BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031I04

Length=699
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009623017.1|  PREDICTED: enolase                                 354   2e-117   Nicotiana tomentosiformis
ref|XP_004249573.1|  PREDICTED: enolase-like                            349   2e-115   
ref|XP_009764205.1|  PREDICTED: enolase-like                            349   2e-115   Nicotiana sylvestris
gb|ACR56690.1|  enolase                                                 349   3e-115   Nicotiana tabacum [American tobacco]
ref|XP_009612088.1|  PREDICTED: enolase-like                            348   3e-115   Nicotiana tomentosiformis
ref|XP_006341172.1|  PREDICTED: enolase-like                            348   5e-115   Solanum tuberosum [potatoes]
ref|XP_006338945.1|  PREDICTED: enolase-like                            348   8e-115   Solanum tuberosum [potatoes]
ref|NP_001234080.1|  enolase                                            346   3e-114   Solanum lycopersicum
emb|CDP15353.1|  unnamed protein product                                344   2e-113   Coffea canephora [robusta coffee]
ref|XP_010910644.1|  PREDICTED: enolase 2-like                          333   9e-113   Elaeis guineensis
gb|AEQ94123.1|  putative enolase                                        333   1e-112   Elaeis guineensis
ref|XP_011094426.1|  PREDICTED: enolase                                 340   4e-112   Sesamum indicum [beniseed]
gb|ABR25736.1|  enolase                                                 332   9e-112   Oryza sativa Indica Group [Indian rice]
gb|KJB16685.1|  hypothetical protein B456_002G243100                    339   1e-111   Gossypium raimondii
gb|KJB36422.1|  hypothetical protein B456_006G158500                    336   2e-111   Gossypium raimondii
dbj|BAD94751.1|  enolase                                                332   2e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KJB16679.1|  hypothetical protein B456_002G243100                    339   2e-111   Gossypium raimondii
gb|KHG13187.1|  Enolase 1                                               339   2e-111   Gossypium arboreum [tree cotton]
gb|KJB16684.1|  hypothetical protein B456_002G243100                    339   2e-111   Gossypium raimondii
gb|KJB16683.1|  hypothetical protein B456_002G243100                    339   2e-111   Gossypium raimondii
gb|ABW21688.1|  enolase                                                 339   2e-111   Gossypium hirsutum [American cotton]
gb|AFK43733.1|  unknown                                                 332   6e-111   Medicago truncatula
emb|CAA41116.1|  enolase                                                333   1e-110   Solanum lycopersicum
gb|KJB36420.1|  hypothetical protein B456_006G158500                    337   1e-110   Gossypium raimondii
ref|XP_006481907.1|  PREDICTED: enolase-like                            337   1e-110   Citrus sinensis [apfelsine]
ref|XP_010050008.1|  PREDICTED: enolase 1                               337   1e-110   Eucalyptus grandis [rose gum]
gb|KDO61018.1|  hypothetical protein CISIN_1g043137mg                   337   2e-110   Citrus sinensis [apfelsine]
ref|NP_001064223.1|  Os10g0167300                                       337   2e-110   
gb|EEC66609.1|  hypothetical protein OsI_32842                          337   2e-110   Oryza sativa Indica Group [Indian rice]
ref|XP_006430313.1|  hypothetical protein CICLE_v10011726mg             337   2e-110   Citrus clementina [clementine]
sp|Q42971.2|ENO_ORYSJ  RecName: Full=Enolase; AltName: Full=2-pho...    337   2e-110   Oryza sativa Japonica Group [Japonica rice]
gb|KHF99213.1|  Enolase 2                                               337   2e-110   Gossypium arboreum [tree cotton]
ref|XP_010527847.1|  PREDICTED: bifunctional enolase 2/transcript...    337   2e-110   Tarenaya hassleriana [spider flower]
ref|XP_010558960.1|  PREDICTED: bifunctional enolase 2/transcript...    336   3e-110   Tarenaya hassleriana [spider flower]
gb|KJB07832.1|  hypothetical protein B456_001G046400                    332   3e-110   Gossypium raimondii
ref|XP_011101486.1|  PREDICTED: enolase-like                            336   4e-110   Sesamum indicum [beniseed]
gb|ABB46861.2|  Enolase, putative, expressed                            337   4e-110   Oryza sativa Japonica Group [Japonica rice]
gb|ABB46862.2|  Enolase, putative, expressed                            337   4e-110   Oryza sativa Japonica Group [Japonica rice]
gb|KFK34543.1|  hypothetical protein AALP_AA5G159700                    335   5e-110   Arabis alpina [alpine rockcress]
ref|XP_006851831.1|  hypothetical protein AMTR_s00041p00062460          335   6e-110   Amborella trichopoda
emb|CAB96173.1|  enolase                                                335   6e-110   Spinacia oleracea
gb|AAC49173.1|  enolase                                                 335   1e-109   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002877895.1|  enolase                                            334   2e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_006661656.1|  PREDICTED: enolase-like                            334   2e-109   Oryza brachyantha
ref|XP_006294225.1|  hypothetical protein CARUB_v10023223mg             334   2e-109   Capsella rubella
ref|XP_007027607.1|  Enolase                                            334   2e-109   
ref|XP_002881452.1|  hypothetical protein ARALYDRAFT_902771             333   2e-109   Arabidopsis lyrata subsp. lyrata
gb|KEH24120.1|  phosphopyruvate hydratase                               332   3e-109   Medicago truncatula
gb|AAS66001.1|  LOS2                                                    333   3e-109   Capsella bursa-pastoris
ref|XP_010907928.1|  PREDICTED: enolase-like                            333   3e-109   Elaeis guineensis
ref|XP_010515776.1|  PREDICTED: bifunctional enolase 2/transcript...    333   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010509461.1|  PREDICTED: bifunctional enolase 2/transcript...    333   4e-109   Camelina sativa [gold-of-pleasure]
ref|XP_009353019.1|  PREDICTED: enolase-like                            333   4e-109   Pyrus x bretschneideri [bai li]
gb|AAM12985.1|  enolase (2-phospho-D-glycerate hydroylase)              333   4e-109   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ18140.1|  enolase                                                 333   4e-109   Gossypium barbadense [Egyptian cotton]
ref|XP_010426928.1|  PREDICTED: bifunctional enolase 2/transcript...    333   5e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010516879.1|  PREDICTED: bifunctional enolase 2/transcript...    333   5e-109   Camelina sativa [gold-of-pleasure]
gb|AAL59917.1|  putative enolase (2-phospho-D-glycerate hydroylase)     333   5e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KDP22386.1|  hypothetical protein JCGZ_26217                         333   5e-109   Jatropha curcas
ref|XP_011018872.1|  PREDICTED: enolase 2                               333   5e-109   Populus euphratica
ref|NP_181192.1|  bifunctional enolase 2/transcriptional activator      333   5e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010096850.1|  hypothetical protein L484_003561                   333   5e-109   Morus notabilis
ref|XP_006291136.1|  hypothetical protein CARUB_v10017251mg             333   6e-109   Capsella rubella
ref|XP_008391739.1|  PREDICTED: enolase-like                            333   6e-109   Malus domestica [apple tree]
emb|CBI24517.3|  unnamed protein product                                333   6e-109   Vitis vinifera
ref|XP_010504049.1|  PREDICTED: bifunctional enolase 2/transcript...    333   6e-109   Camelina sativa [gold-of-pleasure]
ref|XP_006381325.1|  phosphopyruvate hydratase family protein           332   8e-109   Populus trichocarpa [western balsam poplar]
gb|KEH24119.1|  phosphopyruvate hydratase                               332   1e-108   Medicago truncatula
sp|P42896.1|ENO_RICCO  RecName: Full=Enolase; AltName: Full=2-pho...    332   1e-108   Ricinus communis
ref|XP_002528580.1|  enolase, putative                                  332   1e-108   
emb|CDY65842.1|  BnaAnng21140D                                          332   1e-108   Brassica napus [oilseed rape]
ref|XP_010505199.1|  PREDICTED: bifunctional enolase 2/transcript...    332   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_004143301.1|  PREDICTED: enolase-like                            332   1e-108   Cucumis sativus [cucumbers]
ref|XP_010243562.1|  PREDICTED: enolase 1                               332   1e-108   Nelumbo nucifera [Indian lotus]
ref|XP_004962569.1|  PREDICTED: enolase 2-like isoform X2               332   1e-108   Setaria italica
ref|XP_009141601.1|  PREDICTED: bifunctional enolase 2/transcript...    332   1e-108   Brassica rapa
ref|XP_010933076.1|  PREDICTED: enolase 2                               332   1e-108   Elaeis guineensis
gb|ABD92697.1|  los                                                     332   2e-108   Brassica rapa subsp. chinensis [bok-choy]
gb|AFB35652.1|  enolase                                                 332   2e-108   Phytolacca americana [common pokeberry]
ref|XP_009365316.1|  PREDICTED: enolase                                 332   2e-108   Pyrus x bretschneideri [bai li]
gb|AAL06912.1|  At2g36530/F1O11.16                                      332   2e-108   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LEJ0.1|ENO1_HEVBR  RecName: Full=Enolase 1; AltName: Full=2-...    331   2e-108   Hevea brasiliensis [jebe]
ref|XP_009143574.1|  PREDICTED: bifunctional enolase 2/transcript...    331   2e-108   Brassica rapa
emb|CDY33161.1|  BnaC04g08780D                                          331   2e-108   Brassica napus [oilseed rape]
ref|XP_003558351.1|  PREDICTED: enolase 2                               331   2e-108   Brachypodium distachyon [annual false brome]
sp|Q9LEI9.1|ENO2_HEVBR  RecName: Full=Enolase 2; AltName: Full=2-...    331   2e-108   Hevea brasiliensis [jebe]
gb|ACN26258.1|  unknown                                                 331   2e-108   Zea mays [maize]
ref|XP_003521438.1|  PREDICTED: enolase-like                            331   2e-108   Glycine max [soybeans]
ref|XP_010277374.1|  PREDICTED: enolase-like                            331   2e-108   Nelumbo nucifera [Indian lotus]
gb|ACG31732.1|  enolase                                                 331   2e-108   Zea mays [maize]
ref|NP_001105371.1|  enolase 2                                          331   2e-108   Zea mays [maize]
ref|NP_001237329.1|  enolase                                            331   4e-108   
ref|XP_002267091.2|  PREDICTED: enolase                                 333   4e-108   Vitis vinifera
emb|CDX84555.1|  BnaA03g16750D                                          330   4e-108   
ref|XP_008462531.1|  PREDICTED: enolase                                 330   4e-108   Cucumis melo [Oriental melon]
gb|KJB07831.1|  hypothetical protein B456_001G046400                    330   4e-108   Gossypium raimondii
ref|XP_007162849.1|  hypothetical protein PHAVU_001G186100g             330   4e-108   Phaseolus vulgaris [French bean]
ref|XP_009133088.1|  PREDICTED: bifunctional enolase 2/transcript...    330   5e-108   Brassica rapa
emb|CDX79684.1|  BnaC03g20200D                                          330   5e-108   
ref|XP_003573806.1|  PREDICTED: enolase                                 330   6e-108   Brachypodium distachyon [annual false brome]
gb|KHN02262.1|  Enolase                                                 330   7e-108   Glycine soja [wild soybean]
gb|KHN18726.1|  Enolase                                                 330   7e-108   Glycine soja [wild soybean]
gb|EMT10090.1|  Enolase 1                                               330   8e-108   
gb|EMS66544.1|  Enolase 1                                               330   8e-108   Triticum urartu
gb|AFW85966.1|  enolase1                                                330   8e-108   
sp|Q43321.1|ENO_ALNGL  RecName: Full=Enolase; AltName: Full=2-pho...    329   9e-108   Alnus glutinosa
gb|EEC74867.1|  hypothetical protein OsI_10758                          330   1e-107   Oryza sativa Indica Group [Indian rice]
gb|AFW85964.1|  enolase1                                                330   1e-107   
ref|NP_001049556.1|  Os03g0248600                                       330   1e-107   
ref|XP_009401920.1|  PREDICTED: enolase-like                            329   1e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105896.1|  enolase 1                                          329   2e-107   Zea mays [maize]
ref|XP_003557232.1|  PREDICTED: enolase 1                               329   2e-107   Brachypodium distachyon [annual false brome]
ref|XP_008241309.1|  PREDICTED: enolase                                 329   2e-107   Prunus mume [ume]
ref|XP_004494139.1|  PREDICTED: enolase-like                            329   2e-107   
ref|XP_007202055.1|  hypothetical protein PRUPE_ppa005779mg             329   2e-107   Prunus persica
gb|AEW69686.1|  enolase1                                                329   2e-107   Guzmania wittmackii x Guzmania lingulata
ref|XP_006403746.1|  hypothetical protein EUTSA_v10010379mg             329   2e-107   Eutrema salsugineum [saltwater cress]
ref|XP_010050038.1|  PREDICTED: enolase-like                            329   2e-107   Eucalyptus grandis [rose gum]
gb|AAQ77241.1|  enolase                                                 329   2e-107   Brassica napus [oilseed rape]
ref|XP_008386927.1|  PREDICTED: enolase                                 329   2e-107   
ref|XP_006403745.1|  hypothetical protein EUTSA_v10010378mg             328   2e-107   
ref|XP_007152407.1|  hypothetical protein PHAVU_004G127500g             329   2e-107   Phaseolus vulgaris [French bean]
ref|XP_004964466.1|  PREDICTED: enolase 1-like isoform X4               328   2e-107   Setaria italica
ref|XP_010278245.1|  PREDICTED: enolase 1-like                          328   3e-107   Nelumbo nucifera [Indian lotus]
ref|XP_007038456.1|  Enolase isoform 1                                  328   3e-107   Theobroma cacao [chocolate]
gb|KFK32725.1|  hypothetical protein AALP_AA6G281000                    328   3e-107   Arabis alpina [alpine rockcress]
ref|XP_002322420.1|  hypothetical protein POPTR_0015s14380g             328   3e-107   Populus trichocarpa [western balsam poplar]
gb|EYU35120.1|  hypothetical protein MIMGU_mgv1a006438mg                328   4e-107   Erythranthe guttata [common monkey flower]
ref|XP_002283632.1|  PREDICTED: enolase 1                               328   4e-107   Vitis vinifera
gb|KDP22388.1|  hypothetical protein JCGZ_26219                         328   5e-107   Jatropha curcas
ref|XP_004964465.1|  PREDICTED: enolase 1-like isoform X3               328   5e-107   
ref|XP_008376333.1|  PREDICTED: enolase                                 328   5e-107   Malus domestica [apple tree]
ref|XP_009384633.1|  PREDICTED: enolase                                 328   5e-107   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534043.1|  PREDICTED: enolase                                 327   7e-107   Glycine max [soybeans]
ref|XP_008234357.1|  PREDICTED: enolase                                 327   7e-107   Prunus mume [ume]
ref|XP_010683886.1|  PREDICTED: enolase                                 327   7e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011041692.1|  PREDICTED: enolase                                 327   7e-107   Populus euphratica
ref|XP_009374527.1|  PREDICTED: enolase                                 327   7e-107   Pyrus x bretschneideri [bai li]
ref|XP_003548246.1|  PREDICTED: enolase-like                            327   7e-107   Glycine max [soybeans]
gb|ACN50180.1|  enolase                                                 327   9e-107   Annona cherimola [cherimoya]
ref|XP_004303035.1|  PREDICTED: enolase                                 327   1e-106   Fragaria vesca subsp. vesca
gb|AAQ77240.1|  enolase                                                 327   1e-106   Brassica rapa subsp. oleifera [biennial turnip rape]
gb|AAA21277.1|  2-phospho-D-glycerate hydrolase                         327   1e-106   Mesembryanthemum crystallinum
ref|NP_001056727.1|  Os06g0136600                                       327   1e-106   
dbj|BAJ85279.1|  predicted protein                                      327   1e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002510911.1|  enolase, putative                                  327   2e-106   Ricinus communis
gb|EEE65047.1|  hypothetical protein OsJ_20044                          327   2e-106   Oryza sativa Japonica Group [Japonica rice]
gb|ACL53816.1|  unknown                                                 326   2e-106   Zea mays [maize]
ref|XP_004308163.1|  PREDICTED: enolase                                 326   2e-106   Fragaria vesca subsp. vesca
ref|XP_007218006.1|  hypothetical protein PRUPE_ppa005739mg             326   2e-106   Prunus persica
dbj|BAJ90134.1|  predicted protein                                      326   3e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008778664.1|  PREDICTED: enolase-like                            326   3e-106   Phoenix dactylifera
emb|CAB75428.1|  enolase                                                326   3e-106   Lupinus luteus
ref|XP_006656609.1|  PREDICTED: enolase 1-like                          326   4e-106   
ref|XP_008791284.1|  PREDICTED: enolase isoform X1                      325   4e-106   Phoenix dactylifera
gb|AEM97875.1|  enolase                                                 326   4e-106   Corylus heterophylla
ref|XP_004514974.1|  PREDICTED: enolase-like                            325   4e-106   Cicer arietinum [garbanzo]
sp|Q43130.1|ENO_MESCR  RecName: Full=Enolase; AltName: Full=2-pho...    325   4e-106   Mesembryanthemum crystallinum
gb|AES75861.2|  phosphopyruvate hydratase                               325   5e-106   Medicago truncatula
ref|XP_010050020.1|  PREDICTED: enolase-like isoform X1                 327   5e-106   Eucalyptus grandis [rose gum]
ref|XP_003619643.1|  Enolase                                            324   7e-106   
ref|XP_009393022.1|  PREDICTED: enolase-like                            323   2e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO38071.1|  hypothetical protein CISIN_1g040341mg                   317   2e-105   Citrus sinensis [apfelsine]
gb|AGH20061.1|  enolase                                                 323   4e-105   Triticum aestivum [Canadian hard winter wheat]
gb|AGH20062.1|  enolase                                                 323   4e-105   Triticum aestivum [Canadian hard winter wheat]
gb|AIR93791.1|  enolase                                                 322   6e-105   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KJB36423.1|  hypothetical protein B456_006G158500                    322   9e-105   Gossypium raimondii
ref|XP_010068982.1|  PREDICTED: enolase 1-like                          316   4e-104   
gb|KHG20587.1|  Enolase 2                                               319   8e-104   Gossypium arboreum [tree cotton]
gb|ABR16337.1|  unknown                                                 319   9e-104   Picea sitchensis
gb|ABR17990.1|  unknown                                                 318   2e-103   Picea sitchensis
emb|CDX73592.1|  BnaC08g24110D                                          318   4e-103   
ref|XP_006421751.1|  hypothetical protein CICLE_v10004965mg             317   5e-103   Citrus clementina [clementine]
gb|ACN39925.1|  unknown                                                 317   9e-103   Picea sitchensis
ref|XP_006490248.1|  PREDICTED: enolase-like                            315   5e-102   Citrus sinensis [apfelsine]
gb|KDO65391.1|  hypothetical protein CISIN_1g013317mg                   315   5e-102   Citrus sinensis [apfelsine]
ref|XP_010094249.1|  hypothetical protein L484_001983                   314   6e-102   
ref|XP_002984551.1|  hypothetical protein SELMODRAFT_120189             314   1e-101   Selaginella moellendorffii
ref|XP_002965441.1|  hypothetical protein SELMODRAFT_167539             314   1e-101   Selaginella moellendorffii
gb|KJB07830.1|  hypothetical protein B456_001G046400                    312   1e-100   Gossypium raimondii
emb|CDX78136.1|  BnaA09g33310D                                          301   2e-99    
ref|XP_001751336.1|  predicted protein                                  299   6e-96    
ref|XP_001751337.1|  predicted protein                                  299   6e-96    
gb|KHN24421.1|  Enolase                                                 299   9e-96    Glycine soja [wild soybean]
gb|AAM74365.1|AC116603_1  Putative enolase (2-phospho-D-glycerate...    288   2e-93    Oryza sativa Japonica Group [Japonica rice]
gb|KJB16682.1|  hypothetical protein B456_002G243100                    291   4e-93    Gossypium raimondii
gb|ABG65935.1|  Enolase, putative, expressed                            290   5e-92    Oryza sativa Japonica Group [Japonica rice]
gb|AFW75434.1|  putative enolase family protein                         286   6e-91    
ref|XP_008650330.1|  PREDICTED: enolase 1-like                          286   2e-90    Zea mays [maize]
gb|AAN04181.1|  Putative enolase (2-phospho-D-glycerate hydroylase)     284   3e-90    Oryza sativa Japonica Group [Japonica rice]
gb|ETO14807.1|  enolase 2                                               276   4e-90    Reticulomyxa filosa
ref|XP_004964464.1|  PREDICTED: enolase 1-like isoform X2               286   9e-90    
ref|XP_004964463.1|  PREDICTED: enolase 1-like isoform X1               286   1e-89    
ref|XP_008798541.1|  PREDICTED: enolase 2-like                          280   2e-89    
gb|AAY34909.1|  enolase                                                 270   9e-89    Prunus armeniaca
ref|XP_005716244.1|  enolase                                            281   1e-88    Chondrus crispus [carageen]
gb|EMS57999.1|  Enolase                                                 279   1e-88    Triticum urartu
ref|XP_008791285.1|  PREDICTED: enolase isoform X2                      280   2e-88    
ref|XP_010050029.1|  PREDICTED: enolase-like isoform X2                 279   1e-87    Eucalyptus grandis [rose gum]
gb|EWM28602.1|  enolase                                                 276   7e-87    Nannochloropsis gaditana
ref|XP_005791836.1|  hypothetical protein EMIHUDRAFT_420746             277   9e-87    Emiliania huxleyi CCMP1516
gb|EMT25998.1|  Enolase                                                 276   1e-86    
ref|XP_004362164.1|  phosphopyruvate hydratase                          273   1e-85    Cavenderia fasciculata
gb|EMS64258.1|  Enolase 2                                               279   1e-85    Triticum urartu
sp|P56252.1|ENO_HOMGA  RecName: Full=Enolase; AltName: Full=2-pho...    271   5e-85    Homarus gammarus
pdb|1PDZ|A  Chain A, X-Ray Structure And Catalytic Mechanism Of L...    271   5e-85    Homarus gammarus
emb|CBJ32586.1|  enolase                                                271   5e-85    Ectocarpus siliculosus
ref|XP_003294597.1|  hypothetical protein DICPUDRAFT_93248              262   9e-85    Dictyostelium purpureum
gb|EMT07160.1|  Enolase                                                 268   1e-84    
ref|NP_001271501.1|  uncharacterized protein LOC101866389               262   1e-84    
dbj|GAM19564.1|  hypothetical protein SAMD00019534_027390               270   1e-84    Acytostelium subglobosum LB1
emb|CAI39008.1|  enolase, putative                                      270   2e-84    Paramecium tetraurelia
ref|XP_001452406.1|  hypothetical protein                               270   2e-84    Paramecium tetraurelia strain d4-2
ref|XP_002507278.1|  enolase                                            270   5e-84    Micromonas commoda
gb|KFP49382.1|  Alpha-enolase                                           260   5e-84    Cathartes aura
gb|AAC78141.1|  phosphopyruvate hydratase                               268   6e-84    Penaeus monodon [giant tiger prawn]
gb|AAH09218.2|  ENO1 protein                                            259   8e-84    Homo sapiens [man]
gb|EFA77097.1|  phosphopyruvate hydratase                               268   9e-84    Heterostelium album PN500
ref|XP_002899300.1|  enolase                                            268   1e-83    Phytophthora infestans T30-4
ref|XP_001415437.1|  predicted protein                                  268   1e-83    Ostreococcus lucimarinus CCE9901
gb|KGL76760.1|  Alpha-enolase                                           259   2e-83    Tinamus guttatus
ref|XP_002962785.1|  hypothetical protein SELMODRAFT_165356             268   2e-83    Selaginella moellendorffii
gb|ETL94004.1|  enolase                                                 258   2e-83    Phytophthora parasitica
ref|XP_002962502.1|  hypothetical protein SELMODRAFT_78644              268   2e-83    
ref|XP_005112796.1|  PREDICTED: enolase-like isoform X2                 265   2e-83    
ref|XP_011399343.1|  Enolase                                            271   3e-83    Auxenochlorella protothecoides
ref|XP_001014643.1|  enolase family protein                             267   3e-83    Tetrahymena thermophila SB210
ref|XP_003413233.1|  PREDICTED: alpha-enolase                           266   3e-83    Loxodonta africana [African bush elephant]
ref|XP_011404007.1|  PREDICTED: enolase-like                            266   3e-83    Amphimedon queenslandica
ref|XP_003884000.1|  unnamed protein product                            267   3e-83    Neospora caninum Liverpool
ref|XP_002164467.2|  PREDICTED: beta-enolase-like                       263   4e-83    
ref|XP_003056091.1|  predicted protein                                  267   4e-83    Micromonas pusilla CCMP1545
ref|XP_010212229.1|  PREDICTED: alpha-enolase                           258   4e-83    Tinamus guttatus
sp|Q9BPL7.1|ENO2_TOXGO  RecName: Full=Enolase 2; AltName: Full=2-...    266   4e-83    Toxoplasma gondii
emb|CCI42145.1|  unnamed protein product                                267   5e-83    Albugo candida
ref|XP_008903925.1|  enolase                                            266   5e-83    Phytophthora parasitica INRA-310
gb|EGT35057.1|  hypothetical protein CAEBREN_22407                      266   5e-83    Caenorhabditis brenneri
gb|ETO77406.1|  enolase                                                 266   6e-83    Phytophthora parasitica P1976
ref|XP_004596130.1|  PREDICTED: alpha-enolase isoform X2                264   6e-83    
ref|XP_003793296.1|  PREDICTED: alpha-enolase                           265   7e-83    Otolemur garnettii
gb|KHJ80785.1|  Enolase, TIM barrel domain protein                      257   7e-83    Oesophagostomum dentatum [nodule worm]
gb|ETI48672.1|  enolase                                                 266   8e-83    Phytophthora parasitica P1569
gb|ABF60010.1|  enolase B                                               265   1e-82    Polypterus senegalus
gb|AAH21166.2|  ENO1 protein                                            259   1e-82    Homo sapiens [man]
ref|XP_002365578.1|  enolase 2                                          266   1e-82    Toxoplasma gondii ME49
ref|XP_002716189.1|  PREDICTED: alpha-enolase                           265   1e-82    
ref|XP_004596129.1|  PREDICTED: alpha-enolase isoform X1                265   1e-82    Ochotona princeps [southern American pika]
gb|AAH04325.1|  ENO1 protein                                            259   1e-82    Homo sapiens [man]
gb|AAC39935.1|  alpha enolase like 1                                    259   1e-82    Homo sapiens [man]
ref|XP_005112795.1|  PREDICTED: enolase-like isoform X1                 265   1e-82    Aplysia californica
gb|AEE62664.1|  unknown                                                 265   1e-82    Dendroctonus ponderosae
gb|EJW76031.1|  enolase                                                 258   2e-82    Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004385192.1|  PREDICTED: alpha-enolase                           264   2e-82    Trichechus manatus latirostris
gb|AHB33499.1|  enolase                                                 264   2e-82    Nilaparvata lugens
ref|XP_004337411.1|  Enolase, Cterminal TIM barrel domain contain...    264   2e-82    Acanthamoeba castellanii str. Neff
ref|XP_009979968.1|  PREDICTED: alpha-enolase isoform X3                263   2e-82    Tauraco erythrolophus
ref|XP_005420663.1|  PREDICTED: gamma-enolase isoform X2                263   3e-82    
ref|XP_009905083.1|  PREDICTED: alpha-enolase isoform X3                263   3e-82    Picoides pubescens
ref|XP_008882278.1|  enolase 2                                          265   3e-82    
ref|XP_009067477.1|  PREDICTED: gamma-enolase isoform X2                262   3e-82    Acanthisitta chloris
ref|XP_006678086.1|  hypothetical protein BATDEDRAFT_87345              264   3e-82    Batrachochytrium dendrobatidis JAM81
emb|CEF96573.1|  Enolase, N-terminal                                    265   4e-82    Ostreococcus tauri
ref|XP_009979966.1|  PREDICTED: alpha-enolase isoform X1                263   4e-82    Tauraco erythrolophus
ref|XP_006873159.1|  PREDICTED: alpha-enolase-like                      263   4e-82    Chrysochloris asiatica
ref|NP_001166544.1|  alpha-enolase                                      263   4e-82    Cavia porcellus [guinea pig]
gb|EWM29732.1|  enolase                                                 265   4e-82    Nannochloropsis gaditana
gb|ETL41969.1|  enolase                                                 266   4e-82    Phytophthora parasitica
gb|EYB81232.1|  hypothetical protein Y032_0389g531                      258   4e-82    Ancylostoma ceylanicum
ref|XP_005835216.1|  hypothetical protein GUITHDRAFT_86064              263   4e-82    Guillardia theta CCMP2712
ref|XP_009979967.1|  PREDICTED: alpha-enolase isoform X2                263   4e-82    Tauraco erythrolophus
gb|ETK88572.1|  enolase                                                 266   4e-82    Phytophthora parasitica
gb|KFP74738.1|  Gamma-enolase                                           263   5e-82    Acanthisitta chloris
ref|XP_009815715.1|  PREDICTED: alpha-enolase isoform X1                261   5e-82    Gavia stellata
ref|XP_005004264.1|  PREDICTED: alpha-enolase isoform X3                263   5e-82    Cavia porcellus [guinea pig]
gb|KFV72305.1|  Alpha-enolase                                           263   5e-82    Picoides pubescens
ref|XP_010142229.1|  PREDICTED: alpha-enolase isoform X3                262   5e-82    Buceros rhinoceros silvestris
ref|XP_009996792.1|  PREDICTED: gamma-enolase isoform X2                262   6e-82    Chaetura pelagica
ref|XP_009905082.1|  PREDICTED: alpha-enolase isoform X2                263   6e-82    Picoides pubescens
ref|XP_009905081.1|  PREDICTED: alpha-enolase isoform X1                263   6e-82    Picoides pubescens
ref|XP_009067476.1|  PREDICTED: gamma-enolase isoform X1                263   6e-82    
gb|KFO57778.1|  Gamma-enolase                                           263   6e-82    
ref|XP_008317043.1|  PREDICTED: alpha-enolase isoform X1                263   6e-82    
ref|XP_002196516.1|  PREDICTED: gamma-enolase                           263   6e-82    
gb|AAB88178.1|  alpha enolase                                           260   6e-82    
ref|XP_005523882.1|  PREDICTED: gamma-enolase isoform X1                263   6e-82    
gb|ADH95415.1|  enolase                                                 263   6e-82    
ref|XP_009829255.1|  enolase                                            263   6e-82    
gb|ADH95416.1|  enolase                                                 263   6e-82    
ref|XP_009815716.1|  PREDICTED: alpha-enolase isoform X2                261   6e-82    
ref|XP_008317044.1|  PREDICTED: alpha-enolase isoform X2                263   6e-82    
ref|XP_005353735.1|  PREDICTED: alpha-enolase                           263   7e-82    
ref|NP_871916.1|  Protein ENOL-1, isoform b                             260   7e-82    
gb|ADK47995.1|  c-myc promoter-binding protein 1                        259   7e-82    
ref|XP_009555009.1|  PREDICTED: alpha-enolase isoform X3                261   8e-82    
ref|XP_009077260.1|  PREDICTED: alpha-enolase isoform X4                261   8e-82    
ref|XP_008572621.1|  PREDICTED: alpha-enolase                           263   8e-82    
ref|XP_009574349.1|  PREDICTED: alpha-enolase isoform X2                261   8e-82    
ref|XP_007631689.1|  PREDICTED: alpha-enolase isoform X3                263   8e-82    
ref|XP_010167924.1|  PREDICTED: gamma-enolase isoform X2                261   8e-82    
ref|XP_009459200.1|  PREDICTED: alpha-enolase isoform X3                261   8e-82    
ref|XP_008829031.1|  PREDICTED: alpha-enolase                           263   8e-82    
ref|XP_006124204.1|  PREDICTED: gamma-enolase                           263   8e-82    
ref|NP_001188412.1|  c-myc promoter-binding protein-1 isoform MBP-1     259   9e-82    
ref|XP_002631372.1|  C. briggsae CBR-ENOL-1 protein                     263   9e-82    
ref|XP_006737946.1|  PREDICTED: gamma-enolase-like                      256   9e-82    
ref|XP_006262952.1|  PREDICTED: alpha-enolase isoform X1                261   1e-81    
ref|XP_010202836.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
ref|XP_005292932.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
ref|XP_007070271.1|  PREDICTED: alpha-enolase isoform X4                261   1e-81    
gb|KFO94606.1|  Alpha-enolase                                           262   1e-81    
ref|XP_010290662.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
ref|XP_006004753.1|  PREDICTED: gamma-enolase                           259   1e-81    
ref|XP_010142227.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
ref|XP_005292933.1|  PREDICTED: alpha-enolase isoform X2                262   1e-81    
ref|XP_010114500.1|  PREDICTED: gamma-enolase isoform X2                261   1e-81    
ref|XP_003428480.1|  PREDICTED: enolase                                 262   1e-81    
emb|CAH56247.1|  hypothetical protein                                   260   1e-81    
gb|EDM05044.1|  enolase 3, beta, isoform CRA_b                          254   1e-81    
ref|XP_003116830.1|  CRE-ENOL-1 protein                                 263   1e-81    
sp|O02654.1|ENO_DORPE  RecName: Full=Enolase; AltName: Full=2-pho...    262   1e-81    
ref|XP_009945529.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
gb|KFV45015.1|  Alpha-enolase                                           261   1e-81    
ref|XP_005437123.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
ref|XP_009887875.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
gb|ETN80540.1|  phosphopyruvate hydratase                               262   1e-81    
ref|XP_639231.1|  phosphopyruvate hydratase                             262   1e-81    
ref|XP_008941413.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
gb|KFZ49625.1|  Gamma-enolase                                           262   1e-81    
ref|XP_008067145.1|  PREDICTED: alpha-enolase                           262   1e-81    
ref|XP_009539953.1|  hypothetical protein PHYSODRAFT_358108             263   1e-81    
ref|XP_009963085.1|  PREDICTED: alpha-enolase isoform X3                261   1e-81    
ref|XP_010167852.1|  PREDICTED: gamma-enolase isoform X1                262   1e-81    
ref|XP_009555006.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
ref|XP_009459199.1|  PREDICTED: alpha-enolase isoform X2                262   1e-81    
ref|XP_009077257.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
ref|XP_009459197.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
gb|KFU84150.1|  Gamma-enolase                                           262   1e-81    
ref|XP_010721061.1|  PREDICTED: alpha-enolase isoform X1                262   1e-81    
ref|XP_010142228.1|  PREDICTED: alpha-enolase isoform X2                262   1e-81    
ref|XP_009996784.1|  PREDICTED: gamma-enolase isoform X1                262   1e-81    
ref|XP_009489518.1|  PREDICTED: alpha-enolase isoform X3                261   2e-81    
ref|XP_007069701.1|  PREDICTED: gamma-enolase isoform X3                261   2e-81    
ref|XP_010721062.1|  PREDICTED: alpha-enolase isoform X2                262   2e-81    
sp|P31683.1|ENO_CHLRE  RecName: Full=Enolase; AltName: Full=2-pho...    260   2e-81    
ref|XP_007515230.1|  enolase                                            264   2e-81    
ref|XP_005644049.1|  enolase                                            263   2e-81    
gb|AAA49217.1|  alpha-enolase/tau-crystallin                            260   2e-81    
ref|XP_009930318.1|  PREDICTED: gamma-enolase isoform X2                261   2e-81    
ref|XP_009555008.1|  PREDICTED: alpha-enolase isoform X2                262   2e-81    
ref|XP_009574348.1|  PREDICTED: alpha-enolase isoform X1                262   2e-81    
ref|XP_010287651.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_009077259.1|  PREDICTED: alpha-enolase isoform X3                262   2e-81    
ref|XP_010202834.1|  PREDICTED: alpha-enolase isoform X1                262   2e-81    
ref|XP_006193124.1|  PREDICTED: alpha-enolase isoform X3                260   2e-81    
ref|XP_009498499.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
dbj|BAE48227.1|  enolase                                                258   2e-81    
gb|KFQ32392.1|  Alpha-enolase                                           261   2e-81    
ref|XP_009897918.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_005235420.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_010159038.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_009945527.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_009972305.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_009323460.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
gb|AGH13199.1|  alpha-enolase                                           261   2e-81    
ref|XP_009702628.1|  PREDICTED: alpha-enolase isoform X3                260   2e-81    
ref|XP_009581709.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_010290660.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
gb|KFP37911.1|  Gamma-enolase                                           261   2e-81    
ref|XP_005437122.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
ref|XP_009887872.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_009323459.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_005437121.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_010202835.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
ref|XP_010177180.1|  PREDICTED: gamma-enolase isoform X2                260   2e-81    
ref|XP_005146696.1|  PREDICTED: gamma-enolase                           261   2e-81    
ref|XP_007070269.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
ref|XP_005690791.1|  PREDICTED: alpha-enolase isoform X3                261   2e-81    
emb|CBL79146.1|  enolase                                                261   2e-81    
ref|XP_010114492.1|  PREDICTED: gamma-enolase isoform X1                261   2e-81    
ref|XP_010290661.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
ref|XP_009287941.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_010083754.1|  PREDICTED: alpha-enolase isoform X3                260   2e-81    
gb|KFZ51417.1|  Gamma-enolase                                           261   2e-81    
gb|KFQ59222.1|  Gamma-enolase                                           261   2e-81    
ref|XP_008941411.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_009945528.1|  PREDICTED: alpha-enolase isoform X2                261   2e-81    
ref|XP_009926114.1|  PREDICTED: alpha-enolase isoform X1                261   2e-81    
ref|XP_008938486.1|  PREDICTED: gamma-enolase isoform X2                260   3e-81    
ref|XP_009287942.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|NP_001133366.1|  Alpha-enolase                                      261   3e-81    
ref|XP_009963083.1|  PREDICTED: alpha-enolase isoform X1                261   3e-81    
ref|XP_009887873.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|XP_010902625.1|  PREDICTED: enolase isoform X1                      261   3e-81    
ref|XP_006127161.1|  PREDICTED: alpha-enolase                           261   3e-81    
ref|XP_007420481.1|  PREDICTED: gamma-enolase isoform X1                261   3e-81    
ref|XP_007070270.1|  PREDICTED: alpha-enolase isoform X3                261   3e-81    
ref|XP_011436228.1|  PREDICTED: enolase-like isoform X2                 261   3e-81    
ref|XP_007070268.1|  PREDICTED: alpha-enolase isoform X1                261   3e-81    
ref|XP_009926115.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|XP_010999093.1|  PREDICTED: alpha-enolase                           261   3e-81    
emb|CDI82390.1|  enolase 2, putative                                    259   3e-81    
ref|XP_010902627.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|XP_008941412.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|XP_010084852.1|  PREDICTED: gamma-enolase isoform X2                260   3e-81    
ref|XP_009963084.1|  PREDICTED: alpha-enolase isoform X2                261   3e-81    
ref|XP_006193122.1|  PREDICTED: alpha-enolase isoform X1                261   3e-81    
ref|XP_005016821.1|  PREDICTED: gamma-enolase isoform X2                260   3e-81    
ref|XP_008619366.1|  enolase 2                                          262   3e-81    
ref|XP_010955893.1|  PREDICTED: alpha-enolase                           261   3e-81    
emb|CDJ96217.1|  Enolase domain containing protein                      261   3e-81    
ref|XP_002187469.1|  PREDICTED: alpha-enolase-like                      258   3e-81    
ref|XP_009489516.1|  PREDICTED: alpha-enolase isoform X1                261   3e-81    
ref|XP_009972304.1|  PREDICTED: gamma-enolase isoform X1                261   3e-81    
gb|EMP26009.1|  Alpha-enolase                                           261   3e-81    
dbj|BAK61980.1|  alpha-enolase                                          261   3e-81    
gb|KFW96063.1|  Gamma-enolase                                           261   3e-81    
gb|KFR07416.1|  Gamma-enolase                                           261   3e-81    
gb|KFP86238.1|  Gamma-enolase                                           261   3e-81    
ref|XP_009702625.1|  PREDICTED: alpha-enolase isoform X1                261   3e-81    
ref|XP_010287650.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_009683425.1|  PREDICTED: gamma-enolase isoform X2                260   4e-81    
ref|XP_009930317.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_009581708.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_009489517.1|  PREDICTED: alpha-enolase isoform X2                261   4e-81    
gb|KDO32627.1|  enolase 2                                               261   4e-81    
gb|KFV59996.1|  Gamma-enolase                                           261   4e-81    
gb|KFV99086.1|  Gamma-enolase                                           261   4e-81    
gb|KFV66728.1|  Gamma-enolase                                           261   4e-81    
gb|KFM12860.1|  Gamma-enolase                                           261   4e-81    
ref|XP_005143318.1|  PREDICTED: alpha-enolase isoform X3                259   4e-81    
ref|XP_009897917.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_005016820.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
gb|ACZ51355.1|  enolase                                                 261   4e-81    
ref|XP_010159037.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_010716123.1|  PREDICTED: gamma-enolase                           261   4e-81    
ref|XP_010116442.1|  PREDICTED: alpha-enolase isoform X3                259   4e-81    
gb|KFQ88021.1|  Gamma-enolase                                           261   4e-81    
gb|KFQ26713.1|  Gamma-enolase                                           261   4e-81    
ref|XP_010177172.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_009459739.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_009498498.1|  PREDICTED: gamma-enolase isoform X1                261   4e-81    
ref|XP_003227156.1|  PREDICTED: gamma-enolase                           261   4e-81    
gb|KFV86534.1|  Gamma-enolase                                           261   4e-81    
sp|Q967Y8.1|ENO_EIMTE  RecName: Full=Enolase; AltName: Full=2-pho...    261   4e-81    
gb|KFQ67733.1|  Gamma-enolase                                           261   4e-81    
ref|XP_009702626.1|  PREDICTED: alpha-enolase isoform X2                261   4e-81    
ref|XP_010083752.1|  PREDICTED: alpha-enolase isoform X1                261   4e-81    
ref|XP_006193123.1|  PREDICTED: alpha-enolase isoform X2                261   4e-81    
ref|XP_005956441.1|  PREDICTED: alpha-enolase                           261   4e-81    
gb|AFD53917.1|  neuron-specific enolase                                 261   5e-81    
ref|XP_006037107.1|  PREDICTED: gamma-enolase isoform X3                258   5e-81    
ref|XP_007246350.1|  PREDICTED: alpha-enolase isoform X1                261   5e-81    
ref|XP_005312068.1|  PREDICTED: gamma-enolase                           261   5e-81    
ref|XP_003149703.1|  enolase                                            254   5e-81    
gb|EHH14293.1|  hypothetical protein EGK_00189                          261   5e-81    
ref|XP_003230749.2|  PREDICTED: alpha-enolase                           261   5e-81    
emb|CAA59331.1|  2-phosphopyruvate-hydratase alpha-enolase              261   5e-81    
ref|XP_010083753.1|  PREDICTED: alpha-enolase isoform X2                261   5e-81    
ref|XP_005514338.1|  PREDICTED: alpha-enolase isoform X3                259   5e-81    
ref|XP_007978852.1|  PREDICTED: alpha-enolase                           261   5e-81    
dbj|BAD96237.1|  enolase 1 variant                                      261   5e-81    
ref|XP_007246351.1|  PREDICTED: alpha-enolase isoform X2                260   5e-81    
ref|NP_001182540.1|  enolase 1, (alpha)                                 261   5e-81    
ref|XP_007069700.1|  PREDICTED: gamma-enolase isoform X2                261   5e-81    
ref|XP_006035516.1|  PREDICTED: alpha-enolase                           261   5e-81    
ref|XP_009869033.1|  PREDICTED: alpha-enolase isoform X3                259   5e-81    
ref|XP_008938485.1|  PREDICTED: gamma-enolase isoform X1                261   5e-81    
gb|KFU97217.1|  Gamma-enolase                                           260   5e-81    
ref|XP_010003461.1|  PREDICTED: alpha-enolase isoform X3                259   5e-81    
ref|XP_003274363.1|  PREDICTED: alpha-enolase                           260   5e-81    
ref|XP_008497343.1|  PREDICTED: gamma-enolase isoform X1                261   6e-81    
ref|XP_010084851.1|  PREDICTED: gamma-enolase isoform X1                260   6e-81    
gb|KFQ29625.1|  Gamma-enolase                                           260   6e-81    
ref|XP_006262953.1|  PREDICTED: alpha-enolase isoform X2                260   6e-81    
ref|XP_011133482.1|  enolase                                            254   6e-81    
ref|XP_005690789.1|  PREDICTED: alpha-enolase isoform X1                261   6e-81    
gb|AIC54340.1|  ENO1                                                    260   6e-81    
ref|XP_005544922.1|  PREDICTED: alpha-enolase isoform X3                260   6e-81    
ref|XP_004652745.1|  PREDICTED: alpha-enolase-like                      261   6e-81    
ref|NP_001419.1|  alpha-enolase isoform 1                               260   6e-81    
gb|AAP36132.1|  Homo sapiens enolase 1, (alpha)                         260   6e-81    
gb|EDL79128.1|  rCG62986                                                255   6e-81    
ref|XP_009512135.1|  PREDICTED: alpha-enolase isoform X3                259   6e-81    
emb|CCA22195.1|  unnamed protein product                                261   6e-81    
ref|NP_001274198.1|  enolase 1, (alpha)                                 260   6e-81    
pdb|3B97|A  Chain A, Crystal Structure Of Human Enolase 1               260   6e-81    
ref|XP_010180784.1|  PREDICTED: alpha-enolase isoform X3                259   6e-81    
dbj|BAD96912.1|  enolase 1 variant                                      260   6e-81    
sp|P19140.2|ENOA_ANAPL  RecName: Full=Alpha-enolase; AltName: Ful...    260   6e-81    
ref|XP_010114971.1|  PREDICTED: alpha-enolase isoform X1                260   7e-81    
ref|XP_006145439.1|  PREDICTED: alpha-enolase-like                      260   7e-81    
ref|XP_005024294.1|  PREDICTED: alpha-enolase isoform X2                260   7e-81    
gb|AAH04017.1|  EG433182 protein                                        258   7e-81    
ref|XP_009058096.1|  hypothetical protein LOTGIDRAFT_182683             260   7e-81    
ref|XP_005143316.1|  PREDICTED: alpha-enolase isoform X1                260   7e-81    
gb|AAH56611.1|  Eno1 protein                                            258   7e-81    
ref|XP_010115707.1|  PREDICTED: alpha-enolase isoform X2                260   7e-81    
gb|AHV90301.1|  alpha-enolase                                           260   7e-81    
ref|XP_010165803.1|  PREDICTED: alpha-enolase isoform X3                259   7e-81    
ref|XP_005690790.1|  PREDICTED: alpha-enolase isoform X2                261   7e-81    



>ref|XP_009623017.1| PREDICTED: enolase [Nicotiana tomentosiformis]
Length=444

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/177 (96%), Positives = 174/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLT EIGEKVQIVGD
Sbjct  268  KEENNNGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDA+YAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAIYAGASFRVPVEPY  444



>ref|XP_004249573.1| PREDICTED: enolase-like [Solanum lycopersicum]
Length=444

 Score =   349 bits (896),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLT EIG+KVQIVGD
Sbjct  268  KEENNNGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGQKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAISEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  444



>ref|XP_009764205.1| PREDICTED: enolase-like [Nicotiana sylvestris]
Length=444

 Score =   349 bits (895),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGDQLKDLYK+FVSEYPIVSIEDPFDQDDWETYAKLTTE+GE+VQIVGD
Sbjct  268  KEENNDGSQKISGDQLKDLYKTFVSEYPIVSIEDPFDQDDWETYAKLTTEMGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRKPVEPY  444



>gb|ACR56690.1| enolase [Nicotiana tabacum]
Length=444

 Score =   349 bits (895),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGDQLKDLYK+FVSEYPIVSIEDPFDQDDWETYAKLTTE+GE+VQIVGD
Sbjct  268  KEENNDGSQKISGDQLKDLYKTFVSEYPIVSIEDPFDQDDWETYAKLTTEMGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRKPVEPY  444



>ref|XP_009612088.1| PREDICTED: enolase-like [Nicotiana tomentosiformis]
Length=444

 Score =   348 bits (894),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG Q+ISGDQLKDLYK+FVSEYPIVSIEDPFDQDDWETYAKLTTEIGE VQIVGD
Sbjct  268  KEENNDGSQRISGDQLKDLYKTFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEPVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRKPVEPY  444



>ref|XP_006341172.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   348 bits (893),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 169/177 (95%), Positives = 173/177 (98%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE+NDG QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGE+VQIVGD
Sbjct  268  KEESNDGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY  444



>ref|XP_006338945.1| PREDICTED: enolase-like [Solanum tuberosum]
Length=444

 Score =   348 bits (892),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLT EIGEKVQIVGD
Sbjct  268  KEENNNGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAISEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRI+EELGSDAVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIDEELGSDAVYAGASFRTPVEPY  444



>ref|NP_001234080.1| enolase [Solanum lycopersicum]
 sp|P26300.1|ENO_SOLLC RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Solanum 
lycopersicum]
 emb|CAA41115.1| enolase [Solanum lycopersicum]
Length=444

 Score =   346 bits (888),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 168/177 (95%), Positives = 172/177 (97%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE+NDG QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLT EIGE+VQIVGD
Sbjct  268  KEESNDGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGASFR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY  444



>emb|CDP15353.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGDQLKDLYK FV+EYPIVSIEDPFDQDDWE YAKLT EIGEKVQIVGD
Sbjct  268  KEENNDGSQKISGDQLKDLYKMFVAEYPIVSIEDPFDQDDWEHYAKLTCEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+DA+YAGASFRAPVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAIYAGASFRAPVEPY  444



>ref|XP_010910644.1| PREDICTED: enolase 2-like [Elaeis guineensis]
Length=197

 Score =   333 bits (855),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKD+YKSFVSEYPIVS+EDPFDQDDW  YAKLT EIGE+VQIVGD
Sbjct  21   KEENNDGSQKISGESLKDVYKSFVSEYPIVSVEDPFDQDDWTHYAKLTEEIGEQVQIVGD  80

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  81   DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  140

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  141  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  197



>gb|AEQ94123.1| putative enolase [Elaeis guineensis]
Length=209

 Score =   333 bits (855),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKD+YKSFVSEYPIVS+EDPFDQDDW  YAKLT EIGE+VQIVGD
Sbjct  33   KEENNDGSQKISGESLKDVYKSFVSEYPIVSVEDPFDQDDWTHYAKLTEEIGEQVQIVGD  92

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  93   DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  152

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  153  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  209



>ref|XP_011094426.1| PREDICTED: enolase [Sesamum indicum]
Length=444

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/177 (93%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT+EIG +VQIVGD
Sbjct  268  KEENNNGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTSEIGAQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGASFRAPVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRAPVEPY  444



>gb|ABR25736.1| enolase [Oryza sativa Indica Group]
Length=231

 Score =   332 bits (852),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  55   KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  114

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  115  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  174

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVY GA FRAPV+PY
Sbjct  175  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYPGAKFRAPVDPY  231



>gb|KJB16685.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=435

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  259  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  318

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  319  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  378

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  379  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  435



>gb|KJB36422.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=351

 Score =   336 bits (862),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LKDLYKSFVSEYPI SIEDPFDQDDWE Y+KLT EIG KVQIVGD
Sbjct  175  KEEKNDGSQKISGDALKDLYKSFVSEYPIESIEDPFDQDDWEHYSKLTNEIGTKVQIVGD  234

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  235  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  294

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA+YAGASFRAPVEPY
Sbjct  295  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAIYAGASFRAPVEPY  351



>dbj|BAD94751.1| enolase [Arabidopsis thaliana]
Length=256

 Score =   332 bits (852),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G +VQIVGD
Sbjct  80   KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGD  139

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  140  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  199

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  200  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  256



>gb|KJB16679.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=442

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  266  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  325

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  326  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  385

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  386  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  442



>gb|KHG13187.1| Enolase 1 [Gossypium arboreum]
 gb|KJB16678.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=445

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  269  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  445



>gb|KJB16684.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  268  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  444



>gb|KJB16683.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=444

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  268  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  444



>gb|ABW21688.1| enolase [Gossypium hirsutum]
Length=445

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  269  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPV PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVAPY  445



>gb|AFK43733.1| unknown [Medicago truncatula]
Length=285

 Score =   332 bits (851),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISG+ LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T EIG  VQIVGD
Sbjct  109  KEDNNDGSQKISGEALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTGEIGTNVQIVGD  168

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  169  DLLVTNPKRVQKAIDSKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  228

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  229  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  285



>emb|CAA41116.1| enolase [Solanum lycopersicum]
Length=326

 Score =   333 bits (853),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/169 (95%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLT EIG+KVQIVGD
Sbjct  158  KEENNNGSQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTAEIGQKVQIVGD  217

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  218  DLLVTNPKRVAKAISEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMTSHRSGETED  277

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGAS  191
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGAS
Sbjct  278  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGAS  326



>gb|KJB36420.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36421.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
 gb|KJB36424.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=446

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LKDLYKSFVSEYPI SIEDPFDQDDWE Y+KLT EIG KVQIVGD
Sbjct  270  KEEKNDGSQKISGDALKDLYKSFVSEYPIESIEDPFDQDDWEHYSKLTNEIGTKVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  330  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA+YAGASFRAPVEPY
Sbjct  390  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAIYAGASFRAPVEPY  446



>ref|XP_006481907.1| PREDICTED: enolase-like [Citrus sinensis]
 gb|ADD12953.1| 2-phospho-D-glycerate hydrolase [Citrus trifoliata]
Length=445

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF+S+YPIVSIEDPFDQDDWE YAKLT+E+GEKVQIVGD
Sbjct  269  KEENNDGSQKISGDALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY  445



>ref|XP_010050008.1| PREDICTED: enolase 1 [Eucalyptus grandis]
Length=444

 Score =   337 bits (864),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE Y+KLT EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYSKLTREIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWG+M SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGIMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGANFRMPVEPY  444



>gb|KDO61018.1| hypothetical protein CISIN_1g043137mg [Citrus sinensis]
Length=445

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF+S+YPIVSIEDPFDQDDWE YAKLT+E+GEKVQIVGD
Sbjct  269  KEENNDGSQKISGDALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY  445



>ref|NP_001064223.1| Os10g0167300 [Oryza sativa Japonica Group]
 dbj|BAF26137.1| Os10g0167300 [Oryza sativa Japonica Group]
Length=446

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>gb|EEC66609.1| hypothetical protein OsI_32842 [Oryza sativa Indica Group]
 gb|EEE50625.1| hypothetical protein OsJ_30829 [Oryza sativa Japonica Group]
Length=447

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  271  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  330

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  331  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  390

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  391  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  447



>ref|XP_006430313.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
 gb|ESR43553.1| hypothetical protein CICLE_v10011726mg [Citrus clementina]
Length=445

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF+S+YPIVSIEDPFDQDDWE YAKLT+E+GEKVQIVGD
Sbjct  269  KEENNDGSQKISGDALKDLYKSFISDYPIVSIEDPFDQDDWEHYAKLTSEVGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVEPY  445



>sp|Q42971.2|ENO_ORYSJ RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase; AltName: 
Full=OSE1 [Oryza sativa Japonica Group]
 gb|AAP94211.1| enolase [Oryza sativa Japonica Group]
 gb|ABL74573.1| enolase [Oryza sativa Japonica Group]
 gb|ADM86850.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>gb|KHF99213.1| Enolase 2 [Gossypium arboreum]
Length=446

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LKDLYKSFVSEYPI SIEDPFDQDDWE Y+KLT EIG KVQIVGD
Sbjct  270  KEEKNDGSQKISGDALKDLYKSFVSEYPIESIEDPFDQDDWEHYSKLTNEIGTKVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  330  DLLVTNPKRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+V LATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA+YAGASFRAPVEPY
Sbjct  390  TFIADLSVSLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAIYAGASFRAPVEPY  446



>ref|XP_010527847.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Tarenaya hassleriana]
Length=468

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVS+YPIVSIEDPFDQDDWE YAK+T EIG+KVQIVGD
Sbjct  292  KEENNDGSQKISGDALKDLYKSFVSKYPIVSIEDPFDQDDWEHYAKMTAEIGDKVQIVGD  351

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  352  DLLVTNPKRVEKAINEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  411

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGASFR PVEPY
Sbjct  412  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGASFRKPVEPY  468



>ref|XP_010558960.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Tarenaya 
hassleriana]
Length=444

 Score =   336 bits (861),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+  TCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKENTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  444



>gb|KJB07832.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=317

 Score =   332 bits (850),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T+EIGE+VQIVGD
Sbjct  141  KEENNDGSQKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYAKMTSEIGEQVQIVGD  200

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  201  DLLVTNPKRVEKAITEKTCNALLLKVNQIGSVTESIEAVKMSKSAGWGVMASHRSGETED  260

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  261  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  317



>ref|XP_011101486.1| PREDICTED: enolase-like [Sesamum indicum]
Length=444

 Score =   336 bits (861),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD+LKDLYKSF SEYPIVSIEDPFDQDDWE YAKLT EIG +VQIVGD
Sbjct  268  KEENNDGSQKISGDKLKDLYKSFASEYPIVSIEDPFDQDDWEHYAKLTGEIGAQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGASFRAPVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGASFRAPVEPY  444



>gb|ABB46861.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  304  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  363

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  364  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  423

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  424  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  480



>gb|ABB46862.2| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=480

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  304  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  363

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  364  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  423

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  424  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  480



>gb|KFK34543.1| hypothetical protein AALP_AA5G159700 [Arabis alpina]
Length=444

 Score =   335 bits (860),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E+GEKVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTGEVGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAISEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAG +FRAPVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGVNFRAPVEPY  444



>ref|XP_006851831.1| hypothetical protein AMTR_s00041p00062460 [Amborella trichopoda]
 gb|ERN13298.1| hypothetical protein AMTR_s00041p00062460 [Amborella trichopoda]
Length=445

 Score =   335 bits (860),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGDQLKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  269  KEENNDGSQKISGDQLKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTAEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAINEKACNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  445



>emb|CAB96173.1| enolase [Spinacia oleracea]
Length=444

 Score =   335 bits (859),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE Y KLT EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYGKLTAEIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI GK+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAINGKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAGA FRAPVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAIYAGADFRAPVEPY  444



>gb|AAC49173.1| enolase [Oryza sativa Japonica Group]
Length=446

 Score =   335 bits (858),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIA+LAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIAELAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>ref|XP_002877895.1| enolase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54154.1| enolase [Arabidopsis lyrata subsp. lyrata]
Length=444

 Score =   334 bits (857),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+DA+YAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGADAIYAGANFRKPVEPY  444



>ref|XP_006661656.1| PREDICTED: enolase-like [Oryza brachyantha]
Length=446

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTGEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>ref|XP_006294225.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
 gb|EOA27123.1| hypothetical protein CARUB_v10023223mg [Capsella rubella]
Length=444

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G++VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGVNFRTPVEPY  444



>ref|XP_007027607.1| Enolase [Theobroma cacao]
 gb|EOY08109.1| Enolase [Theobroma cacao]
Length=445

 Score =   334 bits (856),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKI GD LKDLYKSF SEYPIVSIEDPFDQDDWE Y KLT EIGEKVQIVGD
Sbjct  269  KEENNDGSQKIPGDALKDLYKSFASEYPIVSIEDPFDQDDWEHYTKLTYEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAINEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+DAVYAGASFR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGASFRTPVEPY  445



>ref|XP_002881452.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57711.1| hypothetical protein ARALYDRAFT_902771 [Arabidopsis lyrata subsp. 
lyrata]
Length=444

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDW  YAK+TTE G +VQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWAHYAKMTTECGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  444



>gb|KEH24120.1| phosphopyruvate hydratase [Medicago truncatula]
Length=394

 Score =   332 bits (851),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISG+ LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T EIG  VQIVGD
Sbjct  218  KEDNNDGSQKISGEALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTGEIGTNVQIVGD  277

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  278  DLLVTNPKRVQKAIDSKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  337

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  338  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  394



>gb|AAS66001.1| LOS2 [Capsella bursa-pastoris]
Length=444

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G++VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGVNFRTPVEPY  444



>ref|XP_010907928.1| PREDICTED: enolase-like [Elaeis guineensis]
Length=445

 Score =   333 bits (855),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKD+YKSFVSEYPIVSIEDPFDQDDW  YAKLT EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGESLKDVYKSFVSEYPIVSIEDPFDQDDWTHYAKLTEEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  389  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  445



>ref|XP_010515776.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   333 bits (854),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  444



>ref|XP_010509461.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G++VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRTPVEPY  444



>ref|XP_009353019.1| PREDICTED: enolase-like [Pyrus x bretschneideri]
Length=444

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T E+GEK+QIVGD
Sbjct  268  KEEKNDGSQKISGNALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTAEVGEKIQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  388  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRVPVEPY  444



>gb|AAM12985.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
Length=444

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G +VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  444



>gb|AAQ18140.1| enolase [Gossypium barbadense]
Length=445

 Score =   333 bits (854),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/177 (92%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  269  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTKEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAP RSERLAKYNQLLRIEEELG+ AVYAGASFRAPV PY
Sbjct  389  TFIADLSVGLATGQIKTGAPRRSERLAKYNQLLRIEEELGAKAVYAGASFRAPVAPY  445



>ref|XP_010426928.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=445

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  269  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  445



>ref|XP_010516879.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   333 bits (854),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G++VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRTPVEPY  444



>gb|AAL59917.1| putative enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis 
thaliana]
Length=444

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G +VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  444



>gb|KDP22386.1| hypothetical protein JCGZ_26217 [Jatropha curcas]
Length=445

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE Y+KLT EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYSKLTAEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA+FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGANFRAPVEPY  445



>ref|XP_011018872.1| PREDICTED: enolase 2 [Populus euphratica]
Length=445

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KI+GD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT EIGEKVQIVGD
Sbjct  269  KEENNDGSKKITGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTAEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQ+LRIEEELG++AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQILRIEEELGAEAVYAGANFRRPVEPY  445



>ref|NP_181192.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
 sp|P25696.1|ENO2_ARATH RecName: Full=Bifunctional enolase 2/transcriptional activator; 
AltName: Full=2-phospho-D-glycerate hydro-lyase 2; AltName: 
Full=2-phosphoglycerate dehydratase 2; AltName: Full=LOW 
EXPRESSION OF OSMOTICALLY RESPONSIVE GENES 1 [Arabidopsis thaliana]
 gb|AAL11597.1|AF424603_1 At2g36530/F1O11.16 [Arabidopsis thaliana]
 emb|CAA41114.1| enolase [Arabidopsis thaliana]
 gb|AAD24635.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AAN12963.1| enolase (2-phospho-D-glycerate hydroylase) [Arabidopsis thaliana]
 gb|AEC09265.1| bifunctional enolase 2/transcriptional activator [Arabidopsis 
thaliana]
Length=444

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G +VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  444



>ref|XP_010096850.1| hypothetical protein L484_003561 [Morus notabilis]
 gb|EXB66234.1| hypothetical protein L484_003561 [Morus notabilis]
Length=444

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENND  QKI GD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT+EIGE+VQIVGD
Sbjct  268  KEENNDCSQKIPGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTSEIGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKDKACNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA FRAPVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAKFRAPVEPY  444



>ref|XP_006291136.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
 gb|EOA24034.1| hypothetical protein CARUB_v10017251mg [Capsella rubella]
Length=444

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  444



>ref|XP_008391739.1| PREDICTED: enolase-like [Malus domestica]
Length=444

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T E+GEK+QIVGD
Sbjct  268  KEEKNDGSQKISGNALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTAEVGEKIQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  388  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRVPVEPY  444



>emb|CBI24517.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T+EIGEKVQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVNDYPIVSIEDPFDQDDWEHYAKMTSEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  445



>ref|XP_010504049.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Camelina sativa]
Length=444

 Score =   333 bits (853),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTES+EAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESVEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  444



>ref|XP_006381325.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
 gb|ABK96195.1| unknown [Populus trichocarpa]
 gb|ERP59122.1| phosphopyruvate hydratase family protein [Populus trichocarpa]
Length=445

 Score =   332 bits (852),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KI+GD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT EIGEKVQIVGD
Sbjct  269  KEENNDGSKKITGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTAEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQ+LRIEEELG++AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQILRIEEELGAEAVYAGANFRRPVEPY  445



>gb|KEH24119.1| phosphopyruvate hydratase [Medicago truncatula]
Length=444

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISG+ LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T EIG  VQIVGD
Sbjct  268  KEDNNDGSQKISGEALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTGEIGTNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDSKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>sp|P42896.1|ENO_RICCO RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Ricinus 
communis]
 emb|CAA82232.1| enolase [Ricinus communis]
Length=445

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE Y+KLT+EIGEKVQIVGD
Sbjct  269  KEENNDGSQKISGEALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKLTSEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIQEKACNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY  445



>ref|XP_002528580.1| enolase, putative [Ricinus communis]
 gb|EEF33788.1| enolase, putative [Ricinus communis]
Length=445

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE Y+KLT+EIGEKVQIVGD
Sbjct  269  KEENNDGSQKISGEALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKLTSEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIQEKACNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRTPVEPY  445



>emb|CDY65842.1| BnaAnng21140D [Brassica napus]
Length=429

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G+ VQIVGD
Sbjct  253  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGDSVQIVGD  312

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  313  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  372

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  373  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  429



>ref|XP_010505199.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Camelina 
sativa]
Length=444

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G++VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAIYAGVNFRTPVEPY  444



>ref|XP_004143301.1| PREDICTED: enolase-like [Cucumis sativus]
 ref|XP_004164073.1| PREDICTED: enolase-like [Cucumis sativus]
 gb|KGN48232.1| hypothetical protein Csa_6G450370 [Cucumis sativus]
Length=444

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T+EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTSEIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG +FR PV PY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGVNFRKPVAPY  444



>ref|XP_010243562.1| PREDICTED: enolase 1 [Nelumbo nucifera]
Length=444

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE Y KLT EIGEKVQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYNKLTCEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIG+VTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKACNALLLKVNQIGTVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGANFRKPVEPY  444



>ref|XP_004962569.1| PREDICTED: enolase 2-like isoform X2 [Setaria italica]
Length=445

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>ref|XP_009141601.1| PREDICTED: bifunctional enolase 2/transcriptional activator [Brassica 
rapa]
Length=444

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGDSVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>ref|XP_010933076.1| PREDICTED: enolase 2 [Elaeis guineensis]
Length=445

 Score =   332 bits (850),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVS YPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSGYPIVSIEDPFDQDDWTHYAKMTEEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>gb|ABD92697.1| los [Brassica rapa subsp. chinensis]
Length=444

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>gb|AFB35652.1| enolase [Phytolacca americana]
Length=444

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGNALKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKMTAEIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRQPVEPY  444



>ref|XP_009365316.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=444

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T E+GEKVQIVGD
Sbjct  268  KEEKNDGSQKISGNALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTAEVGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAKFRVPVEPY  444



>gb|AAL06912.1| At2g36530/F1O11.16 [Arabidopsis thaliana]
Length=444

 Score =   332 bits (850),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+TTE G +VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTTECGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGET+D
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETKD  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRKPVEPY  444



>sp|Q9LEJ0.1|ENO1_HEVBR RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00532.1| enolase, isoform 1 [Hevea brasiliensis]
Length=445

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISG+ LKDLYKSFV+EYPIVSIEDPFDQDDW  YAKLT+EIGEKVQIVGD
Sbjct  269  KEENNNGSQKISGEALKDLYKSFVAEYPIVSIEDPFDQDDWAHYAKLTSEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  445



>ref|XP_009143574.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>emb|CDY33161.1| BnaC04g08780D [Brassica napus]
 emb|CDX75031.1| BnaA05g07770D [Brassica napus]
Length=429

 Score =   331 bits (848),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  253  KEENNNGSQKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  312

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  313  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  372

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  373  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  429



>ref|XP_003558351.1| PREDICTED: enolase 2 [Brachypodium distachyon]
Length=446

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>sp|Q9LEI9.1|ENO2_HEVBR RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2; AltName: Allergen=Hev b 9 [Hevea brasiliensis]
 emb|CAC00533.1| enolase, isoform 2 [Hevea brasiliensis]
Length=445

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAKLT+EIG KVQIVGD
Sbjct  269  KEENNNGSQKISGDVLKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTSEIGVKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  445



>gb|ACN26258.1| unknown [Zea mays]
 tpg|DAA46777.1| TPA: putative enolase family protein isoform 1 [Zea mays]
 tpg|DAA46778.1| TPA: putative enolase family protein isoform 2 [Zea mays]
Length=446

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY  446



>ref|XP_003521438.1| PREDICTED: enolase-like [Glycine max]
Length=444

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAKLT E+G  VQIVGD
Sbjct  268  KEDNNDGSQKISGDALKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTAEVGTNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDTKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>ref|XP_010277374.1| PREDICTED: enolase-like [Nelumbo nucifera]
Length=445

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVS+YPIVSIEDPFDQDDWE YAKLT+EIG+ VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSDYPIVSIEDPFDQDDWEHYAKLTSEIGQHVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS A+YAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAIYAGAKFRAPVEPY  445



>gb|ACG31732.1| enolase [Zea mays]
Length=446

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY  446



>ref|NP_001105371.1| enolase 2 [Zea mays]
 sp|P42895.1|ENO2_MAIZE RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Zea mays]
 gb|AAD04187.1| enolase [Zea mays]
 gb|AAQ17040.2| pollen 2-phosphoglycerate dehydrogenase 2 precursor [Cynodon 
dactylon]
Length=446

 Score =   331 bits (849),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAIAVYAGAKFRAPVEPY  446



>ref|NP_001237329.1| enolase [Glycine max]
 gb|AAS18240.1| enolase [Glycine max]
Length=444

 Score =   331 bits (848),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG Q+ISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT E+G  VQIVGD
Sbjct  268  KEDNNDGSQRISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTAEVGANVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDTKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>ref|XP_002267091.2| PREDICTED: enolase [Vitis vinifera]
Length=510

 Score =   333 bits (853),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T+EIGEKVQIVGD
Sbjct  334  KEENNDGSQKISGDSLKNVYKSFVNDYPIVSIEDPFDQDDWEHYAKMTSEIGEKVQIVGD  393

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  394  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  453

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  454  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  510



>emb|CDX84555.1| BnaA03g16750D [Brassica napus]
Length=429

 Score =   330 bits (846),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  253  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  312

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  313  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  372

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  373  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  429



>ref|XP_008462531.1| PREDICTED: enolase [Cucumis melo]
Length=444

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF SEYPIVSIEDPFDQDDWE Y+K+T+EIG+KVQIVGD
Sbjct  268  KEENNDGSQKISGDALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKMTSEIGDKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG +FR PV PY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGVNFRKPVAPY  444



>gb|KJB07831.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=445

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T+EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYAKMTSEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAITEKTCNALLLKVNQIGSVTESIEAVKMSKSAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>ref|XP_007162849.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
 gb|ESW34843.1| hypothetical protein PHAVU_001G186100g [Phaseolus vulgaris]
Length=444

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISGD LKDLYKSFVS+YPIVSIEDPFDQDDWE YAKLT E+G  VQIVGD
Sbjct  268  KEDNNDGSQKISGDALKDLYKSFVSDYPIVSIEDPFDQDDWEHYAKLTAEVGTNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDTKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>ref|XP_009133088.1| PREDICTED: bifunctional enolase 2/transcriptional activator-like 
[Brassica rapa]
Length=444

 Score =   330 bits (847),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>emb|CDX79684.1| BnaC03g20200D [Brassica napus]
Length=429

 Score =   330 bits (845),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  253  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  312

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  313  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  372

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  373  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  429



>ref|XP_003573806.1| PREDICTED: enolase [Brachypodium distachyon]
Length=446

 Score =   330 bits (846),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGEPVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  446



>gb|KHN02262.1| Enolase [Glycine soja]
Length=457

 Score =   330 bits (847),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG Q+ISGD LKDLYKSFVSEYPIVSIEDPFDQDDWE YAKLT E+G  VQIVGD
Sbjct  281  KEDNNDGSQRISGDALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKLTAEVGANVQIVGD  340

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  341  DLLVTNPKRVQKAIDTKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  400

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  401  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  457



>gb|KHN18726.1| Enolase [Glycine soja]
Length=455

 Score =   330 bits (847),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAKLT E+G  VQIVGD
Sbjct  279  KEDNNDGSQKISGDALKDLYKSFVTEYPIVSIEDPFDQDDWEHYAKLTAEVGTNVQIVGD  338

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  339  DLLVTNPKRVQKAIDSKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  398

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  399  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  455



>gb|EMT10090.1| Enolase 1 [Aegilops tauschii]
Length=448

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAK+T E+G++VQIVGD
Sbjct  272  KEDNNDGSHKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWATYAKMTGEVGQQVQIVGD  331

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV MSK+AGWGVM SHRSGETED
Sbjct  332  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVSMSKRAGWGVMASHRSGETED  391

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FRAPVEPY
Sbjct  392  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGANFRAPVEPY  448



>gb|EMS66544.1| Enolase 1 [Triticum urartu]
Length=449

 Score =   330 bits (846),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAK+T E+G++VQIVGD
Sbjct  273  KEDNNDGSHKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWATYAKMTGEVGQQVQIVGD  332

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV MSK+AGWGVM SHRSGETED
Sbjct  333  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVSMSKRAGWGVMASHRSGETED  392

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FRAPVEPY
Sbjct  393  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGANFRAPVEPY  449



>gb|AFW85966.1| enolase1 [Zea mays]
Length=445

 Score =   330 bits (845),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LKDLYKSFVSEYPI SIEDPFDQDDW TYAKLT EIG+KVQIVGD
Sbjct  269  KEENNDGSKKISGDSLKDLYKSFVSEYPIESIEDPFDQDDWSTYAKLTDEIGQKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  445



>sp|Q43321.1|ENO_ALNGL RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Alnus 
glutinosa]
 emb|CAA63121.1| enolase [Alnus glutinosa]
Length=440

 Score =   329 bits (844),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 167/177 (94%), Gaps = 1/177 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKIS DQLKDLYKSFV EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  265  KEENNDGSQKISADQLKDLYKSFVDEYPIVSIEDPFDQDDWEHYSKLTAEIGEKVQIVGD  324

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM +HRSGETED
Sbjct  325  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVM-AHRSGETED  383

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  384  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY  440



>gb|EEC74867.1| hypothetical protein OsI_10758 [Oryza sativa Indica Group]
Length=445

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGDQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKDKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>gb|AFW85964.1| enolase1 [Zea mays]
Length=446

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LKDLYKSFVSEYPI SIEDPFDQDDW TYAKLT EIG+KVQIVGD
Sbjct  270  KEENNDGSKKISGDSLKDLYKSFVSEYPIESIEDPFDQDDWSTYAKLTDEIGQKVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  446



>ref|NP_001049556.1| Os03g0248600 [Oryza sativa Japonica Group]
 gb|ABF94968.1| Enolase 2, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11470.1| Os03g0248600 [Oryza sativa Japonica Group]
 dbj|BAG93549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94076.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE58701.1| hypothetical protein OsJ_10141 [Oryza sativa Japonica Group]
Length=445

 Score =   330 bits (845),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEEIGDQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKDKACNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>ref|XP_009401920.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   329 bits (844),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIG+KVQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWTHYAKMTEEIGDKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>ref|NP_001105896.1| enolase 1 [Zea mays]
 sp|P26301.1|ENO1_MAIZE RecName: Full=Enolase 1; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 1; AltName: Full=2-phosphoglycerate dehydratase 
1 [Zea mays]
 emb|CAA39454.1| enolase [Zea mays]
Length=446

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG  KISGD LKDLYKSFVSEYPI SIEDPFDQDDW TYAKLT EIG+KVQIVGD
Sbjct  270  KEENNDGSNKISGDSLKDLYKSFVSEYPIESIEDPFDQDDWSTYAKLTDEIGQKVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  446



>ref|XP_003557232.1| PREDICTED: enolase 1 [Brachypodium distachyon]
Length=447

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG  KISGD LKD+YKSFVS+YPIVSIEDPFDQDDW TYAK+T EIG++VQIVGD
Sbjct  271  KEENNDGSHKISGDSLKDMYKSFVSDYPIVSIEDPFDQDDWATYAKMTAEIGQQVQIVGD  330

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RV+KAI  KTCNALLLKVNQIGSVTESIEAV MSK+AGWGVM SHRSGETED
Sbjct  331  DLLVTNPTRVSKAINEKTCNALLLKVNQIGSVTESIEAVSMSKRAGWGVMASHRSGETED  390

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FRAPVEPY
Sbjct  391  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGANFRAPVEPY  447



>ref|XP_008241309.1| PREDICTED: enolase [Prunus mume]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG+ LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GE+VQIVGD
Sbjct  268  KEEKNDGSQKISGNALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRVPVEPY  444



>ref|XP_004494139.1| PREDICTED: enolase-like [Cicer arietinum]
Length=442

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE Y K+T EIG  VQIVGD
Sbjct  266  KEDNNDGSQKISGNALKDLYKSFVAEYPIVSIEDPFDQDDWEHYGKMTGEIGANVQIVGD  325

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSKKAGWGVMTSHRSGETED
Sbjct  326  DLLVTNPKRVQKAIDSKACNALLLKVNQIGSVTESIEAVRMSKKAGWGVMTSHRSGETED  385

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAG +FR PVEPY
Sbjct  386  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGTNFRTPVEPY  442



>ref|XP_007202055.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
 gb|EMJ03254.1| hypothetical protein PRUPE_ppa005779mg [Prunus persica]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG+ LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T E GE+VQIVGD
Sbjct  268  KEEKNDGSQKISGNALKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRVPVEPY  444



>gb|AEW69686.1| enolase1 [Guzmania wittmackii x Guzmania lingulata]
Length=445

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAKLT EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWTHYAKLTEEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGET+D
Sbjct  329  DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETDD  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGA CRSERLAKYNQLLRIEEELG+ AVYAG+ FRAPVEPY
Sbjct  389  TFIADLAVGLATGQIKTGASCRSERLAKYNQLLRIEEELGAAAVYAGSKFRAPVEPY  445



>ref|XP_006403746.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
 gb|ESQ45199.1| hypothetical protein EUTSA_v10010379mg [Eutrema salsugineum]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G +KISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNNGSEKISGEALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTGECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAISEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>ref|XP_010050038.1| PREDICTED: enolase-like [Eucalyptus grandis]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKI GD LKDLYKSF SEYPIVSIEDPFDQDDWE Y+K+T E+GE VQIVGD
Sbjct  268  KEDNNDGSQKIPGDALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKMTVEMGEHVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI+  TCNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIKENTCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRKPVEPY  444



>gb|AAQ77241.1| enolase [Brassica napus]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LK LYKSFVSEYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKGLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>ref|XP_008386927.1| PREDICTED: enolase [Malus domestica]
Length=444

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKI G+ LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T E+GEKVQIVGD
Sbjct  268  KEEKNDGSQKILGNALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTAEVGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGAKFRVPVEPY  444



>ref|XP_006403745.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
 dbj|BAJ33773.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ45198.1| hypothetical protein EUTSA_v10010378mg [Eutrema salsugineum]
Length=444

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G +KISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNNGSEKISGEALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTGECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVAKAISEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGANFRTPVEPY  444



>ref|XP_007152407.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
 gb|ESW24401.1| hypothetical protein PHAVU_004G127500g [Phaseolus vulgaris]
Length=445

 Score =   329 bits (843),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKS+V++YPIVSIEDPFDQDDW+TYAKLT+E+G++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSYVTDYPIVSIEDPFDQDDWDTYAKLTSEVGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KA++ K CNALLLKVNQIGSVTESI+AVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVEKAVKEKACNALLLKVNQIGSVTESIDAVKMSKQAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG+ FRAPVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGSKFRAPVEPY  445



>ref|XP_004964466.1| PREDICTED: enolase 1-like isoform X4 [Setaria italica]
Length=446

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  270  KEDNNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWSTYAKLTDEIGQQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ A+YAG +FRAPVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAIYAGENFRAPVEPY  446



>ref|XP_010278245.1| PREDICTED: enolase 1-like [Nelumbo nucifera]
Length=445

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKD+YKSF SEYPIVSIEDPFDQDDW  Y KLT+EIGEKVQIVGD
Sbjct  269  KEENNDGSQKISGDALKDVYKSFSSEYPIVSIEDPFDQDDWTHYNKLTSEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K CNALLLKVNQIGSVTESIEAVKM+K+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAINEKACNALLLKVNQIGSVTESIEAVKMAKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAGA+FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGANFRRPVEPY  445



>ref|XP_007038456.1| Enolase isoform 1 [Theobroma cacao]
 gb|EOY22957.1| Enolase isoform 1 [Theobroma cacao]
Length=445

 Score =   328 bits (842),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAKLT EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYAKLTCEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKLAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVEPY  445



>gb|KFK32725.1| hypothetical protein AALP_AA6G281000 [Arabis alpina]
Length=444

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G +KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW  YAK+T E G++VQIVGD
Sbjct  268  KEENNNGSEKISGDALKDLYKSFVSEYPIVSIEDPFDQDDWAHYAKMTAECGKEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  K+CNALLLKVNQIG+VTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVAKAIAEKSCNALLLKVNQIGTVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+A+YAG +FR PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAIYAGVNFRTPVEPY  444



>ref|XP_002322420.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
 gb|ABK94302.1| unknown [Populus trichocarpa]
 gb|EEF06547.1| hypothetical protein POPTR_0015s14380g [Populus trichocarpa]
Length=445

 Score =   328 bits (841),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T E+GE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVADYPIVSIEDPFDQDDWEHYAKMTGEVGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  445



>gb|EYU35120.1| hypothetical protein MIMGU_mgv1a006438mg [Erythranthe guttata]
Length=444

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD+LKDLYKSFVSEYPIVSIEDPFDQDDWE YAK+T EIG  VQIVGD
Sbjct  268  KEDNNDGSAKISGDKLKDLYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGTPVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSK AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKHAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRTPVEPY  444



>ref|XP_002283632.1| PREDICTED: enolase 1 [Vitis vinifera]
 emb|CBI30238.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   328 bits (841),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LK+LYKSFV+EYPI SIEDPFDQDDWE Y KLT EIGEKVQIVGD
Sbjct  268  KEENNDGSEKISGDALKNLYKSFVNEYPISSIEDPFDQDDWEHYTKLTCEIGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIG+VTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKACNALLLKVNQIGTVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+DAVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGANFRKPVEPY  444



>gb|KDP22388.1| hypothetical protein JCGZ_26219 [Jatropha curcas]
Length=445

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG  LK++YKSFV++YPIVSIEDPFDQDDWE Y+K+T EIGEKVQIVGD
Sbjct  269  KEEKNDGSQKISGQSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYSKMTAEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPV+PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVQPY  445



>ref|XP_004964465.1| PREDICTED: enolase 1-like isoform X3 [Setaria italica]
Length=470

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  294  KEDNNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWSTYAKLTDEIGQQVQIVGD  353

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  354  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  413

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ A+YAG +FRAPVEPY
Sbjct  414  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAIYAGENFRAPVEPY  470



>ref|XP_008376333.1| PREDICTED: enolase [Malus domestica]
Length=445

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  269  KEEKNDGSQKISGDSLKNVYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVKKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS A+YAGA FR PVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAIYAGAKFRVPVEPY  445



>ref|XP_009384633.1| PREDICTED: enolase [Musa acuminata subsp. malaccensis]
Length=445

 Score =   328 bits (840),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAKLT EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWIHYAKLTEEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKACNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA FRAPV+PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGAKFRAPVQPY  445



>ref|XP_003534043.1| PREDICTED: enolase [Glycine max]
 gb|KHN27853.1| Enolase [Glycine soja]
Length=445

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKS+V++YPIVSIEDPFDQDDWE YAKLT E+G++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSYVTDYPIVSIEDPFDQDDWEHYAKLTAEVGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  445



>ref|XP_008234357.1| PREDICTED: enolase [Prunus mume]
Length=446

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEEKNDGSQKISGDSLKNVYKSFVTEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG+ FR PVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGSKFRVPVEPY  446



>ref|XP_010683886.1| PREDICTED: enolase [Beta vulgaris subsp. vulgaris]
Length=444

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG Q+ISGD LKDLYKSF SEYPIVSIEDPFDQDDWE YAK+T E G+KVQ+VGD
Sbjct  268  KEENNDGSQRISGDALKDLYKSFASEYPIVSIEDPFDQDDWEHYAKMTAECGDKVQVVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGANFRVPVEPY  444



>ref|XP_011041692.1| PREDICTED: enolase [Populus euphratica]
Length=445

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T E+GE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVADYPIVSIEDPFDQDDWEHYAKMTGEVGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  445



>ref|XP_009374527.1| PREDICTED: enolase [Pyrus x bretschneideri]
Length=445

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  269  KEEKNDGSQKISGDGLKNVYKSFVTEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAINEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FR PVEPY
Sbjct  389  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRVPVEPY  445



>ref|XP_003548246.1| PREDICTED: enolase-like [Glycine max]
Length=445

 Score =   327 bits (839),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKS+V++YPIVSIEDPFDQDDWE YAKLT E+G++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSYVTDYPIVSIEDPFDQDDWEHYAKLTAEVGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRAPVEPY  445



>gb|ACN50180.1| enolase [Annona cherimola]
Length=445

 Score =   327 bits (838),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAKLT EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKLTAEIGQEVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKHAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG  FRAPV+PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGEKFRAPVQPY  445



>ref|XP_004303035.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=444

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISG  LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+K+TTE GE+VQIVGD
Sbjct  268  KEEKNDGSQKISGTALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKMTTECGEQVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FR PVEPY
Sbjct  388  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGAKFRTPVEPY  444



>gb|AAQ77240.1| enolase [Brassica rapa subsp. oleifera]
Length=444

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E G+ VQIVGD
Sbjct  268  KEENNNGSQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGDNVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPK VAKAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKGVAKAIAEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS+AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSEAVYAGANFRKPVEPY  444



>gb|AAA21277.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG Q+ISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQRISGEALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+  +CNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVKKAIDENSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY  444



>ref|NP_001056727.1| Os06g0136600 [Oryza sativa Japonica Group]
 dbj|BAD68461.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAD68886.1| putative enolase [Oryza sativa Japonica Group]
 dbj|BAF18641.1| Os06g0136600 [Oryza sativa Japonica Group]
 gb|EEC79946.1| hypothetical protein OsI_21538 [Oryza sativa Indica Group]
Length=446

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKD+YKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  270  KEDNNDGSHKISGDSLKDVYKSFVSEYPIVSIEDPFDQDDWATYAKLTDEIGQQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGEKFRAPVEPY  446



>dbj|BAJ85279.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=446

 Score =   327 bits (838),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E GE+VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG  FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGLKFRAPVEPY  446



>ref|XP_002510911.1| enolase, putative [Ricinus communis]
 gb|EEF51513.1| enolase, putative [Ricinus communis]
Length=445

 Score =   327 bits (837),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LK++YKSFV++YPIVSIEDPFDQDDWE Y+KLT EIGE+VQIVGD
Sbjct  269  KEENNDGSEKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYSKLTAEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV K I  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVNKGIREKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA FRAPV PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSGAVYAGAKFRAPVAPY  445



>gb|EEE65047.1| hypothetical protein OsJ_20044 [Oryza sativa Japonica Group]
Length=462

 Score =   327 bits (838),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKD+YKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  286  KEDNNDGSHKISGDSLKDVYKSFVSEYPIVSIEDPFDQDDWATYAKLTDEIGQQVQIVGD  345

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  346  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  405

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  406  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGEKFRAPVEPY  462



>gb|ACL53816.1| unknown [Zea mays]
Length=446

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/177 (89%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LKDLYKSFVSEYPI SIEDPFDQDDW TYAKLT EIG+KVQIVGD
Sbjct  270  KEENNDGSKKISGDSLKDLYKSFVSEYPIESIEDPFDQDDWSTYAKLTDEIGQKVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGW VM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWEVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FRAPVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRAPVEPY  446



>ref|XP_004308163.1| PREDICTED: enolase [Fragaria vesca subsp. vesca]
Length=446

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG Q+ISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEEKNDGSQRISGDSLKNVYKSFVTEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG+ FR PVEPY
Sbjct  390  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGSKFRVPVEPY  446



>ref|XP_007218006.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
 gb|EMJ19205.1| hypothetical protein PRUPE_ppa005739mg [Prunus persica]
Length=446

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  270  KEEKNDGSQKISGDSLKNVYKSFVTEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG+ FR PVEPY
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGSKFRVPVEPY  446



>dbj|BAJ90134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   326 bits (836),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/177 (89%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E GE+VQIVGD
Sbjct  273  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGEQVQIVGD  332

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  333  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  392

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  393  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGLKFRAPVEPY  449



>ref|XP_008778664.1| PREDICTED: enolase-like [Phoenix dactylifera]
Length=445

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAKLT EIG +VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWTHYAKLTEEIGGQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKCAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERL KYNQLLRIEEELG+ AVYAGA FR PVEPY
Sbjct  389  TFIADLAVGLATGQIKTGAPCRSERLCKYNQLLRIEEELGAAAVYAGAKFRDPVEPY  445



>emb|CAB75428.1| enolase [Lupinus luteus]
Length=444

 Score =   326 bits (835),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG QKISG++LK+LYKSFV+EYPI SIEDPFDQDDWE Y K+TTEIG +VQIVGD
Sbjct  268  KEDNNDGSQKISGEELKELYKSFVAEYPIASIEDPFDQDDWEHYGKITTEIGTEVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED
Sbjct  328  DLLVTNPKRVQKAIDSKSCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG +AVYAG ++R PVEPY
Sbjct  388  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDEAVYAGVNYRNPVEPY  444



>ref|XP_006656609.1| PREDICTED: enolase 1-like [Oryza brachyantha]
Length=452

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD+LKD+YKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG+KVQIVGD
Sbjct  276  KEDNNDGSHKISGDKLKDVYKSFVSEYPIVSIEDPFDQDDWTTYAKLTDEIGQKVQIVGD  335

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI   TCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  336  DLLVTNPTRVAKAISENTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  395

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  396  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGLKFRAPVEPY  452



>ref|XP_008791284.1| PREDICTED: enolase isoform X1 [Phoenix dactylifera]
Length=445

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV EYPIVSIEDPFDQDDW  YAKLT EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVCEYPIVSIEDPFDQDDWAHYAKLTEEIGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
             FIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+  VYAGA FRAPVEPY
Sbjct  389  AFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAGVYAGAKFRAPVEPY  445



>gb|AEM97875.1| enolase [Corylus heterophylla]
Length=454

 Score =   326 bits (835),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKI GD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+K+T EIG+KVQIVGD
Sbjct  278  KEEKNDGSQKIPGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKITAEIGDKVQIVGD  337

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  338  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  397

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGA+FR PVEPY
Sbjct  398  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGANFRTPVEPY  454



>ref|XP_004514974.1| PREDICTED: enolase-like [Cicer arietinum]
Length=445

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LK++YKSFVS+YPIVSIEDP DQDDWE YAKLT EIG++VQIVGD
Sbjct  269  KEENNDGSEKISGDSLKNVYKSFVSDYPIVSIEDPLDQDDWEHYAKLTAEIGQEVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSKKAGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKKAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG+ FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGSKFRAPVEPY  445



>sp|Q43130.1|ENO_MESCR RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Mesembryanthemum 
crystallinum]
 gb|AAB34986.1| 2-phospho-D-glycerate hydrolase [Mesembryanthemum crystallinum]
Length=444

 Score =   325 bits (834),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG Q+ISG+ LKDLYKSFV+EYPIVSIEDPFDQDDWE YAK+T E GEKVQIVGD
Sbjct  268  KEENNDGSQRISGEALKDLYKSFVAEYPIVSIEDPFDQDDWEHYAKMTAECGEKVQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+   CNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVKKAIDENPCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FR PVEPY
Sbjct  388  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGANFRRPVEPY  444



>gb|AES75861.2| phosphopyruvate hydratase [Medicago truncatula]
Length=429

 Score =   325 bits (832),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LK++YKSFVS+YPIVSIEDPFDQDDWE Y+KLT E+G++VQIVGD
Sbjct  253  KEENNDGSEKISGDSLKNVYKSFVSDYPIVSIEDPFDQDDWEHYSKLTAEMGQQVQIVGD  312

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  313  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  372

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG+ FRAPVEPY
Sbjct  373  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGSKFRAPVEPY  429



>ref|XP_010050020.1| PREDICTED: enolase-like isoform X1 [Eucalyptus grandis]
Length=491

 Score =   327 bits (837),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE NNDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE Y+K T E G+KVQIVGD
Sbjct  315  KEVNNDGSQKISGEALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKFTCEFGDKVQIVGD  374

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+RV KA++ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  375  DLLVTNPRRVEKAVKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  434

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGA+FR P EPY
Sbjct  435  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGANFRRPAEPY  491



>ref|XP_003619643.1| Enolase [Medicago truncatula]
Length=434

 Score =   324 bits (831),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 168/177 (95%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LK++YKSFVS+YPIVSIEDPFDQDDWE Y+KLT E+G++VQIVGD
Sbjct  258  KEENNDGSEKISGDSLKNVYKSFVSDYPIVSIEDPFDQDDWEHYSKLTAEMGQQVQIVGD  317

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  318  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  377

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG+ FRAPVEPY
Sbjct  378  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGSKFRAPVEPY  434



>ref|XP_009393022.1| PREDICTED: enolase-like [Musa acuminata subsp. malaccensis]
Length=445

 Score =   323 bits (829),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD+LKD+YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDKLKDVYKSFVSEYPIVSIEDPFDQDDWTHYAKMTEEIGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RV+KAI    CNALLLKVNQIG+VTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVSKAINENACNALLLKVNQIGTVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGVKFRAPVEPY  445



>gb|KDO38071.1| hypothetical protein CISIN_1g040341mg [Citrus sinensis]
Length=251

 Score =   317 bits (811),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QK+SGD LK++Y+SF+S++PIVSIEDPFDQDDWE +A+LT +IG  VQIVGD
Sbjct  75   KEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGD  134

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  135  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  194

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAG  FRAPVEPY
Sbjct  195  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY  251



>gb|AGH20061.1| enolase [Triticum aestivum]
 gb|AGH20063.1| enolase [Triticum aestivum]
Length=446

 Score =   323 bits (828),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG+ AVYAG  FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAAAVYAGLKFRAPVEPY  446



>gb|AGH20062.1| enolase [Triticum aestivum]
Length=446

 Score =   323 bits (827),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQIVGD
Sbjct  270  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG  FRAPVEPY
Sbjct  390  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGLKFRAPVEPY  446



>gb|AIR93791.1| enolase [Kalanchoe fedtschenkoi]
Length=445

 Score =   322 bits (826),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEE NDG QKISGD LK+LYK+F +EYPIVSIEDPFDQDDWE Y+KLT EIG++VQIVGD
Sbjct  269  KEEGNDGSQKISGDALKELYKTFTAEYPIVSIEDPFDQDDWEHYSKLTAEIGDEVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAG +FR PVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGLNFRTPVEPY  445



>gb|KJB36423.1| hypothetical protein B456_006G158500 [Gossypium raimondii]
Length=439

 Score =   322 bits (825),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = -3

Query  673  QKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPK  494
            ++ISGD LKDLYKSFVSEYPI SIEDPFDQDDWE Y+KLT EIG KVQIVGDDLLVTNPK
Sbjct  271  EEISGDALKDLYKSFVSEYPIESIEDPFDQDDWEHYSKLTNEIGTKVQIVGDDLLVTNPK  330

Query  493  RVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAV  314
            RV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETEDTFIADL+V
Sbjct  331  RVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETEDTFIADLSV  390

Query  313  GLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            GLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA+YAGASFRAPVEPY
Sbjct  391  GLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAIYAGASFRAPVEPY  439



>ref|XP_010068982.1| PREDICTED: enolase 1-like [Eucalyptus grandis]
Length=325

 Score =   316 bits (810),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 151/172 (88%), Positives = 161/172 (94%), Gaps = 0/172 (0%)
 Frame = -3

Query  691  ENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDL  512
            +NNDG QKISGD LKDLYKSFV EYPIVSIEDPFDQDDWE Y+KLT EIG+KVQIVGDDL
Sbjct  109  KNNDGSQKISGDALKDLYKSFVIEYPIVSIEDPFDQDDWEHYSKLTREIGDKVQIVGDDL  168

Query  511  LVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTF  332
            LVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK+AGWG+M SHRSGETEDTF
Sbjct  169  LVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKRAGWGIMASHRSGETEDTF  228

Query  331  IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            IADL+VGLATGQIKTGAPCRSERLAKYNQLLRIE+ELG DAVYAGA+FR P+
Sbjct  229  IADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEDELGLDAVYAGANFRMPL  280



>gb|KHG20587.1| Enolase 2 [Gossypium arboreum]
Length=434

 Score =   319 bits (818),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 156/177 (88%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD LKDLYKSF SEYPIVSIEDPFDQ DWE Y+KLTTEIGEKV IVG 
Sbjct  258  KEENNDGSKKISGDALKDLYKSFASEYPIVSIEDPFDQHDWEHYSKLTTEIGEKVLIVGH  317

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP  V KAI+ KTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVM SHRSGETED
Sbjct  318  DLLVTNPNTVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMASHRSGETED  377

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGA CRSERLAKYNQLLRIEEELG++AVYAGASFR  VEPY
Sbjct  378  TFIADLSVGLATGQIKTGASCRSERLAKYNQLLRIEEELGAEAVYAGASFRTLVEPY  434



>gb|ABR16337.1| unknown [Picea sitchensis]
Length=445

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 153/177 (86%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISG +L  LY+SF+ +YPIVSIEDPFDQDDW  YA+ T  IGEKVQIVGD
Sbjct  269  KEENNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVGKAINEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGASFR PVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGASFRQPVEPY  445



>gb|ABR17990.1| unknown [Picea sitchensis]
Length=445

 Score =   318 bits (816),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 162/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISG +L  LY+SF+ +YPIVSIEDPFDQDDW  YA+ T  IGEKVQIVGD
Sbjct  269  KEENNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIG+VTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVGKAINEKSCNALLLKVNQIGTVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAGASFR PVEPY
Sbjct  389  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGASFRQPVEPY  445



>emb|CDX73592.1| BnaC08g24110D [Brassica napus]
Length=444

 Score =   318 bits (814),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG  KISGD LKDLYKSF++EYPIVSIEDPFD+DDWE YAK+T E+GEK QIVGD
Sbjct  268  KEENNDGSLKISGDALKDLYKSFLAEYPIVSIEDPFDEDDWEHYAKITREVGEKYQIVGD  327

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K+CNALLLKVNQIGSVTESIEAVKM+K+AGWGVM SHRSGETED
Sbjct  328  DLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVTESIEAVKMAKRAGWGVMASHRSGETED  387

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TF+ADL+VGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAG +FR P +PY
Sbjct  388  TFLADLSVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGVNFRKPAKPY  444



>ref|XP_006421751.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
 gb|ESR34991.1| hypothetical protein CICLE_v10004965mg [Citrus clementina]
Length=445

 Score =   317 bits (813),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 150/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QK+SGD LK++Y+SF+S++PIVSIEDPFDQDDWE +A+LT +IG  VQIVGD
Sbjct  269  KEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHHAELTGKIGRHVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAG  FRAPVEPY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRAPVEPY  445



>gb|ACN39925.1| unknown [Picea sitchensis]
Length=445

 Score =   317 bits (812),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 161/177 (91%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENN+G QKISG +L  LY+SF+ +YPIVSIEDPFDQDDW  YA+ T  IGEKVQIVGD
Sbjct  269  KEENNNGSQKISGSELIKLYESFIEDYPIVSIEDPFDQDDWAHYAQFTATIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI  K+CNALLLKVNQIG+VTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVGKAINEKSCNALLLKVNQIGTVTESIEAVKMSKRAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+TG IKTGAPCRSERLAKYNQLLRIEEELGS AVYAGASFR PVEPY
Sbjct  389  TFIADLAVGLSTGHIKTGAPCRSERLAKYNQLLRIEEELGSAAVYAGASFRQPVEPY  445



>ref|XP_006490248.1| PREDICTED: enolase-like [Citrus sinensis]
Length=445

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QK+SGD LK++Y+SF+S++PIVSIEDPFDQDDWE YA+LT +IG  VQIVGD
Sbjct  269  KEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHYAELTGKIGRHVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKM+K+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMAKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAG  FR PV+PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRTPVQPY  445



>gb|KDO65391.1| hypothetical protein CISIN_1g013317mg [Citrus sinensis]
Length=445

 Score =   315 bits (807),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QK+SGD LK++Y+SF+S++PIVSIEDPFDQDDWE YA+LT +IG  VQIVGD
Sbjct  269  KEENNDGSQKVSGDGLKNVYRSFISDHPIVSIEDPFDQDDWEHYAELTGKIGRHVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ KTCNALLLKVNQIGSVTESIEAVKM+K+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKTCNALLLKVNQIGSVTESIEAVKMAKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  A+YAG  FR PV+PY
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGPAAIYAGTKFRTPVQPY  445



>ref|XP_010094249.1| hypothetical protein L484_001983 [Morus notabilis]
 gb|EXB55478.1| hypothetical protein L484_001983 [Morus notabilis]
Length=419

 Score =   314 bits (804),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 154/177 (87%), Positives = 162/177 (92%), Gaps = 5/177 (3%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV+EYPIVSIEDPFDQDDWE YAKLT+EIGE+VQIVGD
Sbjct  248  KEENNDGSQKISGDSLKNVYKSFVTEYPIVSIEDPFDQDDWEHYAKLTSEIGEQVQIVGD  307

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLL     RV KAI+ K CNALLLKVNQIGSVTESIEAVKMSK AGWGVM SHRSGETED
Sbjct  308  DLL-----RVEKAIKEKACNALLLKVNQIGSVTESIEAVKMSKCAGWGVMASHRSGETED  362

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS A+YAGA FRAPVEPY
Sbjct  363  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAAIYAGAKFRAPVEPY  419



>ref|XP_002984551.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
 gb|EFJ14601.1| hypothetical protein SELMODRAFT_120189 [Selaginella moellendorffii]
Length=446

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD+L  LY+SF+ +YPIVSIEDPFDQDDWE YAK T ++G+ VQIVGD
Sbjct  270  KEENNDGSEKISGDKLITLYESFIKDYPIVSIEDPFDQDDWEHYAKFTAKVGKDVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV +AI  K+CNALLLKVNQIG+VTESIEAVK+SK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPKRVQQAISEKSCNALLLKVNQIGTVTESIEAVKLSKQAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FR PVEPY
Sbjct  390  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGANFRNPVEPY  446



>ref|XP_002965441.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
 gb|EFJ32861.1| hypothetical protein SELMODRAFT_167539 [Selaginella moellendorffii]
Length=446

 Score =   314 bits (805),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 163/177 (92%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG +KISGD+L  LY+SF+ +YPIVSIEDPFDQDDWE YAK T ++G+ VQIVGD
Sbjct  270  KEENNDGSEKISGDKLITLYESFIKDYPIVSIEDPFDQDDWEHYAKFTAKVGKDVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV +AI  K+CNALLLKVNQIG+VTESIEAVK+SK+AGWGVMTSHRSGETED
Sbjct  330  DLLVTNPKRVQQAISEKSCNALLLKVNQIGTVTESIEAVKLSKQAGWGVMTSHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA+FR PVEPY
Sbjct  390  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGANFRKPVEPY  446



>gb|KJB07830.1| hypothetical protein B456_001G046400 [Gossypium raimondii]
Length=466

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 167/198 (84%), Gaps = 21/198 (11%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV++YPIVSIEDPFDQDDWE YAK+T+EIGE+VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVTDYPIVSIEDPFDQDDWEHYAKMTSEIGEQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNA---------------LLL------KVNQIGSVTESIEAV  401
            DLLVTNPKRV KAI  KTCNA               L+L      +VNQIGSVTESIEAV
Sbjct  329  DLLVTNPKRVEKAITEKTCNALLLKLLAHYLDELNFLMLSVLCNRQVNQIGSVTESIEAV  388

Query  400  KMSKKAGWGVMTSHRSGETEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEEL  221
            KMSK AGWGVM SHRSGETEDTFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEEL
Sbjct  389  KMSKSAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEEL  448

Query  220  GSDAVYAGASFRAPVEPY  167
            G+ AVYAGA FRAPVEPY
Sbjct  449  GAAAVYAGAKFRAPVEPY  466



>emb|CDX78136.1| BnaA09g33310D [Brassica napus]
Length=242

 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 162/184 (88%), Gaps = 11/184 (6%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSF++EYPIVSIEDPFD+DDWE YAK+T E+GEK Q+VGD
Sbjct  48   KEENNDGSQKISGDALKDLYKSFLAEYPIVSIEDPFDEDDWEHYAKITREVGEKYQVVGD  107

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPK   KAI+ K+CNALLLKVNQIGSVTESIEAVKM+K+AGWGVM SHRSGETED
Sbjct  108  DLLVTNPK---KAIKEKSCNALLLKVNQIGSVTESIEAVKMAKRAGWGVMASHRSGETED  164

Query  337  TFIADLAVGL--------ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRA  182
            TF+ADL+VG         + GQIKTGAPCRSERLAKYNQLLRIEEELG++AVYAG +FR 
Sbjct  165  TFLADLSVGFLVCIVVISSQGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGVNFRK  224

Query  181  PVEP  170
            PV+P
Sbjct  225  PVKP  228



>ref|XP_001751336.1| predicted protein [Physcomitrella patens]
 gb|EDQ83653.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  K++GD+   LY+SFV EYPI+SIEDPFDQDDW  Y+K+   +G+KVQIVGD
Sbjct  269  KEDNNDGSSKLNGDEFIKLYESFVEEYPILSIEDPFDQDDWAHYSKINELMGDKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVA AI+ K CNALLLKVNQIGSVTESIEAV M+KKAGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVAHAIQHKACNALLLKVNQIGSVTESIEAVVMAKKAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            +FIADLAVGL+TGQIKTGAPCRSERL+KYNQLLRIEEELG  AVYAG  FR P EPY
Sbjct  389  SFIADLAVGLSTGQIKTGAPCRSERLSKYNQLLRIEEELGDKAVYAGLKFRKPAEPY  445



>ref|XP_001751337.1| predicted protein [Physcomitrella patens]
 gb|EDQ83654.1| predicted protein [Physcomitrella patens]
Length=445

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 156/177 (88%), Gaps = 0/177 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  K++GD+   LY+SFV EYPI+SIEDPFDQDDW  Y+K+   +G+KVQIVGD
Sbjct  269  KEDNNDGSSKLNGDEFIKLYESFVEEYPILSIEDPFDQDDWAHYSKINELMGDKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVA AI+ K CNALLLKVNQIGSVTESIEAV M+KKAGWGVMTSHRSGETED
Sbjct  329  DLLVTNPKRVAHAIQHKACNALLLKVNQIGSVTESIEAVVMAKKAGWGVMTSHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            +FIADLAVGL+TGQIKTGAPCRSERL+KYNQLLRIEEELG  AVYAG  FR P EPY
Sbjct  389  SFIADLAVGLSTGQIKTGAPCRSERLSKYNQLLRIEEELGDKAVYAGLKFRKPAEPY  445



>gb|KHN24421.1| Enolase [Glycine soja]
Length=448

 Score =   299 bits (765),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 142/173 (82%), Positives = 156/173 (90%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKS+V++YPIVSIEDPFDQDDWE YAKLT E+G++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSYVTDYPIVSIEDPFDQDDWEHYAKLTAEVGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV KAI+ K CNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVEKAIKEKACNALLLKVNQIGSVTESIEAVRMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQLLRIEEELGS         ++P
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSAGCLCWCQIQSP  441



>gb|AAM74365.1|AC116603_1 Putative enolase (2-phospho-D-glycerate hydroylase) [Oryza sativa 
Japonica Group]
Length=303

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  46   KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  105

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  106  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  165

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQ
Sbjct  166  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  196



>gb|KJB16682.1| hypothetical protein B456_002G243100 [Gossypium raimondii]
Length=429

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/152 (92%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LKDLYKSFV+EYPIVSIEDPFDQDDWE Y+KLT EIGEKVQIVGD
Sbjct  269  KEENNDGKQKISGDALKDLYKSFVAEYPIVSIEDPFDQDDWEHYSKLTNEIGEKVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPKRVAKAIAEKTCNALLLKVNQIGSVTESIEAVKMSKQAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQL  242
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQ+
Sbjct  389  TFIADLSVGLATGQIKTGAPCRSERLAKYNQV  420



>gb|ABG65935.1| Enolase, putative, expressed [Oryza sativa Japonica Group]
Length=457

 Score =   290 bits (741),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  304  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  363

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  364  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  423

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQ
Sbjct  424  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  454



>gb|AFW75434.1| putative enolase family protein [Zea mays]
Length=425

 Score =   286 bits (731),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  231  KEENNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWTTYAKLTGEIGQQVQIVGD  290

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  291  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  350

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQL  242
            TFI+DL+VGLATGQIKTGAPCRSERLAKYNQL
Sbjct  351  TFISDLSVGLATGQIKTGAPCRSERLAKYNQL  382



>ref|XP_008650330.1| PREDICTED: enolase 1-like [Zea mays]
Length=460

 Score =   286 bits (731),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/152 (90%), Positives = 143/152 (94%), Gaps = 0/152 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  266  KEENNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWTTYAKLTGEIGQQVQIVGD  325

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  326  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  385

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQL  242
            TFI+DL+VGLATGQIKTGAPCRSERLAKYNQL
Sbjct  386  TFISDLSVGLATGQIKTGAPCRSERLAKYNQL  417



>gb|AAN04181.1| Putative enolase (2-phospho-D-glycerate hydroylase) [Oryza sativa 
Japonica Group]
Length=428

 Score =   284 bits (727),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/177 (80%), Positives = 150/177 (85%), Gaps = 19/177 (11%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDWE YAK+T EIGE+VQIVGD
Sbjct  271  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWEHYAKMTAEIGEQVQIVGD  330

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK+AGWGVMTSHRSGETED
Sbjct  331  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMTSHRSGETED  390

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGLAT                   LLRIEEELG+ AVYAGA FRAPVEPY
Sbjct  391  TFIADLAVGLAT-------------------LLRIEEELGAAAVYAGAKFRAPVEPY  428



>gb|ETO14807.1| enolase 2 [Reticulomyxa filosa]
Length=213

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = -3

Query  691  ENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDL  512
            + +DG +K++ DQL D+YK ++S +P++S+ED FDQDDW+ +A  T + G+K+QIVGDDL
Sbjct  39   KTDDGKKKLTTDQLADIYKGYISHFPVISVEDGFDQDDWKGWASFTEKCGDKIQIVGDDL  98

Query  511  LVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTF  332
            LVTN  R+ KAI+ K+CNALLLKVNQIG++TESIEAV+M+K+AGWGVMTSHRSGETED F
Sbjct  99   LVTNTTRIQKAIKEKSCNALLLKVNQIGTLTESIEAVRMAKQAGWGVMTSHRSGETEDPF  158

Query  331  IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAG +FR P +PY
Sbjct  159  IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGKNFRQPCKPY  213



>ref|XP_004964464.1| PREDICTED: enolase 1-like isoform X2 [Setaria italica]
Length=526

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  270  KEDNNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWSTYAKLTDEIGQQVQIVGD  329

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  330  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  389

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA  209
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQ+      LGS +
Sbjct  390  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQVSTCARLLGSSS  432



>ref|XP_004964463.1| PREDICTED: enolase 1-like isoform X1 [Setaria italica]
Length=550

 Score =   286 bits (732),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE+NNDG  KISGD LKDLYKSFVSEYPIVSIEDPFDQDDW TYAKLT EIG++VQIVGD
Sbjct  294  KEDNNDGSNKISGDSLKDLYKSFVSEYPIVSIEDPFDQDDWSTYAKLTDEIGQQVQIVGD  353

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAV+MSK+AGWGVM SHRSGETED
Sbjct  354  DLLVTNPTRVAKAISEKTCNALLLKVNQIGSVTESIEAVRMSKRAGWGVMASHRSGETED  413

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDA  209
            TFIADL+VGL+TGQIKTGAPCRSERLAKYNQ+      LGS +
Sbjct  414  TFIADLSVGLSTGQIKTGAPCRSERLAKYNQVSTCARLLGSSS  456



>ref|XP_008798541.1| PREDICTED: enolase 2-like [Phoenix dactylifera]
Length=365

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 154/190 (81%), Gaps = 14/190 (7%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISG+ LKD+YKSFVSEYPIVSIEDPFDQDDW  YAK+T EIGE+VQIVGD
Sbjct  177  KEENNDGSQKISGESLKDVYKSFVSEYPIVSIEDPFDQDDWTHYAKMTEEIGEQVQIVGD  236

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ KTCNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  237  DLLVTNPTRVAKAIKEKTCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  296

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYN-------------QLLRIEEELGSDAVYAG  197
            TFIADLAVGL+T ++   A  R E  A  N              LLRIEEELG  AVYAG
Sbjct  297  TFIADLAVGLSTVRLYP-AKSRLELHAVPNALPSITSPSFNTFSLLRIEEELGDAAVYAG  355

Query  196  ASFRAPVEPY  167
            A FRAPVEPY
Sbjct  356  AKFRAPVEPY  365



>gb|AAY34909.1| enolase [Prunus armeniaca]
Length=144

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/144 (89%), Positives = 136/144 (94%), Gaps = 0/144 (0%)
 Frame = -3

Query  598  DPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVT  419
            DPFDQDDWE YAK+T E GE+VQIVGDDLLVTNPKRV KAI+ K+CNALLLKVNQIGSVT
Sbjct  1    DPFDQDDWEHYAKMTAECGEQVQIVGDDLLVTNPKRVEKAIKEKSCNALLLKVNQIGSVT  60

Query  418  ESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLL  239
            ESIEAV+MSKKAGWGVM SHRSGETEDTFIADL+VGLATGQIKTGAPCRSERLAKYNQLL
Sbjct  61   ESIEAVRMSKKAGWGVMASHRSGETEDTFIADLSVGLATGQIKTGAPCRSERLAKYNQLL  120

Query  238  RIEEELGSDAVYAGASFRAPVEPY  167
            RIEEELG++AVYAGA FR PVEPY
Sbjct  121  RIEEELGAEAVYAGAKFRVPVEPY  144



>ref|XP_005716244.1| enolase [Chondrus crispus]
 emb|CDF36425.1| enolase [Chondrus crispus]
Length=441

 Score =   281 bits (718),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K ENNDG Q +SG++L ++YK F   +P++SIEDPFDQDDWE+YAKLT  +GE VQIVGD
Sbjct  266  KTENNDGSQCLSGEKLGEMYKDFCKNFPMISIEDPFDQDDWESYAKLTAAVGEGVQIVGD  325

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP R+   I+ K CNALLLKVNQIGS+TE+I+A KMS+ AGWGVM SHRSGETED
Sbjct  326  DLLVTNPNRIQTGIDKKACNALLLKVNQIGSITEAIQACKMSRDAGWGVMVSHRSGETED  385

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
             FIADL VGL T QIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGA FR P
Sbjct  386  NFIADLCVGLGTAQIKTGAPCRSERLAKYNQLLRIEEELGDAAVYAGAKFRTP  438



>gb|EMS57999.1| Enolase [Triticum urartu]
Length=402

 Score =   279 bits (714),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQIVGD
Sbjct  217  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIVGD  276

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  277  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  336

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQ
Sbjct  337  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQ  367



>ref|XP_008791285.1| PREDICTED: enolase isoform X2 [Phoenix dactylifera]
Length=436

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFV EYPIVSIEDPFDQDDW  YAKLT EIG++VQIVGD
Sbjct  269  KEENNDGSQKISGDSLKNVYKSFVCEYPIVSIEDPFDQDDWAHYAKLTEEIGQQVQIVGD  328

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI  KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  329  DLLVTNPTRVAKAINEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  388

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
             FIADL+VGLATGQIKTGAPCRSERLAKYNQ
Sbjct  389  AFIADLSVGLATGQIKTGAPCRSERLAKYNQ  419



>ref|XP_010050029.1| PREDICTED: enolase-like isoform X2 [Eucalyptus grandis]
Length=491

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KE NNDG QKISG+ LKDLYKSF SEYPIVSIEDPFDQDDWE Y+K T E G+KVQIVGD
Sbjct  315  KEVNNDGSQKISGEALKDLYKSFASEYPIVSIEDPFDQDDWEHYSKFTCEFGDKVQIVGD  374

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+RV KA++ KTCNALLLKVNQIGSVTESIEAVKMSK+AGWGVM SHRSGETED
Sbjct  375  DLLVTNPRRVEKAVKEKTCNALLLKVNQIGSVTESIEAVKMSKRAGWGVMASHRSGETED  434

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADL+VGLATGQIKTGAPCRSERLAKYNQ
Sbjct  435  TFIADLSVGLATGQIKTGAPCRSERLAKYNQ  465



>gb|EWM28602.1| enolase [Nannochloropsis gaditana]
Length=459

 Score =   276 bits (707),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K    DG Q ++G QL D+Y    ++YPIVSIEDPFDQDDW  Y   T  IG KVQ+VGD
Sbjct  283  KNPQGDGKQVLTGPQLADMYMELSNKYPIVSIEDPFDQDDWANYTPFTAAIGSKVQVVGD  342

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKR+ +A + K CNALLLKVNQIGSVTESIEAVK SKK GWGVMTSHRSGETED
Sbjct  343  DLLVTNPKRIKEAAQKKACNALLLKVNQIGSVTESIEAVKDSKKNGWGVMTSHRSGETED  402

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            ++IADLAVGL TGQIKTGAPCRSERLAKYNQLLRIEE+LGS AVYAG SFR P
Sbjct  403  SYIADLAVGLCTGQIKTGAPCRSERLAKYNQLLRIEEDLGSKAVYAGKSFRVP  455



>ref|XP_005791836.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
 gb|EOD39407.1| hypothetical protein EMIHUDRAFT_420746 [Emiliania huxleyi CCMP1516]
Length=499

 Score =   277 bits (709),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -3

Query  697  KEENNDG---XQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQI  527
            K ENNDG    QK+SG+ L  +Y+ F S+YP+VSIEDPFDQDD+ +Y  +T ++GE  Q+
Sbjct  322  KTENNDGAQSSQKMSGESLLSMYEQFCSDYPMVSIEDPFDQDDFASYGAMTAKLGESCQV  381

Query  526  VGDDLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGE  347
            VGDDLLVTNP RV KAI+ K CNALLLKVNQIGS+TE+IEAV M++KAGWGVMTSHRSGE
Sbjct  382  VGDDLLVTNPTRVQKAIDDKACNALLLKVNQIGSITEAIEAVNMAQKAGWGVMTSHRSGE  441

Query  346  TEDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TED+FIADLAVGL TGQIKTGAPCRSERLAKYNQLLRIEEELG  A+Y GA FR+P
Sbjct  442  TEDSFIADLAVGLKTGQIKTGAPCRSERLAKYNQLLRIEEELGDCAIYTGADFRSP  497



>gb|EMT25998.1| Enolase [Aegilops tauschii]
Length=474

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQIVGD
Sbjct  289  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIVGD  348

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  349  DLLVTNPTRVAKAIKEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  408

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQ
Sbjct  409  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQ  439



>ref|XP_004362164.1| phosphopyruvate hydratase [Dictyostelium fasciculatum]
 gb|EGG24313.1| phosphopyruvate hydratase [Dictyostelium fasciculatum]
Length=436

 Score =   273 bits (697),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K +NNDG Q ISG+ L  LYK FV+EYPIVSIEDPFDQDDWE+Y KLT+     VQIVGD
Sbjct  264  KTKNNDGSQVISGEALGQLYKDFVAEYPIVSIEDPFDQDDWESYTKLTSST--HVQIVGD  321

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPK+V + I+ K CNALLLK+NQIG+VTESI+A  +++ AGWGVM SHRSGETED
Sbjct  322  DLLVTNPKKVQEGIDKKACNALLLKLNQIGTVTESIQACLLAQSAGWGVMVSHRSGETED  381

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELG DAV+ G  FR P
Sbjct  382  TFIADLVVGLQTGQIKTGAPCRSERLAKYNQLLRIEEELGKDAVFVGEKFRNP  434



>gb|EMS64258.1| Enolase 2 [Triticum urartu]
Length=661

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQIVGD
Sbjct  496  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIVGD  555

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  556  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  615

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQ  245
            TFIADLAVGL+TGQIKTGAPCRSERLAKYNQ
Sbjct  616  TFIADLAVGLSTGQIKTGAPCRSERLAKYNQ  646



>sp|P56252.1|ENO_HOMGA RecName: Full=Enolase; AltName: Full=2-phospho-D-glycerate hydro-lyase; 
AltName: Full=2-phosphoglycerate dehydratase [Homarus 
gammarus]
Length=433

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NNDG QKISGDQL+D+Y  F  ++PIVSIEDPFDQDDWET++K+T+  G  +QIVGD
Sbjct  262  KTANNDGSQKISGDQLRDMYMEFCKDFPIVSIEDPFDQDDWETWSKMTS--GTTIQIVGD  319

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNPKR+  A+E K C  LLLKVNQIGSVTESI+A  ++KK GWG M SHRSGETED
Sbjct  320  DLTVTNPKRITTAVEKKACKCLLLKVNQIGSVTESIDAHLLAKKNGWGTMVSHRSGETED  379

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
             FIADL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEELGS A +AG +FRAP
Sbjct  380  CFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSGAKFAGKNFRAP  432



>pdb|1PDZ|A Chain A, X-Ray Structure And Catalytic Mechanism Of Lobster Enolase
 pdb|1PDY|A Chain A, X-Ray Structure And Catalytic Mechanism Of Lobster Enolase
Length=434

 Score =   271 bits (693),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NNDG QKISGDQL+D+Y  F  ++PIVSIEDPFDQDDWET++K+T+  G  +QIVGD
Sbjct  263  KTANNDGSQKISGDQLRDMYMEFCKDFPIVSIEDPFDQDDWETWSKMTS--GTTIQIVGD  320

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNPKR+  A+E K C  LLLKVNQIGSVTESI+A  ++KK GWG M SHRSGETED
Sbjct  321  DLTVTNPKRITTAVEKKACKCLLLKVNQIGSVTESIDAHLLAKKNGWGTMVSHRSGETED  380

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
             FIADL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEELGS A +AG +FRAP
Sbjct  381  CFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSGAKFAGKNFRAP  433



>emb|CBJ32586.1| enolase [Ectocarpus siliculosus]
Length=455

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 144/171 (84%), Gaps = 0/171 (0%)
 Frame = -3

Query  691  ENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDL  512
            +N  G Q+++G++L  LYK   ++YPIVSIEDPFDQDDW  YA  T  +G+ VQ+VGDDL
Sbjct  281  KNKGGDQQLTGEELGQLYKDLAAKYPIVSIEDPFDQDDWANYAPFTAAVGDAVQVVGDDL  340

Query  511  LVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTF  332
            LVTNP R+ +A E K CNALLLKVNQIGSVTESI+AV MSK+ GWGVMTSHRSGETED +
Sbjct  341  LVTNPSRITEAGEKKACNALLLKVNQIGSVTESIKAVTMSKQLGWGVMTSHRSGETEDNY  400

Query  331  IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            IAD+AVGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG +FR P
Sbjct  401  IADIAVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAVYAGQNFRTP  451



>ref|XP_003294597.1| hypothetical protein DICPUDRAFT_93248 [Dictyostelium purpureum]
 gb|EGC28876.1| hypothetical protein DICPUDRAFT_93248 [Dictyostelium purpureum]
Length=194

 Score =   262 bits (670),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 147/176 (84%), Gaps = 7/176 (4%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K +NNDG Q ISG++L DLY+ F+ EYPIVSIEDPFDQDDWE+Y+KLT+ +  ++QIVGD
Sbjct  19   KTKNNDGSQVISGEKLGDLYREFIKEYPIVSIEDPFDQDDWESYSKLTSSV--QIQIVGD  76

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+R+ + I+ K CNALLLKVNQIGSVTESI+A   SK AGWGVM SHRSGETED
Sbjct  77   DLLVTNPERIKEGIQKKACNALLLKVNQIGSVTESIQAAIDSKNAGWGVMVSHRSGETED  136

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG-----SDAVYAGASFR  185
            TFIADL VGL TGQIKTGAPCRSERLAKYNQ++RI+EEL      +D +YAG  FR
Sbjct  137  TFIADLVVGLGTGQIKTGAPCRSERLAKYNQIVRIDEELAENGNNTDELYAGEKFR  192



>gb|EMT07160.1| Enolase [Aegilops tauschii]
Length=362

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 143/177 (81%), Gaps = 19/177 (11%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            KEENNDG QKISGD LK++YKSFVSEYPIVSIEDPFDQDDW  YAK+T E G +VQI GD
Sbjct  205  KEENNDGSQKISGDSLKNVYKSFVSEYPIVSIEDPFDQDDWVHYAKMTEECGVEVQIGGD  264

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RVAKAI+ K+CNALLLKVNQIGSVTESIEAVKMSK AGWGVMTSHRSGETED
Sbjct  265  DLLVTNPTRVAKAIQEKSCNALLLKVNQIGSVTESIEAVKMSKHAGWGVMTSHRSGETED  324

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEPY  167
            TFIADLAVGL+T                   LLRIEEELG  AVYAG  FRAPVEPY
Sbjct  325  TFIADLAVGLST-------------------LLRIEEELGDAAVYAGLKFRAPVEPY  362



>ref|NP_001271501.1| uncharacterized protein LOC101866389 [Macaca fascicularis]
 dbj|BAE88029.1| unnamed protein product [Macaca fascicularis]
Length=191

 Score =   262 bits (669),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDW  + K TT  G  +Q+VGDDL V
Sbjct  22   DDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTTSAG--IQVVGDDLTV  79

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  80   TNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIA  139

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  140  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  189



>dbj|GAM19564.1| hypothetical protein SAMD00019534_027390 [Acytostelium subglobosum 
LB1]
Length=436

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K +NNDG Q ISG+ L DLY+SFV++YP++SIEDPFDQDDWE+Y+KLT  +   +QIVGD
Sbjct  264  KTKNNDGSQVISGEALGDLYRSFVAQYPVISIEDPFDQDDWESYSKLTASV--PIQIVGD  321

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+R+ + I+ K CNALLLKVNQIGSVTESIEA  MS+   WGVM SHRSGETED
Sbjct  322  DLLVTNPQRIKEGIQKKACNALLLKVNQIGSVTESIEACTMSQNEKWGVMVSHRSGETED  381

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGL TGQIKTGAPCRSERLAKYNQLLRIEEE+   + +AG SFR P
Sbjct  382  TFIADLVVGLGTGQIKTGAPCRSERLAKYNQLLRIEEEVAGHSKFAGESFRHP  434



>emb|CAI39008.1| enolase, putative [Paramecium tetraurelia]
Length=449

 Score =   270 bits (690),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K   NDG +K++  QL +LY  FVS +PIVSIEDPFDQDDWE Y + T +IG+KVQIVGD
Sbjct  275  KNAKNDGSKKLTAKQLTELYLKFVSSHPIVSIEDPFDQDDWEGYTQFTAKIGQKVQIVGD  334

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RV +AI  K CNALLLKVNQIGS+TESIEA  +S+K G+GVM SHRSGETED
Sbjct  335  DLLVTNPIRVQEAINRKACNALLLKVNQIGSLTESIEASNLSQKNGFGVMVSHRSGETED  394

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
             FIADL VGL TGQIKTGAPCRSER AKYNQ+LRIEEELGS AVYAG +FR P
Sbjct  395  NFIADLVVGLGTGQIKTGAPCRSERTAKYNQILRIEEELGSKAVYAGKNFRNP  447



>ref|XP_001452406.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAI39017.1| enolase, putative [Paramecium tetraurelia]
 emb|CAK85009.1| unnamed protein product [Paramecium tetraurelia]
Length=449

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K   NDG +K++  QL +LY  FVS +PIVSIEDPFDQDDWE Y + T +IG+KVQIVGD
Sbjct  275  KNAKNDGSKKLTAQQLTELYLKFVSSHPIVSIEDPFDQDDWEGYTQFTAKIGQKVQIVGD  334

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RV +AI  K CNALLLKVNQIGS+TESIEA  +S+K G+GVM SHRSGETED
Sbjct  335  DLLVTNPIRVQEAINRKACNALLLKVNQIGSLTESIEASNLSQKNGFGVMVSHRSGETED  394

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
             FIADL VGL TGQIKTGAPCRSER AKYNQ+LRIEEELGS AVYAG +FR P
Sbjct  395  NFIADLVVGLGTGQIKTGAPCRSERTAKYNQILRIEEELGSKAVYAGKNFRNP  447



>ref|XP_002507278.1| enolase [Micromonas sp. RCC299]
 gb|ACO68536.1| enolase [Micromonas sp. RCC299]
Length=477

 Score =   270 bits (689),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/171 (75%), Positives = 148/171 (87%), Gaps = 2/171 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K ENNDG  K SG+++  +YK F +EYPIVSIEDPFDQDD+E    LT+      Q+VGD
Sbjct  305  KTENNDGSMKKSGEEMIAMYKEFCAEYPIVSIEDPFDQDDFENTGILTSS--GVCQVVGD  362

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+RVA AIE K CNALLLKVNQIGS++E+IEAV+MSKKAGWGVM SHRSGETED
Sbjct  363  DLLVTNPERVATAIEAKACNALLLKVNQIGSISEAIEAVRMSKKAGWGVMASHRSGETED  422

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            ++IADL+VGLATGQIKTGAPCRSERL+KYNQLLRIEEELG+DA+YAG S+R
Sbjct  423  SYIADLSVGLATGQIKTGAPCRSERLSKYNQLLRIEEELGADAIYAGESYR  473



>gb|KFP49382.1| Alpha-enolase [Cathartes aura]
Length=191

 Score =   260 bits (664),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYK FV  YP+VSIEDPFDQDDW  + K T  +G  +Q+VGDDL V
Sbjct  22   DDPSRYISPDQLADLYKGFVKNYPLVSIEDPFDQDDWAAWKKFTGSVG--IQVVGDDLTV  79

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+E K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  80   TNPKRIAKAVEEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIA  139

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P 
Sbjct  140  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGRNFRNPC  189



>gb|AAC78141.1| phosphopyruvate hydratase [Penaeus monodon]
Length=434

 Score =   268 bits (685),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 2/174 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NNDG QKI+GDQL+D+Y  F  E+PIVSIEDPFDQDDWE + K+T+     +QIVGD
Sbjct  263  KTANNDGSQKITGDQLRDMYMEFCKEFPIVSIEDPFDQDDWENWTKMTS--ATNIQIVGD  320

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNPKR+A A+E K CN LLLKVNQIGSVTESI+A  ++KK GWG M SHRSGETED
Sbjct  321  DLTVTNPKRIATAVEKKACNCLLLKVNQIGSVTESIDAHLLAKKNGWGTMVSHRSGETED  380

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
             FIADL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEELG +A +AG  FR P 
Sbjct  381  CFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGGNAKFAGKKFRKPC  434



>gb|AAH09218.2| ENO1 protein, partial [Homo sapiens]
Length=184

 Score =   259 bits (662),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDW  + K T   G  +Q+VGDDL V
Sbjct  15   DDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG--IQVVGDDLTV  72

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  73   TNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIA  132

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  133  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  182



>gb|EFA77097.1| phosphopyruvate hydratase [Polysphondylium pallidum PN500]
Length=435

 Score =   268 bits (684),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 144/173 (83%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K +NNDG Q +SG++L DLYK F+  YPIVSIEDPFDQDDWE+YAKLT      VQIVGD
Sbjct  264  KTKNNDGSQVLSGEKLGDLYKDFIQNYPIVSIEDPFDQDDWESYAKLTAST--HVQIVGD  321

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKR+ + IE K CNALLLKVNQIG+VTESI+A  +++ AGWGVM SHRSGETED
Sbjct  322  DLLVTNPKRIQEGIEKKACNALLLKVNQIGTVTESIQACNLARSAGWGVMVSHRSGETED  381

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEE+  ++ +AG  FR P
Sbjct  382  TFIADLVVGLGTGQIKTGAPCRSERLAKYNQILRIEEEIVKNSKFAGEDFRNP  434



>ref|XP_002899300.1| enolase [Phytophthora infestans T30-4]
 gb|EEY62269.1| enolase [Phytophthora infestans T30-4]
Length=457

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++G++L  LYK    E+PI+SIEDPFDQDDW  Y+  T  IGEKVQIVGDDLL TNPKR+
Sbjct  292  LTGEELGQLYKDLAKEFPIMSIEDPFDQDDWTHYSSFTAGIGEKVQIVGDDLLCTNPKRI  351

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
            A A++ K CNALLLKVNQIGSVTES++AV +++K GWGVMTSHRSGETEDT+IADLAVGL
Sbjct  352  ATALDKKACNALLLKVNQIGSVTESVDAVALAQKNGWGVMTSHRSGETEDTYIADLAVGL  411

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            ATGQIKTGAPCRSERLAKYNQLLRIEE LGSDA YAG  FR P
Sbjct  412  ATGQIKTGAPCRSERLAKYNQLLRIEEALGSDAKYAGKHFRNP  454



>ref|XP_001415437.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93729.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=477

 Score =   268 bits (686),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K E NDG  K +G ++ DLY+ F+SEYP++SIEDPFDQDD E  A LT +     QIVGD
Sbjct  305  KTEGNDGSMKKTGAEMIDLYQEFISEYPMISIEDPFDQDDAENTAALTAK--NNCQIVGD  362

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKRV  AI+GK CNALLLKVNQIG+++ESIEAV MSKKAGWGVM SHRSGETED
Sbjct  363  DLLVTNPKRVQAAIDGKWCNALLLKVNQIGTISESIEAVGMSKKAGWGVMASHRSGETED  422

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            +FIADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEEELG  AVYAGAS++
Sbjct  423  SFIADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEELGDKAVYAGASYK  473



>gb|KGL76760.1| Alpha-enolase [Tinamus guttatus]
Length=191

 Score =   259 bits (661),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYK FV  YP+VSIEDPFDQDDW  + K T  +G  +Q+VGDDL V
Sbjct  22   DDPSRYISPDQLADLYKGFVKNYPVVSIEDPFDQDDWAAWKKFTGSVG--IQVVGDDLTV  79

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA E K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  80   TNPKRIAKAAEEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIA  139

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P
Sbjct  140  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGRNFRNP  188



>ref|XP_002962785.1| hypothetical protein SELMODRAFT_165356 [Selaginella moellendorffii]
 gb|EFJ36248.1| hypothetical protein SELMODRAFT_165356 [Selaginella moellendorffii]
Length=479

 Score =   268 bits (686),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 4/177 (2%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKV-QIVG  521
            K  NN G +K +G Q+ D+YK F +EYP++SIEDPFDQDDWE    LT   G  + Q+VG
Sbjct  305  KTPNNSGAEKRTGAQMIDMYKEFCTEYPVISIEDPFDQDDWENTKTLT---GLNICQVVG  361

Query  520  DDLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETE  341
            DDLLVTNPKRVAKAIE KTCNALLLKVNQIG+VTESI+AV M+K A WGVM SHRSGETE
Sbjct  362  DDLLVTNPKRVAKAIEDKTCNALLLKVNQIGTVTESIQAVNMAKAASWGVMASHRSGETE  421

Query  340  DTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEP  170
            D+FIADLAVGL+TGQIKTGAPCRSERLAKYNQL+RIEEELG  AVYAGA++R    P
Sbjct  422  DSFIADLAVGLSTGQIKTGAPCRSERLAKYNQLMRIEEELGPKAVYAGANWRPNAPP  478



>gb|ETL94004.1| enolase, partial [Phytophthora parasitica]
Length=185

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 144/173 (83%), Gaps = 4/173 (2%)
 Frame = -3

Query  691  ENNDGXQKISGDQLKDLYKSFVSEYP----IVSIEDPFDQDDWETYAKLTTEIGEKVQIV  524
            EN    +KIS D+L+++Y+ F+++      IVSIEDPFDQDDW ++ K T ++G+ VQIV
Sbjct  2    ENAAESEKISADKLQEVYEGFIAKCANSSKIVSIEDPFDQDDWASWVKFTGKVGKDVQIV  61

Query  523  GDDLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGET  344
            GDDL VTNP RV KAIE K CNALLLKVNQIGS+TESIEAV M+KKAGWG+M SHRSGET
Sbjct  62   GDDLTVTNPTRVKKAIEQKACNALLLKVNQIGSITESIEAVTMAKKAGWGIMASHRSGET  121

Query  343  EDTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            EDTFIADLAVGL+ GQIKTGAPCRSERLAKYNQLLRIEEELG+ A YAG  FR
Sbjct  122  EDTFIADLAVGLSAGQIKTGAPCRSERLAKYNQLLRIEEELGNKARYAGEDFR  174



>ref|XP_002962502.1| hypothetical protein SELMODRAFT_78644 [Selaginella moellendorffii]
 gb|EFJ35965.1| hypothetical protein SELMODRAFT_78644 [Selaginella moellendorffii]
Length=480

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 147/177 (83%), Gaps = 4/177 (2%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKV-QIVG  521
            K  NN G +K +G Q+ D+YK F +EYP++SIEDPFDQDDWE    LT   G  + Q+VG
Sbjct  306  KTPNNSGAEKRTGAQMIDMYKEFCTEYPVISIEDPFDQDDWENTKTLT---GLNICQVVG  362

Query  520  DDLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETE  341
            DDLLVTNPKRVAKAIE KTCNALLLKVNQIG+VTESI+AV M+K A WGVM SHRSGETE
Sbjct  363  DDLLVTNPKRVAKAIEDKTCNALLLKVNQIGTVTESIQAVNMAKAASWGVMASHRSGETE  422

Query  340  DTFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVEP  170
            D+FIADLAVGL+TGQIKTGAPCRSERLAKYNQL+RIEEELG  AVYAGA++R    P
Sbjct  423  DSFIADLAVGLSTGQIKTGAPCRSERLAKYNQLMRIEEELGPKAVYAGANWRPNAPP  479



>ref|XP_005112796.1| PREDICTED: enolase-like isoform X2 [Aplysia californica]
Length=377

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++ DQL ++YKSFVS YP+++IEDPFDQDDW+ ++K+T+  G  +QIVGDDLLVTNPKRV
Sbjct  215  VTSDQLGEIYKSFVSNYPVITIEDPFDQDDWQAWSKMTSNAG--IQIVGDDLLVTNPKRV  272

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
             K I+ K CNALLLKVNQIG+VTE+I+A KMS +AGWGVM SHRSGETEDTFIADL VGL
Sbjct  273  QKGIDTKACNALLLKVNQIGTVTEAIDACKMSHEAGWGVMVSHRSGETEDTFIADLVVGL  332

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            +TGQIKTGAPCRSERLAKYNQ+LRIEEELG+DA YAG +F+ P
Sbjct  333  STGQIKTGAPCRSERLAKYNQILRIEEELGADAKYAGKNFKNP  375



>ref|XP_011399343.1| Enolase [Auxenochlorella protothecoides]
 gb|KFM22422.1| Enolase [Auxenochlorella protothecoides]
Length=595

 Score =   271 bits (693),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K E NDG Q+ S ++++  YK   + YPI+SIEDPFDQDDWETYA LT ++   VQIVGD
Sbjct  422  KSEPNDGSQRKSQEEIRAFYKELATSYPIISIEDPFDQDDWETYAALTADL--DVQIVGD  479

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLL TNP RV KAI+ K CNALLLKVNQIGSVTESI+AV +SK AG+GVMTSHRSGETED
Sbjct  480  DLLCTNPVRVQKAIDTKACNALLLKVNQIGSVTESIQAVNLSKSAGFGVMTSHRSGETED  539

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+DAVYAG S+R
Sbjct  540  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGESWR  590



>ref|XP_001014643.1| enolase family protein [Tetrahymena thermophila]
 gb|EAR94453.1| phosphopyruvate hydratase [Tetrahymena thermophila SB210]
Length=464

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NNDG  +++G+ L +LY+  V EY IVSIEDPFDQDDW  YA +   +G+  QIVGD
Sbjct  288  KTANNDGSNQLTGEALTNLYQQLVKEYGIVSIEDPFDQDDWAAYANMNALVGKTTQIVGD  347

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP RV +AI+ K CNALLLKVNQIGSVTESIEA  +S+ AG+GVM SHRSGETED
Sbjct  348  DLLVTNPTRVKQAIQSKACNALLLKVNQIGSVTESIEASVLSQNAGFGVMVSHRSGETED  407

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGLATGQIKTGAPCRSERLAKYNQLLRIE+E+GS AV+AG SFR P
Sbjct  408  TFIADLVVGLATGQIKTGAPCRSERLAKYNQLLRIEQEVGSKAVFAGKSFRNP  460



>ref|XP_003413233.1| PREDICTED: alpha-enolase [Loxodonta africana]
Length=434

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 2/169 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDWE +AK T   G  +Q+VGDDL V
Sbjct  265  DDASRYISPDQLSDLYKSFIKDYPVVSIEDPFDQDDWEAWAKFTASSG--IQVVGDDLTV  322

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++ +GWGVM SHRSGETEDTFIA
Sbjct  323  TNPKRIAKAVSEKSCNCLLLKVNQIGSVTESLQACKLAQSSGWGVMVSHRSGETEDTFIA  382

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG  FR P
Sbjct  383  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGQKFRNP  431



>ref|XP_011404007.1| PREDICTED: enolase-like [Amphimedon queenslandica]
Length=436

 Score =   266 bits (681),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  N+D  + ++  QLKDLYKSF+S+YPIVSIED FDQDDWE +   T E    +QIVGD
Sbjct  263  KNPNSDPSKWLTASQLKDLYKSFISDYPIVSIEDGFDQDDWEGWTSFTAET--DIQIVGD  320

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNPKR++ AIE K CNALLLKVNQIGSVTESIEA  M+++ GWGVM SHRSGETED
Sbjct  321  DLLVTNPKRISTAIERKACNALLLKVNQIGSVTESIEACNMAQRNGWGVMVSHRSGETED  380

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPVE  173
            TFIADL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEELG  AV+AG  FR P++
Sbjct  381  TFIADLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGDKAVFAGTKFRNPLK  435



>ref|XP_003884000.1| unnamed protein product [Neospora caninum Liverpool]
 emb|CBZ53968.1| unnamed protein product [Neospora caninum Liverpool]
Length=475

 Score =   267 bits (683),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 146/171 (85%), Gaps = 0/171 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  +ND  Q+ SG++L+ LYK    +YPIVSIEDPFDQDD+ +Y++LT+E+GEKVQIVGD
Sbjct  302  KVPDNDKSQRKSGEELRKLYKELSEKYPIVSIEDPFDQDDFHSYSQLTSEVGEKVQIVGD  361

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP R+AKA+E K CN LLLKVNQIG+V+ESIEA ++++K  WGVM SHRSGETED
Sbjct  362  DLLVTNPTRIAKAVEEKACNGLLLKVNQIGTVSESIEACQLAQKNNWGVMVSHRSGETED  421

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            +FIADL VGL TGQIKTGAPCRSERL KYNQL+RIEE LGSD  YAGASFR
Sbjct  422  SFIADLVVGLRTGQIKTGAPCRSERLCKYNQLMRIEESLGSDCQYAGASFR  472



>ref|XP_002164467.2| PREDICTED: beta-enolase-like [Hydra vulgaris]
Length=341

 Score =   263 bits (672),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 144/174 (83%), Gaps = 2/174 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K    D  + +SG++L +LYK F++EYPIVSIED FDQDDWE++++LT  +G  +QIVGD
Sbjct  169  KSSTKDPSKVLSGEELGELYKKFIAEYPIVSIEDVFDQDDWESWSRLTGSVG--IQIVGD  226

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNP R+  A+E K CNALLLKVNQIGSVTESIEA K+++K GWGVM SHRSGETED
Sbjct  227  DLTVTNPLRIQMAVEKKACNALLLKVNQIGSVTESIEACKLAQKNGWGVMVSHRSGETED  286

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            TFIADL VGL  GQIKTGAPCRSERLAKYNQLLRIEEELGS AVYAG  FR P+
Sbjct  287  TFIADLVVGLCAGQIKTGAPCRSERLAKYNQLLRIEEELGSSAVYAGKKFRHPL  340



>ref|XP_003056091.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH59467.1| predicted protein [Micromonas pusilla CCMP1545]
Length=478

 Score =   267 bits (683),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 146/171 (85%), Gaps = 2/171 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K ENNDG  K +G+++  +YK F SEYPIVSIEDPFDQDD+E    LT       Q+VGD
Sbjct  306  KTENNDGSLKKTGEEMIAMYKEFCSEYPIVSIEDPFDQDDFENTGTLTAS--GVCQVVGD  363

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP+RVA AIE K CNALLLKVNQIGS+TE+IEAV+MSKKAGWGVM SHRSGETED
Sbjct  364  DLLVTNPERVATAIESKACNALLLKVNQIGSITEAIEAVRMSKKAGWGVMASHRSGETED  423

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFR  185
            ++IADLAVGLATGQIKTGAPCRSERL+KYNQLLRIEEELGS+A YAG ++R
Sbjct  424  SYIADLAVGLATGQIKTGAPCRSERLSKYNQLLRIEEELGSEASYAGENYR  474



>ref|XP_010212229.1| PREDICTED: alpha-enolase, partial [Tinamus guttatus]
Length=211

 Score =   258 bits (660),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 2/169 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYK FV  YP+VSIEDPFDQDDW  + K T  +G  +Q+VGDDL V
Sbjct  42   DDPSRYISPDQLADLYKGFVKNYPVVSIEDPFDQDDWAAWKKFTGSVG--IQVVGDDLTV  99

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA E K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  100  TNPKRIAKAAEEKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIA  159

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P
Sbjct  160  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGRNFRNP  208



>sp|Q9BPL7.1|ENO2_TOXGO RecName: Full=Enolase 2; AltName: Full=2-phospho-D-glycerate 
hydro-lyase 2; AltName: Full=2-phosphoglycerate dehydratase 
2 [Toxoplasma gondii]
 gb|AAG60329.1|AF123457_1 enolase [Toxoplasma gondii]
 gb|AAP24057.1| enolase 2 [Toxoplasma gondii]
Length=444

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NND  Q+ +G++L++LYK    +YP VSIEDPFDQDD+ +YA+LT E+GEKVQIVGD
Sbjct  271  KTPNNDKSQRKTGEELRNLYKDLCQKYPFVSIEDPFDQDDFHSYAQLTNEVGEKVQIVGD  330

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP R+ KA++ K CN LLLKVNQIG+V+ESIEA ++++K  WGVM SHRSGETED
Sbjct  331  DLLVTNPTRIEKAVQEKACNGLLLKVNQIGTVSESIEACQLAQKNKWGVMVSHRSGETED  390

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            +FIADL VGL TGQIKTGAPCRSERL KYNQL+RIEE LGSD  YAGA FR P
Sbjct  391  SFIADLVVGLRTGQIKTGAPCRSERLCKYNQLMRIEESLGSDCQYAGAGFRHP  443



>emb|CCI42145.1| unnamed protein product [Albugo candida]
Length=471

 Score =   267 bits (682),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 143/171 (84%), Gaps = 0/171 (0%)
 Frame = -3

Query  691  ENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDL  512
            EN D  Q +SG+ L  LY+  + E+PIVSIEDPFDQDDW  Y++LT  IG+ VQIVGDDL
Sbjct  299  ENKDQTQLLSGEALGQLYQGLIKEFPIVSIEDPFDQDDWSNYSQLTATIGQNVQIVGDDL  358

Query  511  LVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTF  332
            L TNPKR+  A+  K CNALLLKVNQIGSV+ES++AV ++++ GWGVMTSHRSGETED++
Sbjct  359  LCTNPKRIKTALSKKACNALLLKVNQIGSVSESVDAVALAQENGWGVMTSHRSGETEDSY  418

Query  331  IADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            IADLAVGL+TGQIKTGAPCRSERLAKYNQLLRIEE LG DA YAG +FR P
Sbjct  419  IADLAVGLSTGQIKTGAPCRSERLAKYNQLLRIEEMLGKDAKYAGKAFRNP  469



>ref|XP_008903925.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETN10819.1| enolase [Phytophthora parasitica INRA-310]
 gb|ETP46351.1| enolase [Phytophthora parasitica P10297]
Length=457

 Score =   266 bits (681),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++G++L  LYK    E+PI+SIEDPFDQDDW  Y+  T  IG+KVQIVGDDLL TNPKR+
Sbjct  292  LTGEELGQLYKDLAKEFPIISIEDPFDQDDWTHYSSFTAGIGDKVQIVGDDLLCTNPKRI  351

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
            A A++ K CNALLLKVNQIGSVTES++AV +++K GWGVMTSHRSGETED++IADLAVGL
Sbjct  352  ATALDKKACNALLLKVNQIGSVTESVDAVALAQKNGWGVMTSHRSGETEDSYIADLAVGL  411

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            ATGQIKTGAPCRSERLAKYNQLLRIEE LGSDA YAG  FR P
Sbjct  412  ATGQIKTGAPCRSERLAKYNQLLRIEEALGSDAKYAGKHFRNP  454



>gb|EGT35057.1| hypothetical protein CAEBREN_22407 [Caenorhabditis brenneri]
 gb|EGT35078.1| hypothetical protein CAEBREN_18669 [Caenorhabditis brenneri]
Length=434

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 145/173 (84%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K + +D  + +SGDQL +LY+SF+ EYP+VSIED FDQDDW+ + KL+      +Q+VGD
Sbjct  262  KNDASDASKWLSGDQLAELYQSFIKEYPVVSIEDAFDQDDWDNWGKLSA--ATTIQLVGD  319

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNPKR+  AI+ K+CN LLLKVNQIGSVTESIEA K+S+  GWGVM SHRSGETED
Sbjct  320  DLTVTNPKRIRTAIDKKSCNCLLLKVNQIGSVTESIEAAKLSRANGWGVMVSHRSGETED  379

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG+DAVYAG +FR P
Sbjct  380  TFIADLVVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGQNFRNP  432



>gb|ETO77406.1| enolase [Phytophthora parasitica P1976]
Length=457

 Score =   266 bits (681),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++G++L  LYK    E+PI+SIEDPFDQDDW  Y+  T  IG+KVQIVGDDLL TNPKR+
Sbjct  292  LTGEELGQLYKDLAKEFPIISIEDPFDQDDWTHYSSFTAGIGDKVQIVGDDLLCTNPKRI  351

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
            A A++ K CNALLLKVNQIGSVTES++AV +++K GWGVMTSHRSGETED++IADLAVGL
Sbjct  352  ATALDKKACNALLLKVNQIGSVTESVDAVALAQKNGWGVMTSHRSGETEDSYIADLAVGL  411

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            ATGQIKTGAPCRSERLAKYNQLLRIEE LGSDA YAG  FR P
Sbjct  412  ATGQIKTGAPCRSERLAKYNQLLRIEEALGSDAKYAGKHFRNP  454



>ref|XP_004596130.1| PREDICTED: alpha-enolase isoform X2 [Ochotona princeps]
Length=391

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + I+ DQL DLYKSFV +YP+VSIEDPFDQDDWE + K T   G  +Q+VGDDL V
Sbjct  222  DDPSRYITPDQLADLYKSFVKDYPVVSIEDPFDQDDWEAWQKFTASAG--IQVVGDDLTV  279

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+E K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  280  TNPKRIAKAVEQKSCNCLLLKVNQIGSVTESLKACKLAQSNGWGVMVSHRSGETEDTFIA  339

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  340  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  389



>ref|XP_003793296.1| PREDICTED: alpha-enolase [Otolemur garnettii]
Length=434

 Score =   265 bits (678),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 145/170 (85%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + I+ DQL DLYKSF+ +YP+VSIEDPFDQDDWE++ K T+  G  +Q+VGDDL V
Sbjct  265  DDPSRYITPDQLADLYKSFIKDYPVVSIEDPFDQDDWESWQKFTSSAG--IQVVGDDLTV  322

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR++KA+  K+CN LLLKVNQIGSVTES++A KM++  GWGVM SHRSGETEDTFIA
Sbjct  323  TNPKRISKAVSEKSCNCLLLKVNQIGSVTESLQACKMAQSNGWGVMVSHRSGETEDTFIA  382

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQ+LRIEEELGS AV+AG +FR P+
Sbjct  383  DLVVGLCTGQIKTGAPCRSERLAKYNQILRIEEELGSKAVFAGRNFRNPL  432



>gb|KHJ80785.1| Enolase, TIM barrel domain protein [Oesophagostomum dentatum]
Length=191

 Score =   257 bits (657),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 139/173 (80%), Gaps = 2/173 (1%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K   +D  + ++GDQL  LY  F+ +YP+VSIED FDQDDW+ + KL       +Q+VGD
Sbjct  19   KNPKSDPSKWLTGDQLATLYHEFIKQYPVVSIEDAFDQDDWDNWGKLMKST--DIQLVGD  76

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DL VTNPKR+ +AI+ K+CN LLLKVNQIGSVTESIEA K+S+  GWGVM SHRSGETED
Sbjct  77   DLTVTNPKRIRQAIDKKSCNCLLLKVNQIGSVTESIEAAKLSRSNGWGVMVSHRSGETED  136

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            TFIADL VGLATGQIKTGAPCRSERLAKYNQLLRIEEELG DAVYAG  FR P
Sbjct  137  TFIADLVVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGKDAVYAGTHFRNP  189



>gb|ETI48672.1| enolase [Phytophthora parasitica P1569]
 gb|ETL95124.1| enolase [Phytophthora parasitica]
 gb|ETM48350.1| enolase [Phytophthora parasitica]
 gb|ETP18443.1| enolase [Phytophthora parasitica CJ01A1]
Length=457

 Score =   266 bits (679),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++G++L  LYK    E+PI+SIEDPFDQDDW  Y+  T  IG+KVQIVGDDLL TNPKR+
Sbjct  292  LTGEELGQLYKDLAKEFPIISIEDPFDQDDWTHYSSFTAGIGDKVQIVGDDLLCTNPKRI  351

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
            A A++ K CNALLLKVNQIGSVTES++AV +++K GWGVMTSHRSGETED++IADLAVGL
Sbjct  352  ATALDKKACNALLLKVNQIGSVTESVDAVALAQKNGWGVMTSHRSGETEDSYIADLAVGL  411

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            ATGQIKTGAPCRSERLAKYNQLLRIEE LGSDA YAG  FR P
Sbjct  412  ATGQIKTGAPCRSERLAKYNQLLRIEEALGSDAKYAGKHFRNP  454



>gb|ABF60010.1| enolase B [Polypterus senegalus]
Length=434

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 143/169 (85%), Gaps = 2/169 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + I+G++L DLYKSF+  YP+VSIEDPFDQDDWE + K T  +G  +QIVGDDL V
Sbjct  265  DDPARHITGEKLGDLYKSFIKNYPVVSIEDPFDQDDWENWTKFTASVG--IQIVGDDLTV  322

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+ +A+E K CN LLLKVNQIGSVTESI+A K+++ +GWGVM SHRSGETEDTFIA
Sbjct  323  TNPKRIQQAVEKKACNCLLLKVNQIGSVTESIQACKLAQSSGWGVMVSHRSGETEDTFIA  382

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            DL VGL TGQIKTGAPCRSERLAKYNQL+RIEEELG+ AV+AG +FR P
Sbjct  383  DLVVGLCTGQIKTGAPCRSERLAKYNQLMRIEEELGNKAVFAGKNFRNP  431



>gb|AAH21166.2| ENO1 protein, partial [Homo sapiens]
Length=264

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDW  + K T   G  +Q+VGDDL V
Sbjct  95   DDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG--IQVVGDDLTV  152

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  153  TNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIA  212

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  213  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  262



>ref|XP_002365578.1| enolase 2 [Toxoplasma gondii ME49]
 gb|EPR64867.1| enolase 2 [Toxoplasma gondii GT1]
 gb|EPT28275.1| enolase 2 [Toxoplasma gondii ME49]
 gb|ESS36338.1| enolase 2 [Toxoplasma gondii VEG]
 gb|KFG39200.1| enolase 2 [Toxoplasma gondii GAB2-2007-GAL-DOM2]
 gb|KFG52456.1| enolase 2 [Toxoplasma gondii p89]
 gb|KFG54556.1| enolase 2 [Toxoplasma gondii FOU]
 gb|KFG61437.1| enolase 2 [Toxoplasma gondii RUB]
 gb|KFH06202.1| enolase 2 [Toxoplasma gondii VAND]
 gb|KFH16828.1| enolase 2 [Toxoplasma gondii MAS]
Length=475

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = -3

Query  697  KEENNDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGD  518
            K  NND  Q+ +G++L++LYK    +YP VSIEDPFDQDD+ +YA+LT E+GEKVQIVGD
Sbjct  302  KTPNNDKSQRKTGEELRNLYKDLCQKYPFVSIEDPFDQDDFHSYAQLTNEVGEKVQIVGD  361

Query  517  DLLVTNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETED  338
            DLLVTNP R+ KA++ K CN LLLKVNQIG+V+ESIEA ++++K  WGVM SHRSGETED
Sbjct  362  DLLVTNPTRIEKAVQEKACNGLLLKVNQIGTVSESIEACQLAQKNKWGVMVSHRSGETED  421

Query  337  TFIADLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            +FIADL VGL TGQIKTGAPCRSERL KYNQL+RIEE LGSD  YAGA FR P
Sbjct  422  SFIADLVVGLRTGQIKTGAPCRSERLCKYNQLMRIEESLGSDCQYAGAGFRHP  474



>ref|XP_002716189.1| PREDICTED: alpha-enolase [Oryctolagus cuniculus]
Length=434

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + I+ DQL DLYKSFV +YP+VSIEDPFDQDDWE + K T   G  +Q+VGDDL V
Sbjct  265  DDASRYITPDQLADLYKSFVRDYPVVSIEDPFDQDDWEAWQKFTASAG--IQVVGDDLTV  322

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA++ K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  323  TNPKRIAKAVDQKSCNCLLLKVNQIGSVTESLQACKLAQSNGWGVMVSHRSGETEDTFIA  382

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  383  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  432



>ref|XP_004596129.1| PREDICTED: alpha-enolase isoform X1 [Ochotona princeps]
Length=434

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + I+ DQL DLYKSFV +YP+VSIEDPFDQDDWE + K T   G  +Q+VGDDL V
Sbjct  265  DDPSRYITPDQLADLYKSFVKDYPVVSIEDPFDQDDWEAWQKFTASAG--IQVVGDDLTV  322

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+E K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  323  TNPKRIAKAVEQKSCNCLLLKVNQIGSVTESLKACKLAQSNGWGVMVSHRSGETEDTFIA  382

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  383  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  432



>gb|AAH04325.1| ENO1 protein, partial [Homo sapiens]
Length=272

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDW  + K T   G  +Q+VGDDL V
Sbjct  103  DDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG--IQVVGDDLTV  160

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  161  TNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIA  220

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  221  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  270



>gb|AAC39935.1| alpha enolase like 1 [Homo sapiens]
Length=269

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 141/170 (83%), Gaps = 2/170 (1%)
 Frame = -3

Query  685  NDGXQKISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLV  506
            +D  + IS DQL DLYKSF+ +YP+VSIEDPFDQDDW  + K T   G  +Q+VGDDL V
Sbjct  100  DDPSRYISPDQLADLYKSFIKDYPVVSIEDPFDQDDWGAWQKFTASAG--IQVVGDDLTV  157

Query  505  TNPKRVAKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIA  326
            TNPKR+AKA+  K+CN LLLKVNQIGSVTES++A K+++  GWGVM SHRSGETEDTFIA
Sbjct  158  TNPKRIAKAVNEKSCNCLLLKVNQIGSVTESLQACKLAQANGWGVMVSHRSGETEDTFIA  217

Query  325  DLAVGLATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAPV  176
            DL VGL TGQIKTGAPCRSERLAKYNQLLRIEEELGS A +AG +FR P+
Sbjct  218  DLVVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL  267



>ref|XP_005112795.1| PREDICTED: enolase-like isoform X1 [Aplysia californica]
Length=433

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 2/163 (1%)
 Frame = -3

Query  667  ISGDQLKDLYKSFVSEYPIVSIEDPFDQDDWETYAKLTTEIGEKVQIVGDDLLVTNPKRV  488
            ++ DQL ++YKSFVS YP+++IEDPFDQDDW+ ++K+T+  G  +QIVGDDLLVTNPKRV
Sbjct  271  VTSDQLGEIYKSFVSNYPVITIEDPFDQDDWQAWSKMTSNAG--IQIVGDDLLVTNPKRV  328

Query  487  AKAIEGKTCNALLLKVNQIGSVTESIEAVKMSKKAGWGVMTSHRSGETEDTFIADLAVGL  308
             K I+ K CNALLLKVNQIG+VTE+I+A KMS +AGWGVM SHRSGETEDTFIADL VGL
Sbjct  329  QKGIDTKACNALLLKVNQIGTVTEAIDACKMSHEAGWGVMVSHRSGETEDTFIADLVVGL  388

Query  307  ATGQIKTGAPCRSERLAKYNQLLRIEEELGSDAVYAGASFRAP  179
            +TGQIKTGAPCRSERLAKYNQ+LRIEEELG+DA YAG +F+ P
Sbjct  389  STGQIKTGAPCRSERLAKYNQILRIEEELGADAKYAGKNFKNP  431



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1179751321320