520



>gb|KDD72939.1| amino acid kinase [Helicosporidium sp. ATCC 50920]
Length=499

 Score =   245 bits (626),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/209 (60%), Positives = 161/209 (77%), Gaps = 4/209 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPARE-GGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  566
            EA ELA+FGA VLHP +M+PA+E GG+ VRVKNSYN  APGT I  +RD+ EA++TSIVL
Sbjct  287  EATELAFFGATVLHPLAMQPAQEVGGMAVRVKNSYNRAAPGTRIAASRDLHEALVTSIVL  346

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK-LWSRDL  389
            K+NVT++DI ST+MLG YGFLA+VF +F +  +SVDVVATSEVS+SLTLDP+K LW RDL
Sbjct  347  KQNVTLVDIVSTKMLGTYGFLARVFGVFAEHKLSVDVVATSEVSVSLTLDPAKTLWERDL  406

Query  388  IQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMIS  209
            I+   EL+ +      IA  +  +  SI+ +I NVQR+S ILE+ F+VL   GVNVQM+S
Sbjct  407  IED--ELEALTAGFAGIARASYRRGMSILGIICNVQRTSTILERVFNVLGREGVNVQMMS  464

Query  208  QGASKVNISLIVNDSEAEQCVEALHSAFF  122
            QGASK NISLIV+D+E+E+ +  LH  FF
Sbjct  465  QGASKTNISLIVSDAESERVLTCLHDEFF  493



>ref|XP_002507216.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68474.1| predicted protein [Micromonas sp. RCC299]
Length=498

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 166/213 (78%), Gaps = 9/213 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREG-GIPVRVKNSYNPKAPGTLI---TKTRDMSEAVLTS  575
            EA ELAYFGAQVLHPQSMRPA +   + VRVKNSYN +APGTLI     TRD S+ +LT+
Sbjct  276  EATELAYFGAQVLHPQSMRPAMDSDSLCVRVKNSYNIEAPGTLIGHVRSTRD-SDWILTA  334

Query  574  IVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSR  395
            IV K+NVT+LD+ STRMLGQYGFLA+VF++ E   ISVD +ATSEVS+SLTLDP+KLWSR
Sbjct  335  IVRKKNVTLLDVVSTRMLGQYGFLARVFAVMEKARISVDCIATSEVSVSLTLDPAKLWSR  394

Query  394  DLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNV  221
            DL+++  EL+ +V + E   IA V+     S++SLIGNV+R++ I+E++F  L + G+ V
Sbjct  395  DLVKE--ELEALVRDFENNGIARVSYTTGNSLVSLIGNVERNNEIMERSFRALGSAGIRV  452

Query  220  QMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            +M+SQGASK NISL+V++S+  Q V A+H+ FF
Sbjct  453  KMVSQGASKTNISLLVSESQGAQAVRAIHAEFF  485



>ref|XP_007515683.1| aspartate kinase [Bathycoccus prasinos]
 emb|CCO14562.1| aspartate kinase [Bathycoccus prasinos]
Length=576

 Score =   242 bits (618),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 166/223 (74%), Gaps = 18/223 (8%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGG-IPVRVKNSYNPKAPGTLIT---------KTRD--  599
            EA ELAYFGAQVLHPQ+MRPA + G + VRVKNSYN +APGT+I          K+ D  
Sbjct  342  EAQELAYFGAQVLHPQAMRPAMDNGSLRVRVKNSYNIRAPGTVIGHIDYNSSDGKSGDEG  401

Query  598  --MSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISL  425
              M + +LTSIV K+NVTMLDI STRMLGQYGFLA+VF++ +  GISVDVVATSEVS+SL
Sbjct  402  ERMDDWLLTSIVRKKNVTMLDIVSTRMLGQYGFLAEVFAVLQHNGISVDVVATSEVSVSL  461

Query  424  TLDPSKLWSRDLIQQASELDHVVEELEKI--AVVNLLQHRSIISLIGNVQRSSLILEKAF  251
            TLDP+K+WSRDL Q+  EL+ V  ELE +  A V +    SIISLIGN++R++ I+E+AF
Sbjct  462  TLDPAKIWSRDLAQE--ELEKVQRELEDVGTARVAVSNGHSIISLIGNLERNNEIMERAF  519

Query  250  HVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
              L    V+V+M+SQGASK NISL+V+D+E ++   A+H  FF
Sbjct  520  KALKEAKVHVKMVSQGASKCNISLLVDDAEGQKAASAIHEEFF  562



>gb|KJB11757.1| hypothetical protein B456_001G275700 [Gossypium raimondii]
Length=474

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLIT+ RDMS+AVLTSIVLK
Sbjct  343  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLITRNRDMSKAVLTSIVLK  402

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQ+GFLAKVFSIFEDLGISVDVVATSEVS SLTLDPSKLWSR+LIQ
Sbjct  403  RNVTMLDIVSTRMLGQFGFLAKVFSIFEDLGISVDVVATSEVSTSLTLDPSKLWSRELIQ  462

Query  382  QAS  374
            QAS
Sbjct  463  QAS  465



>gb|KDO43561.1| hypothetical protein CISIN_1g008621mg [Citrus sinensis]
Length=456

 Score =   236 bits (602),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG IPVRVKNSYNP APGTLI ++RDMS+AVLTSIVLK
Sbjct  333  EAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNPNAPGTLIRRSRDMSKAVLTSIVLK  392

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNVTMLDI STRMLGQYGFLAKVFS FEDLGISVDVVATSEVS+SLTLDPSKLWSR+LIQ
Sbjct  393  RNVTMLDIVSTRMLGQYGFLAKVFSTFEDLGISVDVVATSEVSLSLTLDPSKLWSRELIQ  452

Query  382  QAS  374
            QAS
Sbjct  453  QAS  455



>ref|XP_005650639.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
 gb|EIE26095.1| aspartate kinase [Coccomyxa subellipsoidea C-169]
Length=458

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 154/208 (74%), Gaps = 3/208 (1%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  566
            EA+ELA+FGA VLHP +M+PA +   + VRVKNSYN  A GTLI + RDM+  ++TSIVL
Sbjct  251  EASELAFFGATVLHPSAMQPALQTSNLDVRVKNSYNRMAAGTLICRERDMTNVLMTSIVL  310

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            K NVT+LDI STRMLGQYGFL+KVF +F D  +SVDVVATSE+S+SLTLDPSK+W R   
Sbjct  311  KTNVTLLDIVSTRMLGQYGFLSKVFDVFRDNEVSVDVVATSEISVSLTLDPSKIWDR--E  368

Query  385  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  206
                E++ ++      A V+   + SIISLI NV R+S ILE+ F VL    VNV+M+SQ
Sbjct  369  LIEEEIEALMSAFSGFAKVSCTHNVSIISLICNVARTSNILERVFRVLGRQDVNVKMMSQ  428

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFF  122
            GASK NISLIV+DSEA+Q V ALH  FF
Sbjct  429  GASKTNISLIVSDSEAKQVVRALHDEFF  456



>gb|EKD81471.1| hypothetical protein ACD_39C01793G0002, partial [uncultured bacterium]
Length=438

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 153/208 (74%), Gaps = 10/208 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGA+VLHP+S+ PA    IPVRVKNSYNP  PGTLI    D S+ +L  +  K
Sbjct  239  EASELAYFGAKVLHPRSIIPAMCKKIPVRVKNSYNPTHPGTLILSMIDDSDEMLRVLTFK  298

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            + VT++DI STRMLGQYGFLAKVF IF++  +SVD++ATSEVSIS+TLD           
Sbjct  299  KKVTVVDIVSTRMLGQYGFLAKVFQIFDEQKVSVDMLATSEVSISVTLD----------N  348

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + + +D +  ELEKIA V +   ++I++++GNV+RSS ILE+ F VL  + +NVQMISQG
Sbjct  349  RENGIDGLKTELEKIANVTIKTGKTIVTMVGNVKRSSEILERTFEVLNASAINVQMISQG  408

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IV+D EA+ C+  LH AFFE
Sbjct  409  ASKVNISFIVDDKEADTCIRELHRAFFE  436



>gb|AFW74641.1| hypothetical protein ZEAMMB73_320357 [Zea mays]
Length=448

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 141/198 (71%), Gaps = 41/198 (21%)
 Frame = -2

Query  712  QVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDIAS  533
            QVLHPQSMRPAREG IPV VKNSYN KAPGT+IT+ RDM + VLTSIVLK NVTMLDI S
Sbjct  277  QVLHPQSMRPAREGDIPVMVKNSYNAKAPGTIITRQRDMDKVVLTSIVLKSNVTMLDIVS  336

Query  532  TRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVE  353
            TRMLGQYGFLA+                                         ELDHVVE
Sbjct  337  TRMLGQYGFLAR-----------------------------------------ELDHVVE  355

Query  352  ELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIV  173
            ELEKIA+V LLQ R+IISLIGNV++SSLIL+K  HVL  +G+NVQMISQGASKVN+SLIV
Sbjct  356  ELEKIAIVRLLQQRAIISLIGNVEQSSLILQKMGHVLRKSGINVQMISQGASKVNMSLIV  415

Query  172  NDSEAEQCVEALHSAFFE  119
            +DS+A++ VEALH AFF+
Sbjct  416  HDSDAKELVEALHQAFFK  433



>ref|XP_009388316.1| PREDICTED: aspartokinase 2, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=458

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/121 (90%), Positives = 115/121 (95%), Gaps = 0/121 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP SMRPAREG IPVRVKNSYNP+APGT+ITK RDMS+AVLTSIVLK
Sbjct  338  EAAELAYFGAQVLHPLSMRPAREGDIPVRVKNSYNPQAPGTVITKERDMSKAVLTSIVLK  397

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVF+IFEDLGISVD VATSEVSISLTLDPSKLWSR+LIQ
Sbjct  398  SNITMLDIVSTRMLGQYGFLAKVFAIFEDLGISVDCVATSEVSISLTLDPSKLWSRELIQ  457

Query  382  Q  380
            Q
Sbjct  458  Q  458



>ref|WP_013968408.1| aspartate kinase [Treponema caldaria]
 gb|AEJ19097.1| aspartate kinase [Treponema caldaria DSM 7334]
Length=443

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 149/208 (72%), Gaps = 11/208 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP+SM+P    G  VRVKNSYNP+A GT I    D +   + +I  K
Sbjct  246  EAAELAYFGAQVLHPRSMQPCIATGTTVRVKNSYNPQAKGTRIVAKLDGNAGPVRAITSK  305

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT++DI S+RMLGQYGFLA VF  F    ISVD+VATSEVSISLTLD           
Sbjct  306  KNVTLVDIVSSRMLGQYGFLAGVFQAFSVHKISVDMVATSEVSISLTLDA----------  355

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
             A +L  +  +LEKIA V + + ++II++IG+++RSS ILE+AF V  + G+ VQMISQG
Sbjct  356  -AHDLLALKGDLEKIANVTIKEKKAIITIIGDIRRSSEILERAFGVCSSLGIQVQMISQG  414

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IVND+EA Q V+ LH AFFE
Sbjct  415  ASKVNISFIVNDTEASQVVQGLHKAFFE  442



>ref|XP_001698576.1| aspartate kinase [Chlamydomonas reinhardtii]
 gb|EDP08069.1| aspartate kinase [Chlamydomonas reinhardtii]
Length=545

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 152/209 (73%), Gaps = 5/209 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  566
            EA ELAYFGAQVLHPQ+M+PA R G + VRVKNSYN  APGT+I+ TR M   V+TSIVL
Sbjct  314  EATELAYFGAQVLHPQAMQPAIRSGKMNVRVKNSYNRTAPGTIISATRPMDCTVVTSIVL  373

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            K NVT++DI STRM+GQYGFL+ VF  F    ISVDVVATSEVS+SLTLDP K+      
Sbjct  374  KSNVTLVDIISTRMMGQYGFLSTVFDAFRRHKISVDVVATSEVSVSLTLDPKKVAG----  429

Query  385  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  206
                EL  + +ELEKIA V+  ++ +I+SLI NV+++S IL +AF V     +NV M+SQ
Sbjct  430  AVEDELTQLSQELEKIAAVSFRKNLAILSLICNVEKTSEILMRAFSVFQRENINVLMMSQ  489

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFFE  119
            GASK NISL+V+ +   + V+ALH  FF+
Sbjct  490  GASKTNISLVVDGARGVEAVQALHREFFD  518



>gb|ABC46704.1| aspartokinase [Arachis hypogaea]
Length=129

 Score =   215 bits (547),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 119/126 (94%), Gaps = 2/126 (2%)
 Frame = -2

Query  511  GFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAV  332
            GFLAKVFSIFEDLGI VDVVAT+EVSISLTLDPSKLWSR+LIQ+  ELD+VVEELEKIAV
Sbjct  6    GFLAKVFSIFEDLGIYVDVVATTEVSISLTLDPSKLWSRELIQE--ELDYVVEELEKIAV  63

Query  331  VNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQ  152
            VNLLQ+RSIISLIGNVQ+SSLILEKAF VL T GVNVQMIS+GASKVNISLIVNDSEAEQ
Sbjct  64   VNLLQNRSIISLIGNVQKSSLILEKAFRVLRTLGVNVQMISKGASKVNISLIVNDSEAEQ  123

Query  151  CVEALH  134
            CV ALH
Sbjct  124  CVRALH  129



>ref|XP_002947347.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
 gb|EFJ51395.1| hypothetical protein VOLCADRAFT_87637 [Volvox carteri f. nagariensis]
Length=557

 Score =   226 bits (576),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 150/209 (72%), Gaps = 5/209 (2%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPA-REGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVL  566
            EA ELAYFGAQVLHPQ+M+PA R G + VRVKNSYN +A GT+I+  RDM   V+TSIVL
Sbjct  320  EATELAYFGAQVLHPQAMQPAIRSGKMNVRVKNSYNREAAGTIISAARDMKCTVVTSIVL  379

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            K NVT++DI STRM+GQYGFLA VF  F    ISVDVVATSEVS+SLTLDP K+      
Sbjct  380  KSNVTLVDIISTRMMGQYGFLATVFDTFRRHKISVDVVATSEVSVSLTLDPKKIAG----  435

Query  385  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  206
                EL  V  EL+++A V+  +  +IISLI NV+++S IL +AF V    G+NV M+SQ
Sbjct  436  APDDELSQVQTELDRMAAVSFRKGLAIISLICNVEKTSEILMRAFSVFQREGINVLMMSQ  495

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFFE  119
            GASK NISL+V+ +   + V ALH  FF+
Sbjct  496  GASKTNISLVVDGARGTEAVLALHREFFD  524



>ref|WP_010253784.1| aspartate kinase [Treponema primitia]
Length=449

 Score =   223 bits (568),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/208 (54%), Positives = 151/208 (73%), Gaps = 11/208 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP++M+P  + G PVRVKNSYNP APGT I +T D     + +I  +
Sbjct  247  EAAELAYFGAQVLHPRAMQPCIKTGTPVRVKNSYNPSAPGTRIIETIDKKTGPVRAITSR  306

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT++DI STRM+GQYGFLA VF+ F +  +SVD+VATSEVS+SLTLD           
Sbjct  307  KNVTLVDIVSTRMVGQYGFLAGVFATFAEHKLSVDMVATSEVSVSLTLD-----------  355

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
             A +L  +  +L KI+ V +   ++I+++IG+V+RSS IL++AF V +  G+ VQM+SQG
Sbjct  356  AAHDLGKLKHDLSKISSVEIKAGKAIVTIIGDVRRSSEILQRAFGVCVLLGIQVQMVSQG  415

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IV+D++A + V ALH  FFE
Sbjct  416  ASKVNISFIVDDTQAGEVVTALHRCFFE  443



>ref|XP_003059042.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57497.1| predicted protein [Micromonas pusilla CCMP1545]
Length=575

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 156/230 (68%), Gaps = 25/230 (11%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPARE-GGI----------------PVRVKNSYNPKAPGTLI  614
            EA ELAYFGAQVLHPQSMRPA +  G+                 VRVKNSYN  APGTLI
Sbjct  347  EATELAYFGAQVLHPQSMRPAMDKDGLRRVCISHTGPHTTAFACVRVKNSYNVTAPGTLI  406

Query  613  TKTR----DMSEAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVAT  446
               R    D    +LTSIV K+++TMLDI STRMLGQYGFLA VF + E   ISVD VAT
Sbjct  407  GHARPRGDDDPNWMLTSIVQKKSITMLDIVSTRMLGQYGFLATVFEVMERNKISVDCVAT  466

Query  445  SEVSISLTLDPSKLWSRDLIQQASELDHVVEELEK--IAVVNLLQHRSIISLIGNVQRSS  272
            SEVS+SLTLDP+K+WSRDL+++  EL+ +V + E+  IA V      S+ISLIGNV+R+ 
Sbjct  467  SEVSVSLTLDPAKMWSRDLVEE--ELEALVRDFEENGIARVTCQTGHSLISLIGNVRRNK  524

Query  271  LILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
             I++++F  L    V V+MISQGASK NISL+VN  E  + V A+H+ FF
Sbjct  525  EIVQRSFAALERADVTVKMISQGASKTNISLLVNGDEGTEAVRAIHAEFF  574



>tpg|DAA39409.1| TPA: hypothetical protein ZEAMMB73_358951, partial [Zea mays]
Length=178

 Score =   212 bits (539),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -2

Query  499  KVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAVVNLL  320
            +VFSIFEDLGISVD VATSEVSISLTLDPSKLWS +L+Q  +ELD V+EELEKIAVV+LL
Sbjct  24   QVFSIFEDLGISVDCVATSEVSISLTLDPSKLWSCELVQHKNELDDVIEELEKIAVVHLL  83

Query  319  QHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEA  140
            Q+RSIISLIGNVQRSSLILEKAF+VL  NGVNVQMISQGASKVNISL+V+DSEA+QCV+A
Sbjct  84   QNRSIISLIGNVQRSSLILEKAFNVLRRNGVNVQMISQGASKVNISLVVHDSEAKQCVQA  143

Query  139  LHSAFFE  119
            LHSAFFE
Sbjct  144  LHSAFFE  150



>ref|XP_002459732.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
 gb|EER96253.1| hypothetical protein SORBIDRAFT_02g009570 [Sorghum bicolor]
Length=458

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/121 (86%), Positives = 111/121 (92%), Gaps = 0/121 (0%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHPQSMRPAREG +PVRVKNSYN +APGTLITK RDMS+ VLTSIVLK
Sbjct  327  EAAELAYFGAQVLHPQSMRPAREGDVPVRVKNSYNRRAPGTLITKARDMSKTVLTSIVLK  386

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
             N+TMLDI STRMLGQYGFLAKVFSIFED G+SVD VATSEVSISLTLDPSKLWS +L+Q
Sbjct  387  SNITMLDIVSTRMLGQYGFLAKVFSIFEDSGMSVDCVATSEVSISLTLDPSKLWSCELVQ  446

Query  382  Q  380
             
Sbjct  447  H  447



>ref|WP_015707281.1| aspartate kinase [Treponema primitia]
 gb|AEF84490.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema primitia ZAS-2]
Length=451

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 150/208 (72%), Gaps = 11/208 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP++M+P  + G PVRVKNSYNP APGT I  + D     + +I  +
Sbjct  247  EAAELAYFGAQVLHPRAMQPCIKTGTPVRVKNSYNPDAPGTRIVGSLDKKAGPVRAITSR  306

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT++DI STRM+GQ+GFLA+VF+ F +  +SVD+VATSEVS+SLTLD           
Sbjct  307  KNVTLVDIVSTRMVGQHGFLAEVFTTFAEHKLSVDMVATSEVSVSLTLDADH--------  358

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               EL  + ++L +IA V +   ++I++++G+V+RSS IL++AF   +  G+ VQMISQG
Sbjct  359  ---ELGALKQDLSRIASVEIRTGKAIVTIVGDVRRSSEILQRAFGTCVLLGIQVQMISQG  415

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IV+D++A + V ALH  FFE
Sbjct  416  ASKVNISFIVDDTQAGEVVIALHKCFFE  443



>gb|EWM28259.1| aspartate kinase [Nannochloropsis gaditana]
Length=572

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/207 (57%), Positives = 146/207 (71%), Gaps = 8/207 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGA++LHP SM PA    I VRVKNSYNP  PGT+I   +D ++ V T+I  K
Sbjct  365  EASELAYFGAEILHPISMVPAMRYNIQVRVKNSYNPDHPGTVILADKDYTQLV-TAITSK  423

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNV +LDI ST MLGQYGFL++VFSIFE+  +SVD VATSEVSISLTLD  K       Q
Sbjct  424  RNVELLDIVSTWMLGQYGFLSRVFSIFEEQKVSVDCVATSEVSISLTLDTKK-------Q  476

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
                 D +V+ L +IA V + + R+IISLI NV RSS +L   F+ L   G+ V+M+SQG
Sbjct  477  DDHAEDRLVKALSEIAAVTVHRDRAIISLIANVARSSEVLSIVFNALKEAGIQVEMLSQG  536

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNISLIV D +AE+C + LH  FF
Sbjct  537  ASKVNISLIVKDEDAERCTQILHDRFF  563



>ref|WP_015710697.1| aspartate kinase [Treponema azotonutricium]
 gb|AEF82415.1| lysine-sensitive aspartokinase 3 (Lysine-sensitiveaspartokinase 
III) (Aspartate kinase III) [Treponema azotonutricium ZAS-9]
Length=446

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 147/207 (71%), Gaps = 11/207 (5%)
 Frame = -2

Query  739  AAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKR  560
            AAELAYFGAQVLHP++M+P  + G PV VKNSYNP APGT I  T     + + +I  ++
Sbjct  248  AAELAYFGAQVLHPRAMQPCIKTGTPVLVKNSYNPSAPGTRIVSTLGKKVSPIQAITSRK  307

Query  559  NVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQQ  380
            NVT++DI STRMLGQYGFLA+VFS F    +SVD+VATSEVS+SLTLD            
Sbjct  308  NVTLVDIVSTRMLGQYGFLAEVFSCFAKHNLSVDMVATSEVSVSLTLD-----------A  356

Query  379  ASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGA  200
              +L  + +++ +IA +++   ++I+++IGNVQRSS IL ++F      GV VQM+SQGA
Sbjct  357  VHDLTVLKKDIARIASIDIKTGKAIVTIIGNVQRSSEILARSFRTCELLGVRVQMVSQGA  416

Query  199  SKVNISLIVNDSEAEQCVEALHSAFFE  119
            SKVNIS IV+DSEA + V+ALH  FFE
Sbjct  417  SKVNISFIVDDSEAAEVVKALHGDFFE  443



>ref|XP_005707902.1| aspartate kinase [Galdieria sulphuraria]
 gb|EME31382.1| aspartate kinase [Galdieria sulphuraria]
Length=522

 Score =   209 bits (532),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 144/208 (69%), Gaps = 8/208 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDM-SEAVLTSIVL  566
            EA E+AYFGA+VLHP +M+PA    IP+RVKNSYNP+ PGT+I   R+  SE  +T+I L
Sbjct  319  EAFEMAYFGAKVLHPIAMQPAMRHNIPIRVKNSYNPEHPGTVIKSRREHPSENPVTAISL  378

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            KR   ++DI STRMLG +GFLA++F +F +  +S+DV+ATSEVS+SLTLDP    +RD  
Sbjct  379  KRKCHLVDIESTRMLGAHGFLAELFKVFGERRVSIDVIATSEVSVSLTLDPKAFDTRD--  436

Query  385  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  206
                EL+    EL KIA V     ++IISL+ NV RS+ IL +A  VL    ++V+MISQ
Sbjct  437  --KEELE---VELSKIASVQFSGEKAIISLVSNVSRSTEILARAMQVLWKENIDVEMISQ  491

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFF  122
            GASK NIS IV D+ A+  V ALH  FF
Sbjct  492  GASKFNISFIVEDTHADAAVRALHGEFF  519



>ref|XP_009388108.1| PREDICTED: aspartokinase 3, chloroplastic-like, partial [Musa 
acuminata subsp. malaccensis]
Length=137

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/113 (89%), Positives = 107/113 (95%), Gaps = 2/113 (2%)
 Frame = -2

Query  457  VVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQR  278
             VATSEVSISLTLDPSKLWSR+LIQQ  ELDHVVEELEKIAVV+LLQHRSIISL+GNVQR
Sbjct  1    CVATSEVSISLTLDPSKLWSRELIQQ--ELDHVVEELEKIAVVHLLQHRSIISLVGNVQR  58

Query  277  SSLILEKAFHVLLTNGVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            SSLILEKAF+VL  NGVNVQMISQGASKVNISLIVND EA+QCV+ALHSAFFE
Sbjct  59   SSLILEKAFNVLRKNGVNVQMISQGASKVNISLIVNDDEAKQCVKALHSAFFE  111



>ref|XP_002182416.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC46317.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=541

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 145/208 (70%), Gaps = 9/208 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGAQVLHP +M+PA +  +PVRVKNSYNP A GT+I + R  +E ++T+I  K
Sbjct  322  EASELAYFGAQVLHPIAMQPAMKHNVPVRVKNSYNPSAVGTII-RNRKETERLVTAITYK  380

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            R++ ++DI ST+MLG YGFLA+VF  FE   +SVDV+A+SEVS+SLTLD          Q
Sbjct  381  RDIKLMDIESTQMLGAYGFLARVFGEFEKHKLSVDVLASSEVSVSLTLDKK--------Q  432

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
            + +E+D ++ +L   A V   + RSI++LI +V RSS +L   F V  T G+ V+M+SQG
Sbjct  433  KDAEIDGLMRDLGSCAKVTCHKDRSILTLITDVGRSSEVLATVFRVFSTCGIKVEMMSQG  492

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IV D   E+ +  LH  FFE
Sbjct  493  ASKVNISFIVKDESLERAILELHKCFFE  520



>ref|XP_005534774.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM80167.1| aspartate kinase [Cyanidioschyzon merolae strain 10D]
Length=609

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 149/208 (72%), Gaps = 8/208 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMS-EAVLTSIVL  566
            EAAELAYFGA+VLHP +M+PA    IPVRVKNSYNP+APGT+I +    + +  +T++ +
Sbjct  374  EAAELAYFGAKVLHPVAMQPALRFNIPVRVKNSYNPEAPGTVILRRESATMDRPVTALSV  433

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            KR V ++DI STRM+G YGFLA+VF+ F    +SVDV+ATSEVS+SLTLD +     D+ 
Sbjct  434  KRGVQLVDIVSTRMVGAYGFLARVFACFATHQLSVDVIATSEVSLSLTLDANAC---DMT  490

Query  385  QQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQ  206
            +Q      +++EL++IA V+    R+IIS+I NV+RSS IL +A  VL    + VQMISQ
Sbjct  491  RQ----QRIIKELQQIAQVSFSSGRAIISIISNVRRSSEILARAMKVLHEQNIEVQMISQ  546

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFF  122
            GASK NISL+V++ EA   V ALH  FF
Sbjct  547  GASKFNISLVVHNDEAITAVRALHDEFF  574



>ref|XP_009035261.1| hypothetical protein AURANDRAFT_52842 [Aureococcus anophagefferens]
 gb|EGB10467.1| hypothetical protein AURANDRAFT_52842 [Aureococcus anophagefferens]
Length=528

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/217 (51%), Positives = 151/217 (70%), Gaps = 20/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEA--------  587
            EAAELAYFGAQVLHP SM PA +  +PVRVKNSYNP   GTLI     ++ A        
Sbjct  305  EAAELAYFGAQVLHPISMLPASKACVPVRVKNSYNPAHEGTLIGDEATIAAARRKAGAEA  364

Query  586  -VLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLD-P  413
             +LT++  KR+VT++D++STRMLGQ GFL ++F +FE  G+SVDVVATSEVS+SLTL+  
Sbjct  365  PLLTALTSKRSVTLVDVSSTRMLGQAGFLKRIFDVFEADGVSVDVVATSEVSVSLTLERK  424

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
                SRD   Q          LE+IA V++ + R+I+S I +V RS+ +L K F VL +N
Sbjct  425  GGDLSRDGRAQ----------LEEIAYVDVKRDRAIVSFIADVTRSTELLAKVFMVLFSN  474

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            G+ V+M+SQGASKVNISL++ D++A++ ++ +H  FF
Sbjct  475  GIAVEMLSQGASKVNISLVLLDADADRALKLIHDCFF  511



>ref|WP_013702193.1| aspartate kinase [Treponema succinifaciens]
 gb|AEB14939.1| aspartate kinase [Treponema succinifaciens DSM 2489]
Length=441

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/207 (49%), Positives = 147/207 (71%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA FG+QVLHP+SM P R+   PVRVKNSYN K+ GTLI +    +  ++T+I   
Sbjct  245  EAQELAMFGSQVLHPRSMIPCRKTRTPVRVKNSYNIKSHGTLIVEEHTGTRPLVTAITKV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +NVT++DI S+RMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT+D           
Sbjct  305  KNVTLIDIQSSRMLGAAGFLAHIFNQFLKWNISIDVIATSEVSVSLTVDGK---------  355

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++E+L+++A VN+   ++I+++I +  RSS+I+ KAF  L   G+NVQMISQG
Sbjct  356  --ADLTGLIEDLKRVADVNVKTGKAIVTIICDASRSSVIIAKAFDGLSKEGINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS++V+ ++A++ VEA+HS  F
Sbjct  414  ASKVNISILVDTNQADKTVEAIHSVLF  440



>ref|WP_016525852.1| aspartate kinase [Treponema maltophilum]
 gb|EPF31241.1| aspartate kinase [Treponema maltophilum ATCC 51939]
Length=444

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 140/208 (67%), Gaps = 11/208 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQ+LHP+SM P R+ G+PVRVKNSYN ++ G+LIT+      + + ++   
Sbjct  248  EAAELAYFGAQILHPRSMAPCRKAGVPVRVKNSYNIQSEGSLITEKHRKKPSPVRALTAV  307

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +N T++DI STRMLG  GFLA +F++F   GIS+DV+ATSEVS+SLT           + 
Sbjct  308  KNSTLIDIVSTRMLGASGFLAHIFNVFLKYGISIDVIATSEVSVSLT-----------VH  356

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ EL  IA   +   +SII++I +   SS IL  AF  L    +N +MISQG
Sbjct  357  TDADLSGLLHELNGIAETKIKTGKSIIAIICDAAHSSSILASAFGALAKENINPEMISQG  416

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS I +D+ A++ V+ LH+AFFE
Sbjct  417  ASKVNISFICDDAVADKTVKTLHAAFFE  444



>ref|XP_002292078.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED90929.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=619

 Score =   200 bits (508),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 140/208 (67%), Gaps = 9/208 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA+ELAYFGAQVLHP +M+PA +  IPVRVKNSYNP APG++I K  +  E ++T+I  K
Sbjct  404  EASELAYFGAQVLHPIAMQPALKANIPVRVKNSYNPSAPGSVIDKIGN-PERMVTAITCK  462

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            RNV +LDI S  MLG YGFL  VF+ FE    SVDV+A+SEVS+S+TLD          Q
Sbjct  463  RNVKLLDIHSLNMLGAYGFLGAVFADFEKHKCSVDVLASSEVSVSVTLDKK--------Q  514

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               ++  +  +L K A V L + R+I++LI +V+RSS +L   F     +GV V+M+SQG
Sbjct  515  HEEDITELCNDLSKFAEVELHRDRAILTLIADVKRSSDVLATVFRSFSAHGVQVEMMSQG  574

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFFE  119
            ASKVNIS IV + + +  +  LHS FFE
Sbjct  575  ASKVNISFIVREDQIDDAILNLHSCFFE  602



>ref|WP_027728545.1| aspartate kinase [Treponema sp. C6A8]
Length=441

 Score =   193 bits (490),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 141/207 (68%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN ++PG++I +        + +I   
Sbjct  245  EAQELAMFGAQVLHPRSMVPCRKTGTPVRVKNSYNIQSPGSIIVEKHTGKVPPVCAITTV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +++T++DI S+RMLG  GFLA VF+ F    +S+DV+ATSEVS+SLT           + 
Sbjct  305  KHITLIDIVSSRMLGAAGFLAHVFNNFLKWNVSIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              S+L  +V++LE+ + V++   +SI++++ +   SS IL   F VL   G+NVQMISQG
Sbjct  354  TKSDLSGLVKDLEEASEVSVHTGKSIVTIVCDAAHSSAILASGFAVLADEGINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EA++ V+ LH AFF
Sbjct  414  ASKVNISMIVDDDEADKTVQILHGAFF  440



>ref|WP_013758817.1| aspartate kinase [Treponema brennaborense]
 gb|AEE17112.1| aspartate kinase [Treponema brennaborense DSM 12168]
Length=448

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/207 (47%), Positives = 138/207 (67%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGAQVLHP+SM P R+ G PVRVKNSYN  +PG++I +      A + +I   
Sbjct  245  EAAELAYFGAQVLHPRSMMPCRKSGTPVRVKNSYNMTSPGSIIVENHAGPVAAVRAITAV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VT++DI STRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT           + 
Sbjct  305  KHVTLIDIVSTRMLGASGFLAHIFNQFLKWNISIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +++K+A       ++I+++I +  R+S I+   F  L    +NVQMIS+G
Sbjct  354  TKADLSGLLADVQKVAATECKTGKAIVTVICDTARASSIIADGFAALARERINVQMISKG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+I +DSEA+  V  LH+A+F
Sbjct  414  ASKVNISMICDDSEADTVVRTLHAAYF  440



>ref|WP_038080481.1| aspartate kinase [Treponema socranskii]
Length=441

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I   
Sbjct  245  EAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAITGV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT           + 
Sbjct  305  KHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMISQG
Sbjct  354  TKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EA++ V  LH A+F
Sbjct  414  ASKVNISMIVDDEEADKTVRVLHKAYF  440



>ref|WP_016521831.1| aspartate kinase [Treponema socranskii]
 gb|EPF25671.1| aspartate kinase [Treponema socranskii subsp. paredis ATCC 35535]
Length=441

 Score =   190 bits (483),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I   
Sbjct  245  EAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAITGV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT           + 
Sbjct  305  KHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMISQG
Sbjct  354  TKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EA++ V  LH A+F
Sbjct  414  ASKVNISMIVDDEEADKTVRVLHKAYF  440



>gb|ERF61453.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
 gb|ERJ98210.1| amino acid kinase family protein [Treponema socranskii subsp. 
socranskii VPI DR56BR1116 = ATCC 35536]
Length=456

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA+FGAQVLHP+SM P R    PVRVKNSYN ++PG++I +T +   + + +I   
Sbjct  260  EAQELAFFGAQVLHPRSMLPCRRTATPVRVKNSYNIESPGSIIVETHNGKASPVCAITGV  319

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            ++VT++DIASTRMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT           + 
Sbjct  320  KHVTLIDIASTRMLGAVGFLAHIFNQFLKWNISIDVIATSEVSVSLT-----------VN  368

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +L  +A V     ++I+S+I +   SS IL   F  L    +NVQMISQG
Sbjct  369  TKTDLSGLIRDLSDVAEVRTRSGKAIVSIICDALHSSAILAAGFKALSDENINVQMISQG  428

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EA++ V  LH A+F
Sbjct  429  ASKVNISMIVDDEEADKTVRVLHKAYF  455



>ref|WP_009104632.1| aspartate kinase [Treponema sp. JC4]
 gb|EID85312.1| aspartate kinase [Treponema sp. JC4]
Length=441

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 139/207 (67%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN ++PG++I +        + +I   
Sbjct  245  EAQELAMFGAQVLHPRSMVPCRKTGTPVRVKNSYNIQSPGSIIVEKHTGKVPPVCAITTV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +++T++DI S+RMLG  GFLA VF+ F    +S+DV+ATSEVS+SLT           + 
Sbjct  305  KHITLIDIVSSRMLGAAGFLAHVFNNFLKWNVSIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +LE+ + V++   +SI+++I +   SS IL   F  L   G+NVQMISQG
Sbjct  354  TKADLSGLISDLEQASEVSVHTGKSIVTIICDAAHSSAILASGFAALSDEGINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EAE+ V+ LH AFF
Sbjct  414  ASKVNISMIVDDDEAEKTVKILHKAFF  440



>ref|WP_022933427.1| aspartate kinase [Treponema bryantii]
Length=441

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 141/207 (68%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA FGAQVLHP+SM P R+ G PVRVKNSYN  +PG++I +  +     + +I   
Sbjct  245  EAQELAMFGAQVLHPRSMLPVRKTGTPVRVKNSYNITSPGSIIVEKHNGKVPPVCAITTV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +++T++DI S+RMLG  GFLA +F+ F    IS+DV+ATSEVS+SLT           + 
Sbjct  305  KHITLIDIVSSRMLGAAGFLAHIFNNFLKWNISIDVIATSEVSVSLT-----------VN  353

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
              ++L  ++ +LE+ + V++ + ++I+++I +   SS IL   F  L   G+NVQMISQG
Sbjct  354  TKADLTGLIADLEQASQVSVRKDKAIVTIICDAAHSSAILASGFDALADEGINVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS+IV+D EA++ V+ LH+A+F
Sbjct  414  ASKVNISMIVDDDEADRTVQILHNAYF  440



>gb|EMS60633.1| hypothetical protein TRIUR3_25086 [Triticum urartu]
Length=291

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 111/197 (56%), Positives = 138/197 (70%), Gaps = 8/197 (4%)
 Frame = -2

Query  691  MRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLKRNVTMLDI--ASTRMLG  518
            M+ A EGGI V VKNSYNP+A GT+ITKTRDMS+++LTSI LK N+T+LDI   ST  L 
Sbjct  1    MQIAVEGGIKVTVKNSYNPQARGTVITKTRDMSKSILTSIALKSNITILDIERTSTLDLD  60

Query  517  QYGFLAKVFSIFED---LGISVDVVATSEVSISLTLDPSKLWSRDLIQQASELDHVVEEL  347
            Q  F+ K  SIF++   L ISVD +ATSE  +S TL PSKL SR+LIQ A  LD  V+EL
Sbjct  61   QNAFVEKAISIFQNFEYLSISVDWIATSEGKVSFTLVPSKLLSRELIQPA--LDMSVQEL  118

Query  346  EKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQGASKV-NISLIVN  170
            + IA V+ L   S+ISLIG   RS  IL K   +L +  V V+ +SQG SKV  +SL+V+
Sbjct  119  QTIADVHRLHDMSVISLIGKPGRSIDILGKVLSILQSRDVAVEKVSQGVSKVTKVSLVVH  178

Query  169  DSEAEQCVEALHSAFFE  119
            D+ A  CV+ALHSAFFE
Sbjct  179  DTVANHCVQALHSAFFE  195



>ref|WP_004266577.1| aspartate kinase [Treponema saccharophilum]
 gb|EIC03081.1| aspartate kinase [Treponema saccharophilum DSM 2985]
Length=441

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 138/207 (67%), Gaps = 11/207 (5%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EA ELA FG+QVLHP+SM P R  G PVRVKNSYN K+PG++I +        +T+I   
Sbjct  245  EAQELAMFGSQVLHPRSMIPCRRTGTPVRVKNSYNIKSPGSVIVEKHSGETPRVTAITSV  304

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            + VT++DI S+RMLG  GFLA +F+ F    +S+DV+ATSEVS+SLT++  K        
Sbjct  305  KGVTLIDIESSRMLGAAGFLAHIFNQFLKWELSIDVIATSEVSVSLTVNTKK--------  356

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMISQG  203
               +L  +V +LEK + V + + ++I+++I +  RSS IL   F  L   GVNVQMISQG
Sbjct  357  ---DLSGLVADLEKASKVVVKKDKAIVTIICDATRSSSILSDVFTALGREGVNVQMISQG  413

Query  202  ASKVNISLIVNDSEAEQCVEALHSAFF  122
            ASKVNIS++V+ SEA + V+ LH A F
Sbjct  414  ASKVNISMLVDASEANRVVQILHGALF  440



>ref|XP_005713499.1| unnamed protein product [Chondrus crispus]
 emb|CDF33680.1| unnamed protein product [Chondrus crispus]
Length=608

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 143/210 (68%), Gaps = 9/210 (4%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDM-SEAVLTSIVL  566
            EAAE+A+FGA+VLHP +M PA  G IPVRVKNSYNP  PGT+I ++R+  +E  +T++ +
Sbjct  406  EAAEMAFFGAKVLHPIAMLPAMRGNIPVRVKNSYNPDHPGTVILRSREFDNENPVTAVSV  465

Query  565  KRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLI  386
            K+NV ++D+ STRMLG  GFLA+VF  F    ISVD++ATSEVSIS+TLD S       +
Sbjct  466  KKNVQIVDVVSTRMLGASGFLAEVFKAFAYHKISVDMIATSEVSISMTLDNS-------V  518

Query  385  QQASELDHVVEELEKIAVVNLLQ-HRSIISLIGNVQRSSLILEKAFHVLLTNGVNVQMIS  209
               + L  +  +L  IA V+  + +++IISL+ +  RSS ++ +A   L    + V MIS
Sbjct  519  CDDTILHQLTADLSTIATVSFSENNKAIISLVSDSARSSEVVGRAVTALDRERIKVLMIS  578

Query  208  QGASKVNISLIVNDSEAEQCVEALHSAFFE  119
            QGASK N+S+ ++ ++A++ V A+H  FF 
Sbjct  579  QGASKFNVSVTIDGTDAKKAVRAVHKEFFH  608



>ref|XP_003884193.1| Aspartokinase/homoserine dehydrogenase, related [Neospora caninum 
Liverpool]
 emb|CBZ54162.1| Aspartokinase/homoserine dehydrogenase, related [Neospora caninum 
Liverpool]
Length=476

 Score =   175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 145/215 (67%), Gaps = 16/215 (7%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTR----DMSEAVL--  581
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP+ PGTL+ +      D S A +  
Sbjct  253  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPEHPGTLVVQAEPSGGDASLAAVPD  312

Query  580  --TSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSK  407
              T++  +R++T++D+ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+  K
Sbjct  313  GVTAVTYQRDITVVDVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE--K  370

Query  406  LWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTNGV  227
              S D I++  E       L   +  ++ + ++++S++GN++  + I+ +    L   GV
Sbjct  371  DTSEDKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLENCNEIVARTCIALTKIGV  424

Query  226  NVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
             +Q+IS G SKVN++  V D+E  + V+A+H A F
Sbjct  425  TMQLISCGTSKVNLTFCVEDAEVHRVVQAVHDALF  459



>gb|KFH09919.1| aspartokinase, partial [Toxoplasma gondii MAS]
Length=347

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDMS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              S
Sbjct  123  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAHPTAAS  182

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  183  DGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  240

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L   
Sbjct  241  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTKI  293

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  294  GVTVQLISCGTSKVNFTFCVEDTDVYRVVQAVHDALF  330



>gb|KFG51953.1| aspartokinase, partial [Toxoplasma gondii FOU]
 gb|KFG60988.1| aspartokinase, partial [Toxoplasma gondii RUB]
 gb|KFH12996.1| aspartokinase, partial [Toxoplasma gondii VAND]
Length=347

 Score =   168 bits (426),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDMS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              S
Sbjct  123  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAHPTAAS  182

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  183  DGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  240

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L   
Sbjct  241  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTKI  293

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  294  GVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  330



>ref|XP_008882085.1| aspartokinase [Hammondia hammondi]
 gb|KEP67650.1| aspartokinase [Hammondia hammondi]
Length=477

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 144/217 (66%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRD----------MS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP+ PGT I +T            +S
Sbjct  253  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPEHPGTRIVQTVSSAGVPAHPTVVS  312

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++D+ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  313  DGV-TAVTYQRDITVIDVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  370

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++  + I+ +    L   
Sbjct  371  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLESCNEIVARTCIALTKI  423

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV +Q+IS G SKVN +  V D++  + V+A+H A F
Sbjct  424  GVTMQLISCGTSKVNFTFCVEDADVHRVVQAVHDALF  460



>ref|WP_031497328.1| aspartate kinase [Bryobacter aggregatus]
Length=440

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/208 (46%), Positives = 132/208 (63%), Gaps = 14/208 (7%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKTRDMSEAVLTSIVLK  563
            EAAELAYFGA+VLHP ++ PA E  IPV + NS  P+  GT IT     S+AV  SI  K
Sbjct  237  EAAELAYFGAKVLHPSTVVPAIEKNIPVLILNSRRPEVAGTRITAEGPKSKAVAKSIACK  296

Query  562  RNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDPSKLWSRDLIQ  383
            +++T+++I STRML  +GFL ++F IF+    SVD++ATSEVS+SLT+D           
Sbjct  297  KSITLVNIQSTRMLMAHGFLKRIFEIFDRYETSVDMIATSEVSVSLTID-----------  345

Query  382  QASELDHVVEELEKIAVVNLLQHRSIISLIG-NVQRSSLILEKAFHVLLTNGVNVQMISQ  206
             AS LD +  ELE+ A V   Q ++I+ L+G N++  S +  + F  L    VNV+MISQ
Sbjct  346  NASRLDTIRRELEEFAEVESEQDKAIVCLVGDNIRWQSGVAHRVFRAL--ENVNVRMISQ  403

Query  205  GASKVNISLIVNDSEAEQCVEALHSAFF  122
            GAS  N+S++V  S+  + VE LH  FF
Sbjct  404  GASLRNLSVVVAQSDLREAVECLHREFF  431



>ref|XP_002366362.1| aspartate kinase, putative [Toxoplasma gondii ME49]
Length=477

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDMS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              S
Sbjct  253  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAQPTAAS  312

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  313  DGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  370

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L   
Sbjct  371  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTKI  423

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  424  GVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  460



>gb|EPT27208.1| aspartokinase [Toxoplasma gondii ME49]
Length=479

 Score =   167 bits (424),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDMS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              S
Sbjct  255  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAQPTAAS  314

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  315  DGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  372

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L   
Sbjct  373  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTKI  425

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  426  GVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  462



>gb|EPR62313.1| aspartokinase [Toxoplasma gondii GT1]
 gb|ESS32699.1| aspartokinase [Toxoplasma gondii VEG]
 gb|KFG45182.1| aspartokinase [Toxoplasma gondii GAB2-2007-GAL-DOM2]
Length=479

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 91/217 (42%), Positives = 142/217 (65%), Gaps = 19/217 (9%)
 Frame = -2

Query  742  EAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNPKAPGTLITKT----------RDMS  593
            +A+ELAYFGA+V+HP++M PA +  IPVRVKNSYNP  PGT I +              S
Sbjct  255  QASELAYFGAKVIHPKTMLPAMKHNIPVRVKNSYNPGHPGTRIVQAVPSAGVPAHPTAAS  314

Query  592  EAVLTSIVLKRNVTMLDIASTRMLGQYGFLAKVFSIFEDLGISVDVVATSEVSISLTLDP  413
            + V T++  +R++T++++ STRMLG +GFLA++FSI + L IS+DVVATSEVS+SL+L+ 
Sbjct  315  DGV-TAVTYQRDITVIEVNSTRMLGAHGFLARLFSICDQLDISIDVVATSEVSVSLSLE-  372

Query  412  SKLWSRDLIQQASELDHVVEELEKIAVVNLLQHRSIISLIGNVQRSSLILEKAFHVLLTN  233
             K  S + I++  E       L   +  ++ + ++++S++GN++R + I+ +    L   
Sbjct  373  -KNTSENKIEKLQEC------LSSFSTTSVRRGKALVSIVGNLERCNEIVARTCIALTKI  425

Query  232  GVNVQMISQGASKVNISLIVNDSEAEQCVEALHSAFF  122
            GV VQ+IS G SKVN +  V D++  + V+A+H A F
Sbjct  426  GVTVQLISCGTSKVNFTFCVEDADVYRVVQAVHDALF  462



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210