BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031H22

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009760211.1|  PREDICTED: mitochondrial Rho GTPase 1-like         263   9e-80   Nicotiana sylvestris
ref|XP_009625701.1|  PREDICTED: mitochondrial Rho GTPase 1              258   1e-77   Nicotiana tomentosiformis
ref|XP_006361849.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    257   2e-77   Solanum tuberosum [potatoes]
ref|XP_004230188.1|  PREDICTED: mitochondrial Rho GTPase 1              257   3e-77   Solanum lycopersicum
ref|XP_011075507.1|  PREDICTED: mitochondrial Rho GTPase 1              254   2e-76   Sesamum indicum [beniseed]
gb|KCW85147.1|  hypothetical protein EUGRSUZ_B01990                     249   2e-74   Eucalyptus grandis [rose gum]
ref|XP_010043089.1|  PREDICTED: mitochondrial Rho GTPase 1              249   3e-74   Eucalyptus grandis [rose gum]
emb|CDP15520.1|  unnamed protein product                                247   1e-73   Coffea canephora [robusta coffee]
gb|KJB45952.1|  hypothetical protein B456_007G342600                    243   2e-73   Gossypium raimondii
gb|KHG06383.1|  mitochondrial rho gtpase 1                              246   2e-73   Gossypium arboreum [tree cotton]
ref|XP_008388576.1|  PREDICTED: mitochondrial Rho GTPase 1-like         232   7e-73   
gb|KJB45950.1|  hypothetical protein B456_007G342600                    243   4e-72   Gossypium raimondii
ref|XP_007030854.1|  Mitochondrial Rho GTPase isoform 1                 243   6e-72   
ref|XP_007030855.1|  Mitochondrial Rho GTPase isoform 2                 243   6e-72   
gb|KJB45955.1|  hypothetical protein B456_007G342600                    243   6e-72   Gossypium raimondii
gb|KJB45953.1|  hypothetical protein B456_007G342600                    243   6e-72   Gossypium raimondii
gb|KJB55164.1|  hypothetical protein B456_009G0664001                   223   3e-69   Gossypium raimondii
ref|XP_002512373.1|  rac-GTP binding protein, putative                  234   3e-69   
ref|XP_004302432.1|  PREDICTED: mitochondrial Rho GTPase 1-like         235   5e-69   Fragaria vesca subsp. vesca
ref|XP_006433312.1|  hypothetical protein CICLE_v10000541mg             231   1e-68   
ref|XP_008454749.1|  PREDICTED: mitochondrial Rho GTPase 1-like         234   1e-68   Cucumis melo [Oriental melon]
gb|EYU28762.1|  hypothetical protein MIMGU_mgv1a002695mg                234   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_004156425.1|  PREDICTED: mitochondrial Rho GTPase 1-like         234   1e-68   
gb|KGN60899.1|  hypothetical protein Csa_2G021700                       234   1e-68   Cucumis sativus [cucumbers]
ref|XP_006382604.1|  hypothetical protein POPTR_0005s03670g             234   2e-68   Populus trichocarpa [western balsam poplar]
ref|XP_010091557.1|  Mitochondrial Rho GTPase 1                         234   2e-68   Morus notabilis
ref|XP_010674761.1|  PREDICTED: mitochondrial Rho GTPase 1-like         233   3e-68   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008345681.1|  PREDICTED: mitochondrial Rho GTPase 1-like         226   4e-68   
ref|XP_008246476.1|  PREDICTED: mitochondrial Rho GTPase 1-like         233   5e-68   Prunus mume [ume]
ref|XP_007207133.1|  hypothetical protein PRUPE_ppa002661mg             233   5e-68   Prunus persica
gb|KJB26440.1|  hypothetical protein B456_004G241600                    231   7e-68   Gossypium raimondii
gb|KJB26437.1|  hypothetical protein B456_004G241600                    232   9e-68   Gossypium raimondii
gb|KDP23523.1|  hypothetical protein JCGZ_23356                         232   9e-68   Jatropha curcas
ref|XP_006433310.1|  hypothetical protein CICLE_v10000541mg             231   2e-67   
ref|XP_011016432.1|  PREDICTED: mitochondrial Rho GTPase 1-like         226   3e-67   Populus euphratica
ref|XP_004139182.1|  PREDICTED: mitochondrial Rho GTPase 1-like         229   6e-67   
ref|XP_010242349.1|  PREDICTED: mitochondrial Rho GTPase 1-like         229   6e-67   
gb|KJB33802.1|  hypothetical protein B456_006G031500                    214   5e-66   Gossypium raimondii
ref|XP_004495731.1|  PREDICTED: mitochondrial Rho GTPase 1-like         227   6e-66   Cicer arietinum [garbanzo]
gb|KJB33804.1|  hypothetical protein B456_006G031500                    215   9e-66   Gossypium raimondii
ref|XP_010244210.1|  PREDICTED: mitochondrial Rho GTPase 1-like         226   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_011023599.1|  PREDICTED: mitochondrial Rho GTPase 1-like         225   2e-65   Populus euphratica
ref|XP_002319545.2|  hypothetical protein POPTR_0013s02400g             225   5e-65   
gb|KJB29213.1|  hypothetical protein B456_005G089500                    213   5e-65   Gossypium raimondii
ref|XP_011036784.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    224   5e-65   Populus euphratica
ref|XP_006841409.1|  hypothetical protein AMTR_s00003p00020850          224   9e-65   Amborella trichopoda
ref|XP_011036782.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    224   1e-64   Populus euphratica
ref|XP_006361850.1|  PREDICTED: uncharacterized protein LOC102579917    209   1e-64   Solanum tuberosum [potatoes]
ref|XP_002284757.1|  PREDICTED: mitochondrial Rho GTPase 1              221   9e-64   Vitis vinifera
ref|XP_003556505.1|  PREDICTED: mitochondrial Rho GTPase 1-like         221   1e-63   Glycine max [soybeans]
gb|ADE77615.1|  unknown                                                 208   1e-63   Picea sitchensis
emb|CBI36765.3|  unnamed protein product                                221   2e-63   Vitis vinifera
gb|KHN20217.1|  Mitochondrial Rho GTPase 1                              219   3e-63   Glycine soja [wild soybean]
ref|XP_003536081.1|  PREDICTED: mitochondrial Rho GTPase 1-like         219   3e-63   Glycine max [soybeans]
ref|XP_010456750.1|  PREDICTED: mitochondrial Rho GTPase 1-like         218   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006287227.1|  hypothetical protein CARUB_v10000404mg             219   6e-63   
ref|XP_006287226.1|  hypothetical protein CARUB_v10000404mg             219   7e-63   
ref|XP_010278002.1|  PREDICTED: uncharacterized protein LOC104612310    210   2e-62   
ref|XP_009385504.1|  PREDICTED: mitochondrial Rho GTPase 1-like         218   2e-62   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010421600.1|  PREDICTED: mitochondrial Rho GTPase 1-like         217   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006394958.1|  hypothetical protein EUTSA_v10003793mg             217   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_007144734.1|  hypothetical protein PHAVU_007G180300g             217   3e-62   Phaseolus vulgaris [French bean]
emb|CDY25032.1|  BnaC02g39760D                                          216   9e-62   Brassica napus [oilseed rape]
emb|CDY05572.1|  BnaA02g31190D                                          216   9e-62   
emb|CDX80639.1|  BnaC07g28050D                                          216   9e-62   
ref|XP_009129866.1|  PREDICTED: mitochondrial Rho GTPase 1-like         216   9e-62   Brassica rapa
ref|XP_002874365.1|  EMB2473                                            215   2e-61   
ref|XP_009385505.1|  PREDICTED: mitochondrial Rho GTPase 1-like         214   3e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_198106.1|  MIRO-related GTP-ase 1                                214   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786917.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    214   4e-61   Phoenix dactylifera
ref|XP_008786915.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    214   4e-61   Phoenix dactylifera
ref|XP_010494001.1|  PREDICTED: mitochondrial Rho GTPase 1-like         213   1e-60   Camelina sativa [gold-of-pleasure]
emb|CDX86152.1|  BnaA06g28690D                                          211   5e-60   
ref|XP_010931977.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    210   8e-60   Elaeis guineensis
ref|XP_010931978.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    210   8e-60   
ref|XP_009151199.1|  PREDICTED: mitochondrial Rho GTPase 1-like         210   1e-59   
ref|XP_010546687.1|  PREDICTED: mitochondrial Rho GTPase 1-like         208   6e-59   Tarenaya hassleriana [spider flower]
ref|XP_008790947.1|  PREDICTED: mitochondrial Rho GTPase 1              207   2e-58   Phoenix dactylifera
ref|XP_010908349.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    207   2e-58   Elaeis guineensis
ref|XP_009111756.1|  PREDICTED: mitochondrial Rho GTPase 1-like         206   5e-58   Brassica rapa
ref|XP_006650773.1|  PREDICTED: mitochondrial Rho GTPase 2-like         202   1e-57   
emb|CDX99980.1|  BnaC09g03210D                                          205   1e-57   
emb|CDY69035.1|  BnaA09g52280D                                          204   2e-57   Brassica napus [oilseed rape]
ref|XP_004171182.1|  PREDICTED: mitochondrial Rho GTPase 1-like         192   2e-57   
ref|XP_010908350.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    204   3e-57   Elaeis guineensis
ref|XP_003563951.1|  PREDICTED: mitochondrial Rho GTPase 1-like         204   3e-57   Brachypodium distachyon [annual false brome]
gb|EMT05838.1|  Mitochondrial Rho GTPase 1                              203   3e-57   
ref|XP_003591106.1|  Mitochondrial Rho GTPase                           200   5e-56   Medicago truncatula
dbj|BAJ94408.1|  predicted protein                                      200   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010550971.1|  PREDICTED: mitochondrial Rho GTPase 1-like         198   3e-55   Tarenaya hassleriana [spider flower]
ref|NP_001051665.1|  Os03g0810600                                       197   7e-55   
ref|XP_008643395.1|  PREDICTED: uncharacterized protein LOC100278...    196   1e-54   Zea mays [maize]
ref|XP_008665658.1|  PREDICTED: mitochondrial Rho GTPase 1-like         196   1e-54   Zea mays [maize]
ref|NP_001144985.1|  uncharacterized protein LOC100278140               196   1e-54   Zea mays [maize]
gb|AFW67245.1|  hypothetical protein ZEAMMB73_549387                    196   2e-54   
ref|XP_011032721.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    196   2e-54   Populus euphratica
ref|XP_011032724.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    196   2e-54   Populus euphratica
ref|XP_004981322.1|  PREDICTED: mitochondrial Rho GTPase 1-like         196   2e-54   Setaria italica
ref|XP_002520752.1|  rac-GTP binding protein, putative                  196   2e-54   Ricinus communis
ref|XP_002306771.1|  GTP-binding family protein                         195   3e-54   
gb|KDO68749.1|  hypothetical protein CISIN_1g005908mg                   194   7e-54   Citrus sinensis [apfelsine]
gb|KDO68748.1|  hypothetical protein CISIN_1g005908mg                   191   1e-53   Citrus sinensis [apfelsine]
gb|KDP21466.1|  hypothetical protein JCGZ_21937                         192   3e-53   Jatropha curcas
ref|XP_002275434.1|  PREDICTED: mitochondrial Rho GTPase 1              192   5e-53   Vitis vinifera
ref|XP_002993625.1|  hypothetical protein SELMODRAFT_451618             192   6e-53   Selaginella moellendorffii
ref|XP_002973259.1|  MIRO family protein                                192   6e-53   Selaginella moellendorffii
gb|KGN44818.1|  hypothetical protein Csa_7G389500                       191   7e-53   Cucumis sativus [cucumbers]
ref|XP_006444081.1|  hypothetical protein CICLE_v10019250mg             191   8e-53   Citrus clementina [clementine]
ref|XP_004148893.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    191   8e-53   
ref|XP_008451367.1|  PREDICTED: mitochondrial Rho GTPase 1              190   2e-52   Cucumis melo [Oriental melon]
ref|XP_009111753.1|  PREDICTED: mitochondrial Rho GTPase 1-like         191   2e-52   
emb|CDY19722.1|  BnaA09g03750D                                          191   2e-52   Brassica napus [oilseed rape]
ref|XP_007162421.1|  hypothetical protein PHAVU_001G150700g             189   4e-52   Phaseolus vulgaris [French bean]
ref|XP_010524876.1|  PREDICTED: mitochondrial Rho GTPase 1-like         189   5e-52   Tarenaya hassleriana [spider flower]
gb|KEH32598.1|  Rho GTPase-like protein                                 189   7e-52   Medicago truncatula
ref|XP_011032722.1|  PREDICTED: mitochondrial Rho GTPase 1 isofor...    189   8e-52   Populus euphratica
ref|XP_006644996.1|  PREDICTED: mitochondrial Rho GTPase 1-like         184   2e-50   
ref|NP_001044775.1|  Os01g0843300                                       184   3e-50   
dbj|BAD81741.1|  putative mitochondrial Rho 1                           184   3e-50   Oryza sativa Japonica Group [Japonica rice]
gb|KJB23092.1|  hypothetical protein B456_004G080500                    184   3e-50   Gossypium raimondii
ref|XP_007050628.1|  Mitochondrial Rho GTPase                           184   3e-50   
ref|XP_008235402.1|  PREDICTED: mitochondrial Rho GTPase 1              184   4e-50   Prunus mume [ume]
gb|KJB23094.1|  hypothetical protein B456_004G080500                    184   4e-50   Gossypium raimondii
gb|EEC71783.1|  hypothetical protein OsI_04400                          184   4e-50   Oryza sativa Indica Group [Indian rice]
gb|EEE55655.1|  hypothetical protein OsJ_04046                          184   4e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003520566.1|  PREDICTED: mitochondrial Rho GTPase 1-like         184   5e-50   Glycine max [soybeans]
ref|XP_004493664.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    184   6e-50   Cicer arietinum [garbanzo]
ref|XP_004493665.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    183   6e-50   Cicer arietinum [garbanzo]
ref|XP_010090397.1|  Mitochondrial Rho GTPase 1                         182   8e-50   
gb|KEH23750.1|  Rho GTPase                                              183   9e-50   Medicago truncatula
gb|KEH23751.1|  Rho GTPase                                              183   1e-49   Medicago truncatula
ref|XP_007199739.1|  hypothetical protein PRUPE_ppa002696mg             182   1e-49   Prunus persica
ref|XP_006604431.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    182   1e-49   Glycine max [soybeans]
ref|XP_003554248.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    182   2e-49   Glycine max [soybeans]
gb|KHN45356.1|  Mitochondrial Rho GTPase 1                              182   2e-49   Glycine soja [wild soybean]
gb|KJB23090.1|  hypothetical protein B456_004G080500                    181   4e-49   Gossypium raimondii
gb|KJB23091.1|  hypothetical protein B456_004G080500                    181   5e-49   Gossypium raimondii
ref|XP_009631945.1|  PREDICTED: mitochondrial Rho GTPase 1-like         180   7e-49   Nicotiana tomentosiformis
ref|XP_006349667.1|  PREDICTED: mitochondrial Rho GTPase 1-like         180   1e-48   Solanum tuberosum [potatoes]
ref|XP_004247162.1|  PREDICTED: mitochondrial Rho GTPase 1              179   1e-48   Solanum lycopersicum
gb|AES96221.2|  Rho GTPase                                              173   2e-48   Medicago truncatula
ref|XP_009787210.1|  PREDICTED: mitochondrial Rho GTPase 1-like         179   3e-48   Nicotiana sylvestris
ref|XP_010513798.1|  PREDICTED: mitochondrial Rho GTPase 1-like         171   3e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011079844.1|  PREDICTED: LOW QUALITY PROTEIN: mitochondria...    179   3e-48   Sesamum indicum [beniseed]
ref|XP_003613256.1|  Mitochondrial Rho GTPase                           177   7e-48   Medicago truncatula
gb|EAZ29014.1|  hypothetical protein OsJ_13062                          176   2e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004290658.1|  PREDICTED: mitochondrial Rho GTPase 2              176   3e-47   Fragaria vesca subsp. vesca
gb|KFK35451.1|  hypothetical protein AALP_AA5G286100                    176   3e-47   Arabis alpina [alpine rockcress]
gb|KFK35452.1|  hypothetical protein AALP_AA5G286100                    176   3e-47   Arabis alpina [alpine rockcress]
ref|XP_003613263.1|  Mitochondrial Rho GTPase                           173   4e-47   
ref|XP_003613772.1|  Mitochondrial Rho GTPase                           175   9e-47   
gb|AES96730.2|  Rho GTPase-like protein                                 174   1e-46   Medicago truncatula
ref|XP_001775852.1|  predicted protein                                  173   3e-46   
ref|XP_007144632.1|  hypothetical protein PHAVU_007G171800g             172   8e-46   Phaseolus vulgaris [French bean]
ref|XP_010552819.1|  PREDICTED: mitochondrial Rho GTPase 1-like         166   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_008368856.1|  PREDICTED: mitochondrial Rho GTPase 1              171   1e-45   
ref|XP_002878499.1|  hypothetical protein ARALYDRAFT_486817             170   3e-45   Arabidopsis lyrata subsp. lyrata
ref|XP_010512723.1|  PREDICTED: mitochondrial Rho GTPase 1-like         170   4e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009367694.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    170   4e-45   
ref|XP_009367695.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    169   5e-45   Pyrus x bretschneideri [bai li]
ref|XP_003536499.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    169   6e-45   Glycine max [soybeans]
ref|XP_009355477.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    169   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_009355476.1|  PREDICTED: mitochondrial Rho GTPase 1-like i...    169   7e-45   Pyrus x bretschneideri [bai li]
ref|XP_008386506.1|  PREDICTED: mitochondrial Rho GTPase 1-like         169   7e-45   Malus domestica [apple tree]
gb|KHN03795.1|  Mitochondrial Rho GTPase 1                              169   8e-45   Glycine soja [wild soybean]
gb|AAL25592.1|  AT3g63150/T20O10_250                                    168   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567139.1|  MIRO-related GTP-ase 2                                168   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413192.1|  PREDICTED: mitochondrial Rho GTPase 1-like         167   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010552773.1|  PREDICTED: mitochondrial Rho GTPase 1              166   1e-43   Tarenaya hassleriana [spider flower]
ref|XP_010468881.1|  PREDICTED: mitochondrial Rho GTPase 1-like         166   1e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006402304.1|  hypothetical protein EUTSA_v10005831mg             166   1e-43   Eutrema salsugineum [saltwater cress]
dbj|BAJ85941.1|  predicted protein                                      164   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002882407.1|  hypothetical protein ARALYDRAFT_477819             165   3e-43   Arabidopsis lyrata subsp. lyrata
ref|NP_187182.1|  MIRO-related GTP-ase 3                                164   5e-43   Arabidopsis thaliana [mouse-ear cress]
gb|EMS67255.1|  Mitochondrial Rho GTPase 1                              164   6e-43   Triticum urartu
gb|AES96178.2|  Rho GTPase                                              162   2e-42   Medicago truncatula
ref|XP_003571671.1|  PREDICTED: mitochondrial Rho GTPase 1-like         161   4e-42   Brachypodium distachyon [annual false brome]
gb|EYU46588.1|  hypothetical protein MIMGU_mgv1a002738mg                161   6e-42   Erythranthe guttata [common monkey flower]
gb|KEH32396.1|  Rho GTPase, putative                                    152   6e-42   Medicago truncatula
ref|XP_003613220.1|  Mitochondrial Rho GTPase                           158   4e-41   
ref|XP_006298991.1|  hypothetical protein CARUB_v10015117mg             159   4e-41   
ref|XP_009138638.1|  PREDICTED: mitochondrial Rho GTPase 1              158   8e-41   Brassica rapa
emb|CDX89176.1|  BnaA04g00100D                                          157   8e-41   
emb|CDX93929.1|  BnaC04g20880D                                          157   8e-41   
ref|XP_001779282.1|  predicted protein                                  155   6e-40   
ref|XP_001778992.1|  predicted protein                                  154   9e-40   
ref|XP_010425682.1|  PREDICTED: mitochondrial Rho GTPase 1              154   1e-39   Camelina sativa [gold-of-pleasure]
emb|CAB87760.1|  rac-GTP binding protein-like                           154   1e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464053.1|  PREDICTED: mitochondrial Rho GTPase 1-like         154   2e-39   
ref|XP_003590652.1|  Mitochondrial Rho GTPase                           154   2e-39   Medicago truncatula
ref|XP_006408091.1|  hypothetical protein EUTSA_v10020270mg             153   3e-39   Eutrema salsugineum [saltwater cress]
ref|XP_003610221.1|  Mitochondrial Rho GTPase                           152   5e-39   
ref|XP_004495205.1|  PREDICTED: mitochondrial Rho GTPase 1-like         151   1e-38   Cicer arietinum [garbanzo]
ref|XP_006841411.1|  hypothetical protein AMTR_s00003p00022810          143   1e-38   
emb|CDY40707.1|  BnaC03g34230D                                          150   5e-38   Brassica napus [oilseed rape]
emb|CDX74148.1|  BnaA03g28990D                                          145   1e-37   
ref|XP_009134822.1|  PREDICTED: mitochondrial Rho GTPase 2              149   1e-37   Brassica rapa
ref|XP_001767645.1|  predicted protein                                  148   2e-37   
ref|XP_010485971.1|  PREDICTED: mitochondrial Rho GTPase 1-like         145   2e-36   
emb|CDY66986.1|  BnaAnng23350D                                          145   2e-36   Brassica napus [oilseed rape]
gb|EPS67784.1|  hypothetical protein M569_06990                         140   2e-36   Genlisea aurea
gb|KFK37959.1|  hypothetical protein AALP_AA3G052000                    138   7e-35   Arabis alpina [alpine rockcress]
ref|XP_009124073.1|  PREDICTED: mitochondrial Rho GTPase 2-like         140   9e-35   Brassica rapa
ref|XP_008350070.1|  PREDICTED: uncharacterized protein LOC103413383    129   3e-33   
gb|KDO56331.1|  hypothetical protein CISIN_1g008223mg                   127   1e-30   Citrus sinensis [apfelsine]
gb|AES92418.2|  Rho GTPase                                              129   1e-30   Medicago truncatula
ref|XP_010094555.1|  Mitochondrial Rho GTPase 2                         129   2e-30   
gb|KDO56330.1|  hypothetical protein CISIN_1g008223mg                   127   2e-30   Citrus sinensis [apfelsine]
gb|KDO56328.1|  hypothetical protein CISIN_1g008223mg                   127   3e-30   Citrus sinensis [apfelsine]
gb|KJB26438.1|  hypothetical protein B456_004G241600                    125   3e-29   Gossypium raimondii
gb|KJB41366.1|  hypothetical protein B456_007G101100                    104   1e-24   Gossypium raimondii
gb|KEH23752.1|  Rho GTPase                                              101   5e-21   Medicago truncatula
gb|KEH23753.1|  Rho GTPase                                              101   6e-21   Medicago truncatula
gb|KGN57777.1|  hypothetical protein Csa_3G298060                     91.3    1e-19   Cucumis sativus [cucumbers]
ref|XP_004145864.1|  PREDICTED: peroxisomal acyl-coenzyme A oxida...  91.3    3e-19   
ref|XP_004513893.1|  PREDICTED: uncharacterized protein LOC101499...  84.7    6e-17   
gb|AFK36587.1|  unknown                                               76.6    1e-13   Lotus japonicus
ref|XP_010098381.1|  Mitochondrial Rho GTPase 1                       62.4    5e-08   
ref|XP_005847786.1|  hypothetical protein CHLNCDRAFT_133936           62.4    8e-08   Chlorella variabilis
emb|CBI23980.3|  unnamed protein product                              55.1    6e-06   Vitis vinifera
ref|XP_001876187.1|  predicted protein                                54.3    4e-05   Laccaria bicolor S238N-H82
gb|KIK06177.1|  hypothetical protein K443DRAFT_286142                 54.3    4e-05   Laccaria amethystina LaAM-08-1
ref|XP_010094580.1|  hypothetical protein L484_024876                 50.4    4e-05   
gb|EJT98761.1|  mitochondrial Rho 1                                   52.8    1e-04   Dacryopinax primogenitus
gb|KJB23093.1|  hypothetical protein B456_004G080500                  52.8    1e-04   Gossypium raimondii
gb|KIM43100.1|  hypothetical protein M413DRAFT_443915                 52.0    2e-04   Hebeloma cylindrosporum h7
ref|XP_008364027.1|  PREDICTED: mitochondrial Rho GTPase 1-like       52.0    2e-04   
ref|XP_007346086.1|  mitochondrial Rho GTPase                         52.0    2e-04   
dbj|GAN04132.1|  mitochondrial Rho 1                                  51.2    5e-04   Mucor ambiguus
gb|KDQ25557.1|  hypothetical protein PLEOSDRAFT_1057842               50.8    5e-04   Pleurotus ostreatus PC15
gb|KJA23989.1|  hypothetical protein HYPSUDRAFT_162448                50.8    5e-04   Hypholoma sublateritium FD-334 SS-4
gb|AFR95905.1|  mitochondrial Rho GTPase 1                            50.8    6e-04   Cryptococcus neoformans var. grubii H99
gb|KDO68750.1|  hypothetical protein CISIN_1g005908mg                 50.1    0.001   Citrus sinensis [apfelsine]



>ref|XP_009760211.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana sylvestris]
Length=645

 Score =   263 bits (673),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLSSKDALA CD+AIFVHDSSRE SWKRA++LLVDVAS+GEATGYE+P L
Sbjct  480  REIPEDGVKKLLSSKDALADCDIAIFVHDSSRETSWKRAADLLVDVASHGEATGYEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPYLTEIQDSTRVSQD+GIEAPIPISTKLGD SNLF+RIVNAAE PHLSIPE
Sbjct  540  IVAAKDDLDPYLTEIQDSTRVSQDLGIEAPIPISTKLGDFSNLFRRIVNAAEHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG+SRKQYHRL+NRSLMF
Sbjct  600  TEAGRSRKQYHRLINRSLMF  619



>ref|XP_009625701.1| PREDICTED: mitochondrial Rho GTPase 1 [Nicotiana tomentosiformis]
 ref|XP_009625702.1| PREDICTED: mitochondrial Rho GTPase 1 [Nicotiana tomentosiformis]
Length=645

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/140 (88%), Positives = 134/140 (96%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLSSKDALA CD+A+FVHDSS EASWKRA++LLVDVAS+GEATG+E+P L
Sbjct  480  REIPEDGVKKLLSSKDALADCDIALFVHDSSCEASWKRAADLLVDVASHGEATGHEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPYLTEIQDSTRVSQD+GIEAPIPISTKLGD SNLF+RIVNAAE PHLSIPE
Sbjct  540  IVAAKDDLDPYLTEIQDSTRVSQDLGIEAPIPISTKLGDFSNLFRRIVNAAEHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG+SRKQYHRL+NRSLMF
Sbjct  600  TEAGRSRKQYHRLINRSLMF  619



>ref|XP_006361849.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Solanum 
tuberosum]
Length=645

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKKLLSSKDALA CD+AIFVHDSS EASWKRA++LLVDVAS+GEATGYE+P L
Sbjct  480  REIPEDEVKKLLSSKDALADCDIAIFVHDSSHEASWKRAADLLVDVASHGEATGYEMPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+PYLTEIQDSTRVSQD+GIEAPIPISTKLGD SNLF+RIVNAAE PHLSIPE
Sbjct  540  IVAAKDDLEPYLTEIQDSTRVSQDLGIEAPIPISTKLGDFSNLFRRIVNAAEHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG+SRKQYHRLVNRSLMF
Sbjct  600  TEAGRSRKQYHRLVNRSLMF  619



>ref|XP_004230188.1| PREDICTED: mitochondrial Rho GTPase 1 [Solanum lycopersicum]
Length=645

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 124/140 (89%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKKLLSSKDALA CD+AIFVHDSS EASWKRA++LLVDVAS+GEATGYE+P L
Sbjct  480  REIPEDEVKKLLSSKDALADCDIAIFVHDSSCEASWKRAADLLVDVASHGEATGYEMPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+PYLTEIQDSTRVSQD+GIEAPIPISTKLGD SNLF+RIVNAAE PHLSIPE
Sbjct  540  IVAAKDDLEPYLTEIQDSTRVSQDLGIEAPIPISTKLGDFSNLFRRIVNAAEHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG+SRKQYHRLVNRSLMF
Sbjct  600  TEAGRSRKQYHRLVNRSLMF  619



>ref|XP_011075507.1| PREDICTED: mitochondrial Rho GTPase 1 [Sesamum indicum]
 ref|XP_011075508.1| PREDICTED: mitochondrial Rho GTPase 1 [Sesamum indicum]
Length=645

 Score =   254 bits (650),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVK+LLS KDALAACDVA+FVHDSSRE SW++A+E+LVDVAS GEATGYE+P L
Sbjct  480  REIPEEGVKELLSKKDALAACDVAVFVHDSSREPSWEKATEMLVDVASQGEATGYEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDP+LTEIQDSTRVSQDMGIEAPIP+STKLGD SN+FQRIV AAE PHLSIPE
Sbjct  540  IVAAKDDLDPFLTEIQDSTRVSQDMGIEAPIPLSTKLGDFSNIFQRIVRAAEHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T AGKSRKQYHRL+NRSL+FVS
Sbjct  600  TSAGKSRKQYHRLINRSLVFVS  621



>gb|KCW85147.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
Length=642

 Score =   249 bits (636),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK+L +K+ALAACD+A+FVHDSS E+SWKRA+ELLV+VAS+GE TG+E+P L
Sbjct  482  REIPEDGVKKMLVNKEALAACDIAVFVHDSSDESSWKRATELLVEVASHGEITGFEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDP+   IQDSTRVSQDMGIEAPIPISTKLGD SN+F+RIVNAAE PHLSIPE
Sbjct  542  IVAAKDDLDPFPMAIQDSTRVSQDMGIEAPIPISTKLGDFSNIFRRIVNAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRLVNRSLMFVS
Sbjct  602  TEAGRSRKQYHRLVNRSLMFVS  623



>ref|XP_010043089.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 ref|XP_010043090.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 ref|XP_010043091.1| PREDICTED: mitochondrial Rho GTPase 1 [Eucalyptus grandis]
 gb|KCW85148.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
 gb|KCW85149.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
 gb|KCW85150.1| hypothetical protein EUGRSUZ_B01990 [Eucalyptus grandis]
Length=647

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK+L +K+ALAACD+A+FVHDSS E+SWKRA+ELLV+VAS+GE TG+E+P L
Sbjct  482  REIPEDGVKKMLVNKEALAACDIAVFVHDSSDESSWKRATELLVEVASHGEITGFEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDP+   IQDSTRVSQDMGIEAPIPISTKLGD SN+F+RIVNAAE PHLSIPE
Sbjct  542  IVAAKDDLDPFPMAIQDSTRVSQDMGIEAPIPISTKLGDFSNIFRRIVNAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRLVNRSLMFVS
Sbjct  602  TEAGRSRKQYHRLVNRSLMFVS  623



>emb|CDP15520.1| unnamed protein product [Coffea canephora]
Length=650

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV  LLSSKDALAACDVA+FVHDS+RE+SWKRA+ELL+DVAS+GEATGYE+P L
Sbjct  485  REIPEDGVHNLLSSKDALAACDVAVFVHDSTRESSWKRATELLLDVASHGEATGYEVPCL  544

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ ++TEIQ+STRVSQD+GIEAPIPISTKLGDLSN+F RIVNAAE PHLSIPE
Sbjct  545  IVAAKDDLESFVTEIQNSTRVSQDLGIEAPIPISTKLGDLSNIFLRIVNAAEHPHLSIPE  604

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAGKSRK YHRL++RSLMF
Sbjct  605  TEAGKSRKHYHRLISRSLMF  624



>gb|KJB45952.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=505

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV KLLSSKD+LA CD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P LI
Sbjct  341  EIPEDGVAKLLSSKDSLAVCDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCLI  400

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD + T IQDSTRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPET
Sbjct  401  VAAKDDLDSFPTAIQDSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPET  460

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG+SRKQYHRL+NRSLMFVS
Sbjct  461  EAGRSRKQYHRLINRSLMFVS  481



>gb|KHG06383.1| mitochondrial rho gtpase 1 [Gossypium arboreum]
Length=644

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSKD+LA CD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  479  REIPEDGVAKLLSSKDSLAVCDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDP+ T IQDSTRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDPFPTAIQDSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  599  TEAGRSRKQYHRLINRSLMFVS  620



>ref|XP_008388576.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=190

 Score =   232 bits (592),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV+K L +K+ALAACD+A+FVHDSS E+SW+RA+ELL++VAS+GE TG+E+P LI
Sbjct  3    EIPEDGVEKFLRNKEALAACDIAVFVHDSSDESSWRRATELLIEVASHGETTGFEVPCLI  62

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD + + IQ STRVSQDMG EAPIPISTKLGD +N+F++IV AAE PHLSIPET
Sbjct  63   VAAKDDLDAFPSAIQHSTRVSQDMGTEAPIPISTKLGDFNNVFRKIVTAAEHPHLSIPET  122

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAGK+RKQYH+++NRSLMF+S
Sbjct  123  EAGKTRKQYHKILNRSLMFIS  143



>gb|KJB45950.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
 gb|KJB45951.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
 gb|KJB45954.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=644

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSKD+LA CD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  479  REIPEDGVAKLLSSKDSLAVCDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD + T IQDSTRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDSFPTAIQDSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  599  TEAGRSRKQYHRLINRSLMFVS  620



>ref|XP_007030854.1| Mitochondrial Rho GTPase isoform 1 [Theobroma cacao]
 gb|EOY11356.1| Mitochondrial Rho GTPase isoform 1 [Theobroma cacao]
Length=644

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  479  REIPEDGVRKLLSTKDSLAACDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGI+APIPIS+KLGD +N+F++IVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDSFPMAIQDSTRVSQDMGIDAPIPISSKLGDFNNIFRKIVNAAEYPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  599  TEAGRSRKQYHRLINRSLMFVS  620



>ref|XP_007030855.1| Mitochondrial Rho GTPase isoform 2, partial [Theobroma cacao]
 gb|EOY11357.1| Mitochondrial Rho GTPase isoform 2, partial [Theobroma cacao]
Length=642

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  477  REIPEDGVRKLLSTKDSLAACDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGI+APIPIS+KLGD +N+F++IVNAAE PHLSIPE
Sbjct  537  IVAAKDDLDSFPMAIQDSTRVSQDMGIDAPIPISSKLGDFNNIFRKIVNAAEYPHLSIPE  596

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  597  TEAGRSRKQYHRLINRSLMFVS  618



>gb|KJB45955.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=654

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSKD+LA CD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  479  REIPEDGVAKLLSSKDSLAVCDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD + T IQDSTRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDSFPTAIQDSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  599  TEAGRSRKQYHRLINRSLMFVS  620



>gb|KJB45953.1| hypothetical protein B456_007G342600 [Gossypium raimondii]
Length=652

 Score =   243 bits (620),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSKD+LA CD+A+FVHDSS E+SWKRA+ELLVDVA +GE TGYE+P L
Sbjct  479  REIPEDGVAKLLSSKDSLAVCDIAVFVHDSSDESSWKRATELLVDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD + T IQDSTRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDSFPTAIQDSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  599  TEAGRSRKQYHRLINRSLMFVS  620



>gb|KJB55164.1| hypothetical protein B456_009G0664001, partial [Gossypium raimondii]
Length=180

 Score =   223 bits (567),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI EDGV KLLSSK++LA CD+A+FV+DSS E+SWKRA+ELL+DVA  GE TGYE+P  I
Sbjct  40   EIHEDGVSKLLSSKESLAPCDIAVFVYDSSDESSWKRATELLMDVAGDGEDTGYEVPCFI  99

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPET
Sbjct  100  VAAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPET  159

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG+SRKQYHRL+NRSL+ VS
Sbjct  160  EAGRSRKQYHRLINRSLIVVS  180



>ref|XP_002512373.1| rac-GTP binding protein, putative [Ricinus communis]
 gb|EEF49825.1| rac-GTP binding protein, putative [Ricinus communis]
Length=583

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVKKLLS+K++LA+CD+AIFVHDSS E+SW+RA+ELLV+VAS+GE TG+E+P L
Sbjct  418  REIPENGVKKLLSNKESLASCDIAIFVHDSSDESSWRRATELLVEVASHGEDTGFEVPCL  477

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I+AAKDDL+ +   IQ+STRV+QDMGIEAPIPIS+K+GD +N+F+RIVNAAE PHLSIPE
Sbjct  478  IIAAKDDLNSFPMAIQESTRVTQDMGIEAPIPISSKMGDTNNVFRRIVNAAEHPHLSIPE  537

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  538  TEAGRSRKQYHRLINRSLMFVS  559



>ref|XP_004302432.1| PREDICTED: mitochondrial Rho GTPase 1-like [Fragaria vesca subsp. 
vesca]
Length=649

 Score =   235 bits (600),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            E+PEDGV KLLSSKDALAACD+A+FVHDSS E SWKRA+ELLV+VAS+GE TG+E+P LI
Sbjct  485  EVPEDGVSKLLSSKDALAACDIAVFVHDSSDELSWKRATELLVEVASHGENTGFEVPCLI  544

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ STRVSQDMG EAPIPISTKLGD +++F++IV+AAE PHLSIPET
Sbjct  545  VAAKDDLDSFPLAIQHSTRVSQDMGTEAPIPISTKLGDFNSVFRKIVSAAEHPHLSIPET  604

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG+SRKQYHRL+NRSLMFVS
Sbjct  605  EAGRSRKQYHRLINRSLMFVS  625



>ref|XP_006433312.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 gb|ESR46552.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
Length=506

 Score =   231 bits (589),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLV+VASYGE TG+E+P L
Sbjct  340  REIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCL  399

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGIEAPIP+S+KLGD + +F+RIV AAE PHLSIPE
Sbjct  400  IVAAKDDLDSFAMAIQDSTRVSQDMGIEAPIPVSSKLGDFNIIFRRIVQAAEHPHLSIPE  459

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RKQYHRL+NRSLM VS
Sbjct  460  TEAGRTRKQYHRLINRSLMIVS  481



>ref|XP_008454749.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis melo]
 gb|ABR67417.1| ATP/GTP/Ca++ binding protein [Cucumis melo subsp. melo]
Length=647

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLSSK++LAACD+A+FVHDSS E+SWK+A++LLV+VAS+GE TGYE+P L
Sbjct  482  REIPEDGVKKLLSSKESLAACDIALFVHDSSDESSWKKATDLLVEVASHGEDTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGIE PIPISTKLGD +N+F+RI +AAE PHLSIPE
Sbjct  542  IVAAKDDLDSFPLAIQDSTRVSQDMGIEPPIPISTKLGDFNNVFRRITSAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRK YH+L+NRSLMFVS
Sbjct  602  TEAGRSRKHYHKLINRSLMFVS  623



>gb|EYU28762.1| hypothetical protein MIMGU_mgv1a002695mg [Erythranthe guttata]
 gb|EYU28763.1| hypothetical protein MIMGU_mgv1a002695mg [Erythranthe guttata]
Length=646

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVK+ LS KDALAACDVA+FVHDSS E SW++A+E+LVDVAS GEATG E+P L
Sbjct  481  REIPEEGVKEFLSRKDALAACDVAVFVHDSSLEPSWQKATEMLVDVASQGEATGNEVPCL  540

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDP+LTEIQDSTRVSQDMGIEAPIP+STKLGD SN+F R+V AAE PHLSIPE
Sbjct  541  IVAAKDDLDPFLTEIQDSTRVSQDMGIEAPIPLSTKLGDFSNIFHRVVKAAEHPHLSIPE  600

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T AG++RKQYHRL+  SL+ VS
Sbjct  601  TSAGRTRKQYHRLIKNSLVVVS  622



>ref|XP_004156425.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus]
Length=648

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLSSK++LAACD+A+FVHDSS E+SWK+A++LLV+VAS+GE TGYE+P L
Sbjct  483  REIPEDGVKKLLSSKESLAACDIALFVHDSSDESSWKKATDLLVEVASHGEDTGYEVPCL  542

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGIE PIPISTKLGD +N+F+RI +AAE PHLSIPE
Sbjct  543  IVAAKDDLDSFPLAIQDSTRVSQDMGIEPPIPISTKLGDFNNVFRRITSAAEHPHLSIPE  602

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRK YH+L+NRSLMFVS
Sbjct  603  TEAGRSRKHYHKLINRSLMFVS  624



>gb|KGN60899.1| hypothetical protein Csa_2G021700 [Cucumis sativus]
Length=647

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLSSK++LAACD+A+FVHDSS E+SWK+A++LLV+VAS+GE TGYE+P L
Sbjct  482  REIPEDGVKKLLSSKESLAACDIALFVHDSSDESSWKKATDLLVEVASHGEDTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGIE PIPISTKLGD +N+F+RI +AAE PHLSIPE
Sbjct  542  IVAAKDDLDSFPLAIQDSTRVSQDMGIEPPIPISTKLGDFNNVFRRITSAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRK YH+L+NRSLMFVS
Sbjct  602  TEAGRSRKHYHKLINRSLMFVS  623



>ref|XP_006382604.1| hypothetical protein POPTR_0005s03670g [Populus trichocarpa]
 gb|ERP60401.1| hypothetical protein POPTR_0005s03670g [Populus trichocarpa]
Length=651

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DGVKKLLS+K++LA+CD+A+FV+DSS ++SWKRA+ELLVDVAS+GE TGYE+P L
Sbjct  486  REIPDDGVKKLLSNKESLASCDIAVFVYDSSDQSSWKRATELLVDVASHGEDTGYEVPCL  545

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAERPHLSIPE
Sbjct  546  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAERPHLSIPE  605

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY+RLVNRSLMFVS
Sbjct  606  TEAGRSRKQYNRLVNRSLMFVS  627



>ref|XP_010091557.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXC36980.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=647

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGVKKLLS+K++LAACDVA+FVHDSS E+SWKRA+ELLV+VAS+GE TG+E+P LI
Sbjct  483  EIPEDGVKKLLSNKESLAACDVAVFVHDSSDESSWKRATELLVEVASHGEDTGFEVPCLI  542

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ STRVSQDMG+EAP+ ISTKLGD +N+F++I++AAE PHLSIPET
Sbjct  543  VAAKDDLDSFPLAIQHSTRVSQDMGVEAPVSISTKLGDFNNVFRKIISAAEHPHLSIPET  602

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG+SRKQYHRL+NRSLMFVS
Sbjct  603  EAGRSRKQYHRLINRSLMFVS  623



>ref|XP_010674761.1| PREDICTED: mitochondrial Rho GTPase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK+LS+KD+LAACD+AIFV+DSS E SWK+ +ELLV+VA +GE TG+E+PSL
Sbjct  477  REIPEDKVKKVLSAKDSLAACDIAIFVYDSSDELSWKKTAELLVEVAGHGEDTGFEVPSL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPY   IQDSTRVSQDMG EAP+PIS KLGD +N+F+RIV++AERPHLSIPE
Sbjct  537  IVAAKDDLDPYPMAIQDSTRVSQDMGTEAPVPISAKLGDFNNIFRRIVSSAERPHLSIPE  596

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+SRKQYHRLVNRSLMF S
Sbjct  597  TEVGRSRKQYHRLVNRSLMFAS  618



>ref|XP_008345681.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=395

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV+K L +K+ALAACD+A+FVHDSS E+SWKRA+ELLV+VAS+GE TG+E+P LI
Sbjct  231  EIPEDGVEKFLRNKEALAACDIAVFVHDSSDESSWKRATELLVEVASHGETTGFEVPCLI  290

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD + + IQ STRVSQDMG EAPIPIS K GD +N+F++IV AAE PHLSIPET
Sbjct  291  VAAKDDLDAFPSAIQHSTRVSQDMGTEAPIPISAKXGDFNNVFRKIVTAAEHPHLSIPET  350

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG++RKQYH+++NRSLMF+S
Sbjct  351  EAGRTRKQYHKILNRSLMFIS  371



>ref|XP_008246476.1| PREDICTED: mitochondrial Rho GTPase 1-like [Prunus mume]
Length=647

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSK+ALAACD+A+FVHDSS E SW RA++LLV+VAS+GE TG+E+P L
Sbjct  482  REIPEDGVSKLLSSKEALAACDIAVFVHDSSDELSWTRATQLLVEVASHGEDTGFEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDD+D + + IQ STRVSQDMG EAPIPISTKLGDL+NLF++IV+AAE PHLSIPE
Sbjct  542  IVAAKDDMDSFPSAIQHSTRVSQDMGTEAPIPISTKLGDLNNLFRKIVSAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLM VS
Sbjct  602  TEAGRSRKQYHRLINRSLMVVS  623



>ref|XP_007207133.1| hypothetical protein PRUPE_ppa002661mg [Prunus persica]
 gb|EMJ08332.1| hypothetical protein PRUPE_ppa002661mg [Prunus persica]
Length=647

 Score =   233 bits (593),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSK+ALAACD+A+FVHDSS E SW RA++LLV+VAS+GE TG+E+P L
Sbjct  482  REIPEDGVSKLLSSKEALAACDIAVFVHDSSDELSWTRATQLLVEVASHGEDTGFEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDD+D + + IQ STRVSQDMG EAPIPISTKLGDL+NLF++IV+AAE PHLSIPE
Sbjct  542  IVAAKDDMDSFPSAIQHSTRVSQDMGTEAPIPISTKLGDLNNLFRKIVSAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLM VS
Sbjct  602  TEAGRSRKQYHRLINRSLMVVS  623



>gb|KJB26440.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=619

 Score =   231 bits (590),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSK++LA CD+A+FV+DSS E+SWKRA+ELL+DVA +GE TGYE+P L
Sbjct  454  REIPEDGVSKLLSSKESLAPCDIAVFVYDSSDESSWKRATELLMDVAGHGEDTGYEVPCL  513

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  514  IVAAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  573

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLM VS
Sbjct  574  TEAGRSRKQYHRLINRSLMVVS  595



>gb|KJB26437.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=644

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSK++LA CD+A+FV+DSS E+SWKRA+ELL+DVA +GE TGYE+P L
Sbjct  479  REIPEDGVSKLLSSKESLAPCDIAVFVYDSSDESSWKRATELLMDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+F+RIVNAAE PHLSIPE
Sbjct  539  IVAAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIFRRIVNAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLM VS
Sbjct  599  TEAGRSRKQYHRLINRSLMVVS  620



>gb|KDP23523.1| hypothetical protein JCGZ_23356 [Jatropha curcas]
Length=652

 Score =   232 bits (591),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLS K++LA CD+A+FVHDSS E+SW+RA+ELLV+VAS+GE TG+E+P L
Sbjct  487  REIPEDGVKKLLSDKESLAPCDIAVFVHDSSDESSWRRATELLVEVASHGEDTGFEVPCL  546

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRV+QDMGIEAPIPIS+K+GD +++F+RIVNAAE PHLSIPE
Sbjct  547  IVAAKDDLNSFPMAIQESTRVTQDMGIEAPIPISSKMGDTNSIFRRIVNAAEHPHLSIPE  606

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQYHRL+NRSLMFVS
Sbjct  607  TEAGRSRKQYHRLINRSLMFVS  628



>ref|XP_006433310.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006433311.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006433313.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 ref|XP_006472005.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472006.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472007.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X3 [Citrus 
sinensis]
 gb|ESR46550.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 gb|ESR46551.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
 gb|ESR46553.1| hypothetical protein CICLE_v10000541mg [Citrus clementina]
Length=649

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLV+VASYGE TG+E+P L
Sbjct  483  REIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCL  542

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMGIEAPIP+S+KLGD + +F+RIV AAE PHLSIPE
Sbjct  543  IVAAKDDLDSFAMAIQDSTRVSQDMGIEAPIPVSSKLGDFNIIFRRIVQAAEHPHLSIPE  602

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RKQYHRL+NRSLM VS
Sbjct  603  TEAGRTRKQYHRLINRSLMIVS  624



>ref|XP_011016432.1| PREDICTED: mitochondrial Rho GTPase 1-like, partial [Populus 
euphratica]
Length=445

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLL +K++LA CD+A+FV+DSS ++SWKRA+ELLV+VA +GE TGYE+P L
Sbjct  280  REIPEDGVKKLLLNKESLAPCDIAVFVYDSSDQSSWKRATELLVEVAGHGEDTGYEVPCL  339

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAE PHLSIPE
Sbjct  340  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAEHPHLSIPE  399

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY+RL+NRSLMFVS
Sbjct  400  TEAGRSRKQYNRLINRSLMFVS  421



>ref|XP_004139182.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cucumis sativus]
Length=647

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 127/141 (90%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGVKKLLSSK++LAACD+A+FVHDSS E+SWK+A++LLV+VAS+GE TGYE+P LI
Sbjct  483  EIPEDGVKKLLSSKESLAACDIALFVHDSSDESSWKKATDLLVEVASHGEDTGYEVPCLI  542

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQDSTRVSQDMGIE PIPISTKLGD +N+F+RI +AAE PHLSIPET
Sbjct  543  VAAKDDLDSFPLAIQDSTRVSQDMGIEPPIPISTKLGDFNNVFRRITSAAEHPHLSIPET  602

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG+SRK YH+L N SLMFVS
Sbjct  603  EAGRSRKHYHKLKNHSLMFVS  623



>ref|XP_010242349.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
Length=628

 Score =   229 bits (584),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK LLS K++LAACD+A+FVHDSS +ASW+RA+ELLVDVAS+GE +G+E+P LI
Sbjct  464  EIPEDEVKGLLSKKESLAACDIALFVHDSSDZASWRRATELLVDVASHGEDSGFEVPCLI  523

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLDPY   IQDSTRVSQD+GIEAPIP+S KLGD +++F+RI++AAE PHLSIPET
Sbjct  524  VAAKDDLDPYPMAIQDSTRVSQDLGIEAPIPVSMKLGDFNSIFRRIISAAEHPHLSIPET  583

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG++RK YH+LVNRSLMFVS
Sbjct  584  EAGRNRKHYHQLVNRSLMFVS  604



>gb|KJB33802.1| hypothetical protein B456_006G031500 [Gossypium raimondii]
 gb|KJB33803.1| hypothetical protein B456_006G031500 [Gossypium raimondii]
Length=173

 Score =   214 bits (545),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED V KLLSSK++LA CD+A+FV+ SS E+SWKRA+ELL+DVA +GE TGYE+P LI
Sbjct  40   EIPEDRVSKLLSSKESLAPCDIAVFVYHSSDESSWKRATELLMDVAGHGEDTGYEVPCLI  99

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+F+R+VNAAE PHLSIPET
Sbjct  100  VAAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIFRRMVNAAEHPHLSIPET  159

Query  367  EAGKSRKQYHRLVN  326
            EAG+SRKQYHRL+N
Sbjct  160  EAGRSRKQYHRLIN  173



>ref|XP_004495731.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cicer arietinum]
Length=644

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE GVK+LL++K++LA+CD+A+F+HD S E+SWK +SELLV++A +GE TGYE+P L
Sbjct  479  REIPEGGVKRLLANKESLASCDIAVFLHDRSDESSWKASSELLVEIAGHGENTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD +   IQDSTRVSQDMG+EAPIPIS KLGD ++LF+RIV AAE PHLSIPE
Sbjct  539  IVAAKDDLDSFTLAIQDSTRVSQDMGVEAPIPISVKLGDFNSLFRRIVTAAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGK+RKQYHRL+NRSLMFVS
Sbjct  599  TEAGKTRKQYHRLINRSLMFVS  620



>gb|KJB33804.1| hypothetical protein B456_006G031500 [Gossypium raimondii]
Length=234

 Score =   215 bits (548),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED V KLLSSK++LA CD+A+FV+ SS E+SWKRA+ELL+DVA +GE TGYE+P LI
Sbjct  101  EIPEDRVSKLLSSKESLAPCDIAVFVYHSSDESSWKRATELLMDVAGHGEDTGYEVPCLI  160

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+F+R+VNAAE PHLSIPET
Sbjct  161  VAAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIFRRMVNAAEHPHLSIPET  220

Query  367  EAGKSRKQYHRLVN  326
            EAG+SRKQYHRL+N
Sbjct  221  EAGRSRKQYHRLIN  234



>ref|XP_010244210.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
 ref|XP_010244211.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nelumbo nucifera]
Length=646

 Score =   226 bits (577),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVK LLS+K++LAACD+AIFVHDSS E+SW++A+ELL++VAS+GE +G+E+P L
Sbjct  481  REIPEDGVKTLLSNKESLAACDIAIFVHDSSDESSWRKATELLLEVASHGEDSGFEVPCL  540

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPY   IQDSTRVSQDMGI+APIP+S KLGD +++F+RI++AAE P+LSIPE
Sbjct  541  IVAAKDDLDPYPLAIQDSTRVSQDMGIDAPIPVSMKLGDFNSIFRRIISAAEHPNLSIPE  600

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RK YH+LVNRSLMFVS
Sbjct  601  TEAGRNRKHYHQLVNRSLMFVS  622



>ref|XP_011023599.1| PREDICTED: mitochondrial Rho GTPase 1-like [Populus euphratica]
 ref|XP_011023600.1| PREDICTED: mitochondrial Rho GTPase 1-like [Populus euphratica]
Length=651

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLL +K++LA CD+A+FV+DSS ++SWKRA+ELLV+VA +GE TGYE+P L
Sbjct  486  REIPEDGVKKLLLNKESLAPCDIAVFVYDSSDQSSWKRATELLVEVAGHGEDTGYEVPCL  545

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAE PHLSIPE
Sbjct  546  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAEHPHLSIPE  605

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY+RL+NRSLMFVS
Sbjct  606  TEAGRSRKQYNRLINRSLMFVS  627



>ref|XP_002319545.2| hypothetical protein POPTR_0013s02400g [Populus trichocarpa]
 gb|EEE95468.2| hypothetical protein POPTR_0013s02400g [Populus trichocarpa]
Length=702

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLL +K++LA CD+A+FV+DSS ++SWKRA+ELLV+VA +GE TGYE+P L
Sbjct  486  REIPEDGVKKLLLNKESLAPCDIAVFVYDSSDQSSWKRATELLVEVAGHGEDTGYEVPCL  545

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAE PHLSIPE
Sbjct  546  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAEHPHLSIPE  605

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY+RLVNRSLMFVS
Sbjct  606  TEAGRSRKQYNRLVNRSLMFVS  627



>gb|KJB29213.1| hypothetical protein B456_005G089500 [Gossypium raimondii]
Length=234

 Score =   213 bits (543),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV KLL++K++LA CD+A+FV+DSS E+SWKRA+ELL+DVAS+GE TGYE+P LI
Sbjct  101  EIPEDGVSKLLATKESLAPCDIAVFVYDSSNESSWKRATELLMDVASHGEDTGYEVPCLI  160

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            V AKDDLD +   IQ+STRVSQDMGIEAPIPIS+KL D +N+ +RIVNAAE P+LSIPE 
Sbjct  161  VIAKDDLDSFPMAIQNSTRVSQDMGIEAPIPISSKLSDFNNIIRRIVNAAEHPYLSIPEN  220

Query  367  EAGKSRKQYHRLVN  326
            EAG+SRKQYHRL+N
Sbjct  221  EAGRSRKQYHRLIN  234



>ref|XP_011036784.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X3 [Populus 
euphratica]
Length=651

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DGVKKLLS+K++LA+CD+A+FV+DSS ++SWKRA+ELLV+VA +GE TGYE+P L
Sbjct  486  REIPDDGVKKLLSNKESLASCDIAVFVYDSSDQSSWKRATELLVEVAGHGEDTGYEVPCL  545

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAE PHLSIPE
Sbjct  546  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAEHPHLSIPE  605

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RKQY+RLVNR+LMF S
Sbjct  606  TEAGRTRKQYNRLVNRTLMFAS  627



>ref|XP_006841409.1| hypothetical protein AMTR_s00003p00020850 [Amborella trichopoda]
 gb|ERN03084.1| hypothetical protein AMTR_s00003p00020850 [Amborella trichopoda]
Length=646

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 128/142 (90%), Gaps = 1/142 (1%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+K+LS+K++LA+CDVA+FV+DSS E+SWKRA+ELLV+VA++GE TGY+IP L
Sbjct  482  REIPEDGVQKMLSNKESLASCDVAVFVYDSSDESSWKRATELLVEVATHGEVTGYDIPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPY   I DSTRVSQDMGIEAPI +S +LGD++NLF+RI+NAA+ PHLSIPE
Sbjct  542  IVAAKDDLDPYPLAISDSTRVSQDMGIEAPITVSMRLGDVNNLFRRIINAAQHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RKQY RLVNR  MFVS
Sbjct  602  TEAGRNRKQYRRLVNR-FMFVS  622



>ref|XP_011036782.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011036783.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Populus 
euphratica]
Length=694

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DGVKKLLS+K++LA+CD+A+FV+DSS ++SWKRA+ELLV+VA +GE TGYE+P L
Sbjct  529  REIPDDGVKKLLSNKESLASCDIAVFVYDSSDQSSWKRATELLVEVAGHGEDTGYEVPCL  588

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDL+ +   IQ+STRVSQDMGIEAPIPIS+K+GD +N+F+RIV AAE PHLSIPE
Sbjct  589  IVAAKDDLNSFPMAIQESTRVSQDMGIEAPIPISSKMGDTNNVFRRIVTAAEHPHLSIPE  648

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RKQY+RLVNR+LMF S
Sbjct  649  TEAGRTRKQYNRLVNRTLMFAS  670



>ref|XP_006361850.1| PREDICTED: uncharacterized protein LOC102579917 [Solanum tuberosum]
Length=139

 Score =   209 bits (532),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 107/111 (96%), Gaps = 0/111 (0%)
 Frame = -1

Query  643  SSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLTEIQDSTRVSQDMGIEA  464
            SS EASWKRA++LLVDVAS+GEATGYE+P LIVAAKDDL+PYLTEIQDSTRVSQD+GIEA
Sbjct  3    SSHEASWKRAADLLVDVASHGEATGYEMPCLIVAAKDDLEPYLTEIQDSTRVSQDLGIEA  62

Query  463  PIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLMF  311
            PIPISTKLGD SNLF+RIVNAAE PHLSIPETEAG+SRKQYHRLVNRSLMF
Sbjct  63   PIPISTKLGDFSNLFRRIVNAAEHPHLSIPETEAGRSRKQYHRLVNRSLMF  113



>ref|XP_002284757.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659841.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659842.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 ref|XP_010659843.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
Length=647

 Score =   221 bits (563),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI EDGV+KLLS +D+LAACD+A+FV+DSS E+SWKRA+ELLV+VAS+GE T YE+P L
Sbjct  482  REIAEDGVRKLLSKRDSLAACDIALFVYDSSDESSWKRATELLVEVASHGENTSYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPY   I DSTR++QDMGIE PIPIS KLGD + +F+RI+ AAE PHLSIPE
Sbjct  542  IVAAKDDLDPYPMAIHDSTRLTQDMGIEPPIPISAKLGDFNTIFRRIIAAAEHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY RL+NRSLM VS
Sbjct  602  TEAGRSRKQYSRLINRSLMVVS  623



>ref|XP_003556505.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
Length=646

 Score =   221 bits (563),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV+KLLS+K++LA+CD+A+FVHD S E+SW+ +SELLV++AS+GE TG+E+P LI
Sbjct  482  EIPEDGVRKLLSNKESLASCDIAVFVHDRSDESSWRTSSELLVEIASHGEDTGFEVPCLI  541

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMG+EAPIPIS KLGD ++LF++IV AAE PHLSIPET
Sbjct  542  VAAKDDLDSFPMAIQESTRVSQDMGVEAPIPISVKLGDFNSLFRKIVTAAEHPHLSIPET  601

Query  367  EAGKSRKQYHRLVNRSLM  314
            EAG+SRKQYHRL+NRSLM
Sbjct  602  EAGRSRKQYHRLINRSLM  619



>gb|ADE77615.1| unknown [Picea sitchensis]
Length=177

 Score =   208 bits (529),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI EDGV KLL++K+ LA CDVA+FV+DSS EASW++ +ELLV+VA++ E +G+E+P ++
Sbjct  13   EILEDGVHKLLANKEFLAPCDVAVFVYDSSDEASWRKTAELLVEVATHAENSGFEVPCVM  72

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLDP+   I DS RVSQDMG+E+PI +S KLGD SNLF+RI+N A+ PHLSIPET
Sbjct  73   VAAKDDLDPHPVSISDSARVSQDMGVESPITVSMKLGDTSNLFRRIINVAQHPHLSIPET  132

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAGK+ KQY RL+NRSLMFVS
Sbjct  133  EAGKNHKQYRRLINRSLMFVS  153



>emb|CBI36765.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI EDGV+KLLS +D+LAACD+A+FV+DSS E+SWKRA+ELLV+VAS+GE T YE+P L
Sbjct  519  REIAEDGVRKLLSKRDSLAACDIALFVYDSSDESSWKRATELLVEVASHGENTSYEVPCL  578

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLDPY   I DSTR++QDMGIE PIPIS KLGD + +F+RI+ AAE PHLSIPE
Sbjct  579  IVAAKDDLDPYPMAIHDSTRLTQDMGIEPPIPISAKLGDFNTIFRRIIAAAEHPHLSIPE  638

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+SRKQY RL+NRSLM VS
Sbjct  639  TEAGRSRKQYSRLINRSLMVVS  660



>gb|KHN20217.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=646

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV+KLLS+K++LA+CD+A+FVHD S E+SW+ +SELLV++AS+GE TG+E+P LI
Sbjct  482  EIPEDGVRKLLSNKESLASCDIAVFVHDRSDESSWRTSSELLVEIASHGEDTGFEVPCLI  541

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMG+EAPIPIS KLGD ++LF++IV AA+ PHLSIPET
Sbjct  542  VAAKDDLDSFPMAIQESTRVSQDMGVEAPIPISVKLGDFNSLFRKIVTAADHPHLSIPET  601

Query  367  EAGKSRKQYHRLVNRSLM  314
            EAG+SRKQYHRL+NRSLM
Sbjct  602  EAGRSRKQYHRLINRSLM  619



>ref|XP_003536081.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
 gb|KHN16127.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=646

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV+KLLS+K++LA+CD+A+FVHD S E+SW+ +SELLV++AS+GE TG+E+P LI
Sbjct  482  EIPEDGVRKLLSNKESLASCDIAVFVHDRSDESSWRTSSELLVEIASHGEDTGFEVPCLI  541

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMG+EAPIPIS KLGD ++LF++IV AA+ PHLSIPET
Sbjct  542  VAAKDDLDSFPMAIQESTRVSQDMGVEAPIPISVKLGDFNSLFRKIVTAADHPHLSIPET  601

Query  367  EAGKSRKQYHRLVNRSLM  314
            EAG+SRKQYHRL+NRSLM
Sbjct  602  EAGRSRKQYHRLINRSLM  619



>ref|XP_010456750.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=603

 Score =   218 bits (556),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L +SK++LAACD+A+FV+DSS E+SWKRA+ELLV VA+YGEATGYE+P L
Sbjct  438  REIPEDGVQGLFASKESLAACDIAVFVYDSSDESSWKRATELLVKVATYGEATGYEVPCL  497

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLD +   IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  498  IVSAKDDLDSFPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKIITAAQHPHLSIPE  557

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  558  TEAGKSRKHYNRLINRSLMAVS  579



>ref|XP_006287227.1| hypothetical protein CARUB_v10000404mg [Capsella rubella]
 gb|EOA20125.1| hypothetical protein CARUB_v10000404mg [Capsella rubella]
Length=649

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA+YGEATGYE+P L
Sbjct  484  REIPEDGVQGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVNVATYGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLDSFPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKIITAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_006287226.1| hypothetical protein CARUB_v10000404mg, partial [Capsella rubella]
 gb|EOA20124.1| hypothetical protein CARUB_v10000404mg, partial [Capsella rubella]
Length=664

 Score =   219 bits (558),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA+YGEATGYE+P L
Sbjct  499  REIPEDGVQGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVNVATYGEATGYEVPCL  558

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  559  MVSAKDDLDSFPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKIITAAQHPHLSIPE  618

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  619  TEAGKSRKHYNRLINRSLMAVS  640



>ref|XP_010278002.1| PREDICTED: uncharacterized protein LOC104612310 [Nelumbo nucifera]
Length=317

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 119/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK LLS K++LAACD+A+FVHDSS EASW+RA ELLVDVAS+GE +G+E+P L 
Sbjct  153  EIPEDEVKGLLSKKESLAACDIALFVHDSSDEASWRRAKELLVDVASHGEDSGFEVPCLS  212

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            V AKDDLDPY T I+D  RVSQD+GIE PIP+S KL D +++F  I++ AE PHLSIPET
Sbjct  213  VVAKDDLDPYPTAIEDIIRVSQDLGIETPIPVSMKLLDFNSIFHDIISVAEHPHLSIPET  272

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAG++RK YH+LVNRSLMFVS
Sbjct  273  EAGRNRKHYHQLVNRSLMFVS  293



>ref|XP_009385504.1| PREDICTED: mitochondrial Rho GTPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=648

 Score =   218 bits (554),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  VK LLS+K++LAACD+A+FVHDSS E SWKR  ELLV VAS+GE TG+E+P L
Sbjct  483  REIPETEVKNLLSNKESLAACDIAVFVHDSSDEESWKRTKELLVQVASHGENTGFEVPCL  542

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I++AKDDLDPY   +QDSTRVSQDMGIE PIPIS KL D +++F RIV+AA++PHLSIPE
Sbjct  543  IISAKDDLDPYPLAVQDSTRVSQDMGIETPIPISVKLRDHNDVFCRIVSAAQQPHLSIPE  602

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y RLVNRSLMFVS
Sbjct  603  TEAGKSRKHYRRLVNRSLMFVS  624



>ref|XP_010421600.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
 ref|XP_010421601.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L +SK++LAACD+A+FV+DSS E+SWKRA+ELLV VA+YGEATGYE+P L
Sbjct  484  REIPEDGVQGLFASKESLAACDIAVFVYDSSDESSWKRATELLVKVATYGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLDSFPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKIITAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_006394958.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394959.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394960.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 ref|XP_006394961.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32244.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32245.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32246.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
 gb|ESQ32247.1| hypothetical protein EUTSA_v10003793mg [Eutrema salsugineum]
Length=650

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVK L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  485  REIPEDGVKGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  544

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMG+E P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  545  MVSAKDDLDSFPISIQESTRVTQDMGLEPPVSISSKLGDFNNLFRKILTAAQHPHLSIPE  604

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  605  TEAGKSRKHYNRLINRSLMAVS  626



>ref|XP_007144734.1| hypothetical protein PHAVU_007G180300g [Phaseolus vulgaris]
 gb|ESW16728.1| hypothetical protein PHAVU_007G180300g [Phaseolus vulgaris]
Length=646

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIP DGV++LLS+K++LA+CD+A+FVHD S E+SW+ +SELLV++AS+GE TG+E+P LI
Sbjct  482  EIPGDGVRRLLSNKESLASCDIAVFVHDRSDESSWRTSSELLVEIASHGEDTGFEVPCLI  541

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   IQ+STRVSQDMG+EAPIPIS KLGD + LF++IV AAE PHLSIPET
Sbjct  542  VAAKDDLDSFPMAIQESTRVSQDMGVEAPIPISVKLGDFNGLFRKIVTAAEHPHLSIPET  601

Query  367  EAGKSRKQYHRLVNRSLM  314
            EAG+SRKQYHRL+NRSLM
Sbjct  602  EAGRSRKQYHRLINRSLM  619



>emb|CDY25032.1| BnaC02g39760D [Brassica napus]
Length=645

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DG K L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  480  REIPDDGAKGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+ IS+KLGD +NLF++IV AA+ PHLSIPE
Sbjct  540  MVSAKDDLDSFPICIQESTRVTQDMGIEPPVSISSKLGDFNNLFRKIVTAAQHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  600  TEAGKSRKHYNRLINRSLMAVS  621



>emb|CDY05572.1| BnaA02g31190D [Brassica napus]
Length=645

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DG K L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  480  REIPDDGAKGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+ IS+KLGD +NLF++IV AA+ PHLSIPE
Sbjct  540  MVSAKDDLDSFPICIQESTRVTQDMGIEPPVSISSKLGDFNNLFRKIVTAAQHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  600  TEAGKSRKHYNRLINRSLMAVS  621



>emb|CDX80639.1| BnaC07g28050D [Brassica napus]
Length=649

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE G + L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  484  REIPEGGAQGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+PIS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLDSFPISIQESTRVTQDMGIEPPVPISSKLGDFNNLFRKILTAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_009129866.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
 ref|XP_009129867.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=645

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP+DG K L SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  480  REIPDDGAKGLFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+ IS+KLGD +NLF++IV AA+ PHLSIPE
Sbjct  540  MVSAKDDLDSFPICIQESTRVTQDMGIEPPVSISSKLGDFNNLFRKIVTAAQHPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  600  TEAGKSRKHYNRLINRSLMAVS  621



>ref|XP_002874365.1| EMB2473 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50624.1| EMB2473 [Arabidopsis lyrata subsp. lyrata]
Length=649

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L SSK++LAACD+A+FV+DSS E+SWKRA++LLV+VA+YGEATGYE+P L
Sbjct  484  REIPEDGVQGLFSSKESLAACDIAVFVYDSSDESSWKRATQLLVEVATYGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD     IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLDSSPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKILTAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_009385505.1| PREDICTED: mitochondrial Rho GTPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=647

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI E  VK LLSSK++LAACD+A+FVHDSS E SWKR  ELLV VAS+GE TG+E+P L
Sbjct  482  REIAEIKVKNLLSSKESLAACDIAVFVHDSSDEESWKRTKELLVQVASHGENTGFEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I++AKDDLDPY   +QDSTRVSQDMGIE PIPIS KL D +++F+RIV+AA++PHLSIPE
Sbjct  542  IISAKDDLDPYPLAVQDSTRVSQDMGIETPIPISMKLRDHNDVFRRIVSAAQQPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRKQY RL+NRSL FVS
Sbjct  602  TEAGKSRKQYQRLLNRSLTFVS  623



>ref|NP_198106.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 ref|NP_001031953.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 sp|Q8RXF8.1|MIRO1_ARATH RecName: Full=Mitochondrial Rho GTPase 1; Short=AtMIRO1; AltName: 
Full=Miro-related GTPase 1 [Arabidopsis thaliana]
 gb|AAL91169.1| unknown protein [Arabidopsis thaliana]
 gb|AAO29970.1| unknown protein [Arabidopsis thaliana]
 gb|AED93698.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
 gb|AED93699.1| MIRO-related GTP-ase 1 [Arabidopsis thaliana]
Length=648

 Score =   214 bits (546),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L SSK++LAACD+A+FV+DSS E+SWKRA++LLV+VA+YGEATGYE+P L
Sbjct  483  REIPEDGVQGLFSSKESLAACDIAVFVYDSSDESSWKRATQLLVEVANYGEATGYEVPCL  542

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD     IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  543  MVSAKDDLDSSPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKILTAAQHPHLSIPE  602

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  603  TEAGKSRKHYNRLINRSLMAVS  624



>ref|XP_008786917.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Phoenix 
dactylifera]
Length=634

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PED VK +LS+K++LAACD+A+FVHDSS E SW++A +LLV VAS+GE TG+E+P L
Sbjct  469  REVPEDEVKMVLSNKESLAACDIAVFVHDSSDEISWRKAKDLLVQVASHGENTGFEVPCL  528

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLDPY   IQDSTRVSQDMGIE PIPIS KL D +N+F RIV AA+ PHLSIPE
Sbjct  529  IVSAKDDLDPYPLAIQDSTRVSQDMGIETPIPISIKLRDFNNVFLRIVTAAQHPHLSIPE  588

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG++RK Y RLVNRSLMF
Sbjct  589  TEAGRNRKHYRRLVNRSLMF  608



>ref|XP_008786915.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Phoenix 
dactylifera]
Length=643

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PED VK +LS+K++LAACD+A+FVHDSS E SW++A +LLV VAS+GE TG+E+P L
Sbjct  478  REVPEDEVKMVLSNKESLAACDIAVFVHDSSDEISWRKAKDLLVQVASHGENTGFEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLDPY   IQDSTRVSQDMGIE PIPIS KL D +N+F RIV AA+ PHLSIPE
Sbjct  538  IVSAKDDLDPYPLAIQDSTRVSQDMGIETPIPISIKLRDFNNVFLRIVTAAQHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG++RK Y RLVNRSLMF
Sbjct  598  TEAGRNRKHYRRLVNRSLMF  617



>ref|XP_010494001.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   213 bits (542),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+ L +SK++LAACD+A+FV+DSS E+SWK+A+ELLV VA+YGE+TGYE+P L
Sbjct  484  REIPEDGVQGLFASKESLAACDIAVFVYDSSDESSWKKATELLVKVATYGESTGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDL+ +   IQ+STR++QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLESFPISIQESTRMTQDMGIEPPVSISSKLGDFNNLFRKIITAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>emb|CDX86152.1| BnaA06g28690D [Brassica napus]
Length=649

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE G + + SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  484  REIPEGGAQGVFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+ IS+KLGD +NLF++I+ AA+ PHLSIPE
Sbjct  544  MVSAKDDLDSFPISIQESTRVTQDMGIEPPVSISSKLGDFNNLFRKILTAAQHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_010931977.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Elaeis 
guineensis]
Length=643

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PED VK +LS+K++LA CD+A+FVHDSS E SW++A +LLV VAS+GE TG+E+P L
Sbjct  478  REVPEDDVKMVLSNKESLAPCDIAVFVHDSSDENSWRKAKDLLVQVASHGENTGFEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLDPY   IQD TRVSQ+MGIE PIPIS KL DL+N+F RIV AA+ PHLSIPE
Sbjct  538  IVSAKDDLDPYPLAIQDLTRVSQEMGIETPIPISIKLRDLNNVFHRIVTAAQHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG++RK Y RLVNRSLMF
Sbjct  598  TEAGRNRKHYRRLVNRSLMF  617



>ref|XP_010931978.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Elaeis 
guineensis]
Length=634

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PED VK +LS+K++LA CD+A+FVHDSS E SW++A +LLV VAS+GE TG+E+P L
Sbjct  469  REVPEDDVKMVLSNKESLAPCDIAVFVHDSSDENSWRKAKDLLVQVASHGENTGFEVPCL  528

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLDPY   IQD TRVSQ+MGIE PIPIS KL DL+N+F RIV AA+ PHLSIPE
Sbjct  529  IVSAKDDLDPYPLAIQDLTRVSQEMGIETPIPISIKLRDLNNVFHRIVTAAQHPHLSIPE  588

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG++RK Y RLVNRSLMF
Sbjct  589  TEAGRNRKHYRRLVNRSLMF  608



>ref|XP_009151199.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=649

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE G + + SSK++LAACD+A+FV+DSS E+SWKRA+ELLV+VA++GEATGYE+P L
Sbjct  484  REIPEGGAQGVFSSKESLAACDIAVFVYDSSDESSWKRATELLVEVATHGEATGYEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDDLD +   IQ+STRV+QDMGIE P+ IS+KLGD +NLF++I+ AA  PHLSIPE
Sbjct  544  MVSAKDDLDSFPISIQESTRVTQDMGIEPPVSISSKLGDFNNLFRKILTAAHHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSLM VS
Sbjct  604  TEAGKSRKHYNRLINRSLMAVS  625



>ref|XP_010546687.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010546688.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=649

 Score =   208 bits (530),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE+GVK LL+SK++LA CD+A+FV+DSS E S+KRA+ELLV+VA++GE TG+E+P L+
Sbjct  485  EIPEEGVKGLLASKESLAVCDIAVFVYDSSDELSYKRATELLVEVATHGEDTGFEVPCLM  544

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD +   +Q+STRV+QDMGIEAPIPIS+KLGD SNLF++I+ AAE PHLSIPET
Sbjct  545  VAAKDDLDSFPMAVQESTRVTQDMGIEAPIPISSKLGDFSNLFRKILMAAEHPHLSIPET  604

Query  367  EAGKSRKQYHRLVNRSLM  314
            EA KSRK Y RL+NRSLM
Sbjct  605  EARKSRKHYSRLINRSLM  622



>ref|XP_008790947.1| PREDICTED: mitochondrial Rho GTPase 1 [Phoenix dactylifera]
Length=641

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PED V+ +LS+K++LA CD+A+FVHDSS E SW +A +LL+ VAS+GE TG+E+P L
Sbjct  478  REVPEDEVQTMLSNKESLATCDIAVFVHDSSDENSWTKAKDLLMQVASHGENTGFEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV+AKDDLDPY   IQDSTRVSQDMGIE PIP+S KL D +N+F+RI+ AA+ PH+SIPE
Sbjct  538  IVSAKDDLDPYPLAIQDSTRVSQDMGIETPIPVSFKLRDFNNVFRRIITAAQHPHMSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAG++RK YHRLVN SLM
Sbjct  598  TEAGRNRKHYHRLVNHSLM  616



>ref|XP_010908349.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Elaeis 
guineensis]
Length=669

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+P+D VK +LS+K++LA CD+A+FVHDSS E SW +A +LL+ VA++GE TG+E+P L
Sbjct  478  REVPDDEVKTVLSNKESLAGCDIAVFVHDSSDENSWTKAKDLLMQVATHGENTGFEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV++KDDLDPY   IQDSTRVSQDMGIE PIP+S KL D +N+F+RI+ AA+ PHLSIPE
Sbjct  538  IVSSKDDLDPYPLAIQDSTRVSQDMGIETPIPVSIKLRDFNNVFRRIITAAQHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++RK Y R+VNRSLM VS
Sbjct  598  TEAGRNRKHYRRIVNRSLMLVS  619



>ref|XP_009111756.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=641

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDG + + SSK++LAACD+A+FV+DSS E+SWKRASELLV+VA++GEATGYE+P L
Sbjct  476  REIPEDGAQGIFSSKESLAACDIAVFVYDSSDESSWKRASELLVEVANHGEATGYEVPCL  535

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDD+      IQ+STRV+Q+MGIE P+ IS+KLGD +NLF +IV AA+ PHLSIPE
Sbjct  536  MVSAKDDIVSSQISIQESTRVTQEMGIEPPVSISSKLGDFNNLFGKIVTAAQHPHLSIPE  595

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSL+ VS
Sbjct  596  TEAGKSRKHYNRLINRSLLSVS  617



>ref|XP_006650773.1| PREDICTED: mitochondrial Rho GTPase 2-like [Oryza brachyantha]
Length=501

 Score =   202 bits (513),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED V+ LL+ +++LA+CDVA+F++DSS E SW+RA  LLV+VA++GE TGYE+P L
Sbjct  336  REIPEDDVRSLLTDRESLASCDVAVFIYDSSDELSWQRARNLLVEVATHGENTGYEVPCL  395

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPE
Sbjct  396  IVAAKDDLDQSPLALQESTRVSQDMGIETPIPISVRLRDLNNIFCRIVHAAQQPHLSIPE  455

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK+R+QY +L+NRSLM VS
Sbjct  456  TEVGKTRRQYRQLLNRSLMVVS  477



>emb|CDX99980.1| BnaC09g03210D [Brassica napus]
Length=701

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP DG + + SSK++LAACD+AIFV+DSS E+SWKRASELLV+VA++GEATGYE+P L
Sbjct  536  REIPADGAQVIFSSKESLAACDIAIFVYDSSDESSWKRASELLVEVANHGEATGYEVPCL  595

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDD+      IQDSTRV+Q+MGIE P+ IS+KLGD +NLF +IV AA+ PHLSIPE
Sbjct  596  MVSAKDDIASSQISIQDSTRVTQEMGIEPPVSISSKLGDFNNLFCKIVTAAQHPHLSIPE  655

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSL+ VS
Sbjct  656  TEAGKSRKHYNRLINRSLLSVS  677



>emb|CDY69035.1| BnaA09g52280D, partial [Brassica napus]
Length=683

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP DG + + SSK++LAACD+A+FV+DSS E+SWKRASELLV+VA++GEATGYE+P L
Sbjct  518  REIPADGAQGIFSSKESLAACDIAVFVYDSSDESSWKRASELLVEVANHGEATGYEVPCL  577

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDD+      IQDSTRV+Q+MGIE P+ IS+KLGD +NLF +IV AA+ PHLSIPE
Sbjct  578  MVSAKDDIVSSQISIQDSTRVTQEMGIEPPVSISSKLGDFNNLFCKIVTAAQHPHLSIPE  637

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSRK Y+RL+NRSL+ VS
Sbjct  638  TEAGKSRKHYNRLINRSLLSVS  659



>ref|XP_004171182.1| PREDICTED: mitochondrial Rho GTPase 1-like, partial [Cucumis 
sativus]
Length=197

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV K LS+++ LA CDVA+FV+DSS E SW R+ ELLV+VA  GE +G+ +P +
Sbjct  32   REIPEDGVHKFLSNEECLAGCDVAVFVYDSSDEDSWNRSRELLVEVARKGEVSGFGVPCI  91

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            + AAKDDLDP    +QDS RV Q +GIEAPIP+S+K GDLSN+F +I+ AAE PH +IPE
Sbjct  92   VTAAKDDLDPSPLAVQDSVRVCQGLGIEAPIPVSSKSGDLSNIFNKILTAAEHPHANIPE  151

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G++RK+Y++L NRSL+FVS
Sbjct  152  TERGRNRKRYYKLFNRSLIFVS  173



>ref|XP_010908350.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+P+D VK +LS+K++LA CD+A+FVHDSS E SW +A +LL+ VA++GE TG+E+P L
Sbjct  478  REVPDDEVKTVLSNKESLAGCDIAVFVHDSSDENSWTKAKDLLMQVATHGENTGFEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IV++KDDLDPY   IQDSTRVSQDMGIE PIP+S KL D +N+F+RI+ AA+ PHLSIPE
Sbjct  538  IVSSKDDLDPYPLAIQDSTRVSQDMGIETPIPVSIKLRDFNNVFRRIITAAQHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAG++RK Y R+VNRSLM
Sbjct  598  TEAGRNRKHYRRIVNRSLM  616



>ref|XP_003563951.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brachypodium distachyon]
Length=643

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LL++K++LA CDVA+FV+DS  E SW+RA +LLV VA++GE TGYE+P L
Sbjct  478  REIPEGDVRSLLTNKESLAPCDVALFVYDSCDEFSWQRARDLLVQVATHGENTGYEVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F R+V+AA+RPHLSIPE
Sbjct  538  IVAAKDDLDQSPLALQESTRVSQDMGIETPIPISVKLKDLNNIFCRVVHAAQRPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKSR+QY +L+NRSLM VS
Sbjct  598  TEAGKSRRQYRQLLNRSLMVVS  619



>gb|EMT05838.1| Mitochondrial Rho GTPase 1 [Aegilops tauschii]
Length=611

 Score =   203 bits (516),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LL++K++LA CD A+FV+DS  E SW+RA +LLV VAS+GE TGYE+P L
Sbjct  463  REIPEGDVRSLLNNKESLAPCDAAVFVYDSCDEFSWQRARDLLVQVASHGENTGYEVPCL  522

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F RIV+AA+RPHLSIPE
Sbjct  523  IVAAKDDLDQSPVALQESTRVSQDMGIETPIPISVKLKDLNNIFCRIVHAAQRPHLSIPE  582

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGK+R+QY +L+NRSLM VS
Sbjct  583  TEAGKTRRQYRQLLNRSLMVVS  604



>ref|XP_003591106.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES61357.1| Rho GTPase-like protein [Medicago truncatula]
Length=646

 Score =   200 bits (509),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE  V +L++ K++LA+CD+A+FVHD S E+SW+ + +LLV +A +GE TGYE+P LI
Sbjct  482  EIPEGEVARLVADKESLASCDIAVFVHDRSDESSWRVSYDLLVQIAGHGENTGYEVPCLI  541

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLDP+   IQ+STRVSQDMG+EAPIPIS KLGD ++LF+RIV AAE PHLSIPET
Sbjct  542  VAAKDDLDPFALAIQESTRVSQDMGVEAPIPISVKLGDFNSLFRRIVTAAEHPHLSIPET  601

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EAGK+RKQ +++++RSL+ VS
Sbjct  602  EAGKTRKQINKILSRSLLCVS  622



>dbj|BAJ94408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=725

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LL++K++LA CD A+FV+DS  E SW+RA +LLV VAS+GE TGYE+P L
Sbjct  560  REIPEGDVRSLLNNKESLAPCDAAVFVYDSCDEFSWQRARDLLVQVASHGENTGYEVPCL  619

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+++F RIV+AA+RPHLSIPE
Sbjct  620  IVAAKDDLDQSPVALQESTRVSQDMGIETPIPISVKLKDLNSIFCRIVHAAQRPHLSIPE  679

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGK+R+QY +L+NRSLM VS
Sbjct  680  TEAGKTRRQYRQLLNRSLMVVS  701



>ref|XP_010550971.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550972.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550973.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
 ref|XP_010550974.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=649

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI EDGVK LLS+K++LA CD+A+FV+DSS E S+KRA+ +LV+VA +GE TG+E+P L
Sbjct  484  REILEDGVKGLLSAKESLAVCDIAVFVYDSSDEVSYKRATGMLVEVARHGEDTGFEVPCL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLD +   IQ+STRV+QDMG+EAPIPIS+KLGD  N+F++I+ AAE PHLSIPE
Sbjct  544  MVAAKDDLDSFPMAIQESTRVTQDMGMEAPIPISSKLGDFGNVFRKILEAAEHPHLSIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEA KSRK Y++L+N SLM VS
Sbjct  604  TEARKSRKHYNKLINCSLMVVS  625



>ref|NP_001051665.1| Os03g0810600 [Oryza sativa Japonica Group]
 gb|AAT77915.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF99485.1| small GTP-binding protein domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF13579.1| Os03g0810600 [Oryza sativa Japonica Group]
 gb|EAY92295.1| hypothetical protein OsI_14016 [Oryza sativa Indica Group]
 dbj|BAG95295.1| unnamed protein product [Oryza sativa Japonica Group]
Length=642

 Score =   197 bits (501),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED V+ LL+ +++LA CDVA+FV+DS  E SW+R  +LLV+VA++GE TGYE+P L
Sbjct  477  REIPEDDVRPLLADRESLAPCDVAVFVYDSCDEFSWQRTRDLLVEVATHGENTGYEVPCL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPE
Sbjct  537  IVAAKDDLDQSPLALQESTRVSQDMGIEMPIPISVRLRDLNNIFCRIVHAAQQPHLSIPE  596

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R+QY +L+NRSLM
Sbjct  597  TEAGKTRRQYRQLLNRSLM  615



>ref|XP_008643395.1| PREDICTED: uncharacterized protein LOC100278140 isoform X1 [Zea 
mays]
Length=652

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ +LS +++LA CDVA+FV+DS  E SW+RA +LLV VA++GE TGYE+P L
Sbjct  487  REIPEGDVRSILSDRESLAPCDVAVFVYDSCDEYSWQRARDLLVQVATHGENTGYEVPCL  546

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F RIV+AA+ PHLSIPE
Sbjct  547  IVAAKDDLDQSSQALQESTRVSQDMGIETPIPISVKLRDLNNIFCRIVHAAQLPHLSIPE  606

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R+QY +L+NRSLM
Sbjct  607  TEAGKTRRQYRQLLNRSLM  625



>ref|XP_008665658.1| PREDICTED: mitochondrial Rho GTPase 1-like [Zea mays]
 tpg|DAA52126.1| TPA: hypothetical protein ZEAMMB73_406369 [Zea mays]
Length=647

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LLS +++LA CDVA+FV+DS  E SW+RA +LLV VA++GE TGYE+P L
Sbjct  482  REIPEGDVRSLLSDRESLAPCDVAVFVYDSCDEYSWQRARDLLVQVATHGENTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F RIV+AA++PHLSIPE
Sbjct  542  IVAAKDDLDQSSQALQESTRVSQDMGIETPIPISVKLRDLNNIFCRIVHAAQQPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TE GK+R+QY +L+NRSLM
Sbjct  602  TETGKARRQYRQLLNRSLM  620



>ref|NP_001144985.1| uncharacterized protein LOC100278140 [Zea mays]
 gb|ACG44216.1| hypothetical protein [Zea mays]
Length=647

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ +LS +++LA CDVA+FV+DS  E SW+RA +LLV VA++GE TGYE+P L
Sbjct  482  REIPEGDVRSILSDRESLAPCDVAVFVYDSCDEYSWQRARDLLVQVATHGENTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F RIV+AA+ PHLSIPE
Sbjct  542  IVAAKDDLDQSSQALQESTRVSQDMGIETPIPISVKLRDLNNIFCRIVHAAQLPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R+QY +L+NRSLM
Sbjct  602  TEAGKTRRQYRQLLNRSLM  620



>gb|AFW67245.1| hypothetical protein ZEAMMB73_549387 [Zea mays]
Length=647

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ +LS +++LA CDVA+FV+DS  E SW+RA +LLV VA++GE TGYE+P L
Sbjct  482  REIPEGDVRSILSDRESLAPCDVAVFVYDSCDEYSWQRARDLLVQVATHGENTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+N+F RIV+AA+ PHLSIPE
Sbjct  542  IVAAKDDLDQSSQALQESTRVSQDMGIETPIPISVKLRDLNNIFCRIVHAAQLPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R+QY +L+NRSLM
Sbjct  602  TEAGKTRRQYRQLLNRSLM  620



>ref|XP_011032721.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X1 [Populus euphratica]
Length=649

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK LS K++L++ DVA+FV+DSS E SWKR++ELLV+VA +GE +GY +PSL
Sbjct  484  QEIPEDGVKKFLSDKESLSSSDVAVFVYDSSDEYSWKRSNELLVEVARHGEESGYGVPSL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I+AAKDDLDP+   +Q S RV Q++G+ A IPIS+KLGD++N+F RI++AAE PHL+IPE
Sbjct  544  IIAAKDDLDPHPMSVQKSVRVCQELGVGASIPISSKLGDMNNVFCRILSAAEHPHLNIPE  603

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T AG+ RKQ+H+LVN SL+F+S
Sbjct  604  TVAGRKRKQFHQLVNHSLLFMS  625



>ref|XP_011032724.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X3 [Populus euphratica]
Length=645

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK LS K++L++ DVA+FV+DSS E SWKR++ELLV+VA +GE +GY +PSL
Sbjct  480  QEIPEDGVKKFLSDKESLSSSDVAVFVYDSSDEYSWKRSNELLVEVARHGEESGYGVPSL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I+AAKDDLDP+   +Q S RV Q++G+ A IPIS+KLGD++N+F RI++AAE PHL+IPE
Sbjct  540  IIAAKDDLDPHPMSVQKSVRVCQELGVGASIPISSKLGDMNNVFCRILSAAEHPHLNIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T AG+ RKQ+H+LVN SL+F+S
Sbjct  600  TVAGRKRKQFHQLVNHSLLFMS  621



>ref|XP_004981322.1| PREDICTED: mitochondrial Rho GTPase 1-like [Setaria italica]
Length=647

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LLS K++LA CDVA+FV+DS  E SW RA +LLV VA++GE TGYE+P L
Sbjct  482  REIPEGDVRSLLSDKESLAPCDVAVFVYDSCDEYSWHRARDLLVQVATHGENTGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVA+KDDLD     +Q+STRVSQDMGIE PIPIS +L DL+N+F R+V+AA++PHLSIPE
Sbjct  542  IVASKDDLDQCPQALQESTRVSQDMGIETPIPISVRLRDLNNIFCRVVHAAQQPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R+QY +L+NRSLM
Sbjct  602  TEAGKTRRQYRQLLNRSLM  620



>ref|XP_002520752.1| rac-GTP binding protein, putative [Ricinus communis]
 gb|EEF41714.1| rac-GTP binding protein, putative [Ricinus communis]
Length=644

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            E+PEDGVKK LS+K++LAACDVA+FV+D S E SWKR+ ELLV++   GE +GY +P L+
Sbjct  480  EVPEDGVKKYLSNKESLAACDVAVFVYDCSDEYSWKRSCELLVEIVRQGEESGYGMPCLL  539

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDLDPY   +QDS  V Q++GIEAPIP+STKLG+++N+F RI++AA RPHL+IPET
Sbjct  540  IAAKDDLDPYPMAVQDSVAVCQELGIEAPIPVSTKLGEMNNVFCRILSAAVRPHLNIPET  599

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E+G+ RK + +LVN SL+F+S
Sbjct  600  ESGRRRKVFRQLVNHSLIFMS  620



>ref|XP_002306771.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE93767.1| GTP-binding family protein [Populus trichocarpa]
Length=645

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/141 (65%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGVKK LS+K++L++ DVA+FV DSS E SWKR++ELLV+VA +GE +GY +PSLI
Sbjct  481  EIPEDGVKKFLSNKESLSSSDVAVFVCDSSDEYSWKRSNELLVEVARHGEESGYGVPSLI  540

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDLDP+   +Q S RV Q++GI A IPIS+KLGD++N+F RI++AAE PHL+IPET
Sbjct  541  IAAKDDLDPHPMSVQKSVRVCQELGIGASIPISSKLGDMNNVFCRILSAAEHPHLNIPET  600

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
             AG+ RKQ+H+LVN SL+F+S
Sbjct  601  VAGRKRKQFHQLVNHSLLFMS  621



>gb|KDO68749.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=670

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVKK+LS+K+ALA+CDV IFV+DSS E SWKR  ELLV+VA  GE +GY +P L
Sbjct  478  QEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++A+KDDL PY   +QDS RV+Q++GIE PIP+S K  DL+N+F RI+ AAE PHL+IPE
Sbjct  538  LIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G++RK+Y  LVN SL+FVS
Sbjct  598  TETGRNRKRYRHLVNSSLVFVS  619



>gb|KDO68748.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=504

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVKK+LS+K+ALA+CDV IFV+DSS E SWKR  ELLV+VA  GE +GY +P L
Sbjct  339  QEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCL  398

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++A+KDDL PY   +QDS RV+Q++GIE PIP+S K  DL+N+F RI+ AAE PHL+IPE
Sbjct  399  LIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPE  458

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TE G++RK+Y  LVN SL+F
Sbjct  459  TETGRNRKRYRHLVNSSLVF  478



>gb|KDP21466.1| hypothetical protein JCGZ_21937 [Jatropha curcas]
Length=643

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
            HE+PEDGVKK LS+K++LAACDVA+FV+DSS + SWKR  E+L++V   GE +GY +P L
Sbjct  478  HEMPEDGVKKFLSNKESLAACDVAVFVYDSSDKYSWKRTCEMLLEVTRLGEESGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDP+   +QD   V QD+GIEAPI +S KLG+ +N+F RI++AAERPHL+IPE
Sbjct  538  LVAAKDDLDPFTMAVQDPVTVCQDLGIEAPIAVSMKLGETNNVFCRILSAAERPHLNIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG+ RK + +L + SL+F+S
Sbjct  598  TEAGRKRKYFRQLFSHSLLFMS  619



>ref|XP_002275434.1| PREDICTED: mitochondrial Rho GTPase 1 [Vitis vinifera]
 emb|CBI32339.3| unnamed protein product [Vitis vinifera]
Length=639

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED  KK LS+K +LAACD AIFV+DSS E SW+RA+ELLV+VA  GE TG+ +P L
Sbjct  474  REIPEDRFKKFLSNKQSLAACDAAIFVYDSSDELSWRRATELLVEVARQGEETGFGVPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAK DLDP+    QDS +V Q+MGIE+PIP+S K GDL+NLF RI+ AAE PHLSIPE
Sbjct  534  LVAAKYDLDPFPMAAQDSAKVCQEMGIESPIPVSVKSGDLNNLFCRIIRAAEHPHLSIPE  593

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T+ G+  KQY +LVN SLM  S
Sbjct  594  TQTGRKHKQYRQLVNHSLMLFS  615



>ref|XP_002993625.1| hypothetical protein SELMODRAFT_451618 [Selaginella moellendorffii]
 gb|EFJ05317.1| hypothetical protein SELMODRAFT_451618 [Selaginella moellendorffii]
Length=640

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V  L+ +KDALA CDVA FV+DSS +ASW+RASE+LV V + GE +GYE+P L
Sbjct  474  REIPEEQVANLMQTKDALAPCDVAAFVYDSSDDASWERASEILVKVTALGEHSGYEVPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL+P    IQ+S RV  DMG+EAPI +S +LGD+ NLF+RIV+AAERPHLSIPE
Sbjct  534  LIAAKDDLEPDPLAIQNSARVCTDMGVEAPIAVSMRLGDIGNLFRRIVDAAERPHLSIPE  593

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKS K ++R+VNRSL   +
Sbjct  594  TEAGKSHKSFNRIVNRSLTITA  615



>ref|XP_002973259.1| MIRO family protein [Selaginella moellendorffii]
 gb|EFJ25633.1| MIRO family protein [Selaginella moellendorffii]
Length=640

 Score =   192 bits (487),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V  L+ +KDALA CDVA FV+DSS +ASW+RASE+LV V + GE +GYE+P L
Sbjct  474  REIPEEQVANLMQTKDALAPCDVAAFVYDSSDDASWERASEILVKVTALGEHSGYEVPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL+P    IQ+S RV  DMG+EAPI +S +LGD+ NLF+RIV+AAERPHLSIPE
Sbjct  534  LIAAKDDLEPDPLAIQNSARVCTDMGVEAPIAVSMRLGDIGNLFRRIVDAAERPHLSIPE  593

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAGKS K ++R+VNRSL   +
Sbjct  594  TEAGKSHKSFNRIVNRSLTITA  615



>gb|KGN44818.1| hypothetical protein Csa_7G389500 [Cucumis sativus]
Length=641

 Score =   191 bits (486),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV K LS+++ LA CDVA+FV+DSS E SW R+ ELLV+VA  GE +G+ +P +
Sbjct  476  REIPEDGVHKFLSNEECLAGCDVAVFVYDSSDEDSWNRSRELLVEVARKGEVSGFGVPCI  535

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            + AAKDDLDP    +QDS RV Q +GIEAPIP+S+K GDLSN+F +I+ AAE PH +IPE
Sbjct  536  VTAAKDDLDPSPLAVQDSVRVCQGLGIEAPIPVSSKSGDLSNIFNKILTAAEHPHANIPE  595

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G++RK+Y++L NRSL+FVS
Sbjct  596  TERGRNRKRYYKLFNRSLIFVS  617



>ref|XP_006444081.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 ref|XP_006479729.1| PREDICTED: mitochondrial Rho GTPase 1-like [Citrus sinensis]
 gb|ESR57321.1| hypothetical protein CICLE_v10019250mg [Citrus clementina]
 gb|KDO68747.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=643

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+GVKK+LS+K+ALA+CDV IFV+DSS E SWKR  ELLV+VA  GE +GY +P L
Sbjct  478  QEIPEEGVKKILSNKEALASCDVTIFVYDSSDEYSWKRTKELLVEVARLGEDSGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++A+KDDL PY   +QDS RV+Q++GIE PIP+S K  DL+N+F RI+ AAE PHL+IPE
Sbjct  538  LIASKDDLKPYTMAVQDSARVTQELGIEPPIPVSMKSKDLNNVFSRIIWAAEHPHLNIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TE G++RK+Y  LVN SL+F
Sbjct  598  TETGRNRKRYRHLVNSSLVF  617



>ref|XP_004148893.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1-like 
[Cucumis sativus]
Length=639

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV K LS+++ LA CDVA+FV+DSS E SW R+ ELLV+VA  GE +G+ +P +
Sbjct  474  REIPEDGVHKFLSNEECLAGCDVAVFVYDSSDEDSWNRSRELLVEVARKGEVSGFGVPCI  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            + AAKDDLDP    +QDS RV Q +GIEAPIP+S+K GDLSN+F +I+ AAE PH +IPE
Sbjct  534  VTAAKDDLDPSPLAVQDSVRVCQGLGIEAPIPVSSKSGDLSNIFNKILTAAEHPHANIPE  593

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G++RK+Y++L NRSL+FVS
Sbjct  594  TERGRNRKRYYKLFNRSLIFVS  615



>ref|XP_008451367.1| PREDICTED: mitochondrial Rho GTPase 1 [Cucumis melo]
Length=641

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV K LS+++ LA CDVA+FV+DSS E SW R+ ELLV+VA  GE +G+ +P +
Sbjct  476  REIPEDGVHKFLSNEECLAGCDVAVFVYDSSDEDSWNRSRELLVEVARKGEVSGFGVPCI  535

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP    +QDS RV Q +GIEAPIP+S+K GDLS++F +I+ AAE PH +IPE
Sbjct  536  VIAAKDDLDPSPLAVQDSVRVCQGLGIEAPIPVSSKSGDLSHIFNKILTAAEHPHANIPE  595

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G++RK+Y++L NRSL+FVS
Sbjct  596  TERGRNRKRYYKLFNRSLIFVS  617



>ref|XP_009111753.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brassica rapa]
Length=664

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDG + L SS ++LA CD+A+FV+DSS E+SWKRASELLV+VA++GEATGYE+P L
Sbjct  482  REIPEDGAQGLFSSMESLAKCDIAVFVYDSSDESSWKRASELLVEVANHGEATGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDD+      IQDSTRV+QD+GIE  + IS+KL D +NLF++I+ AA+ PHLSIPE
Sbjct  542  MVSAKDDIVSSQIPIQDSTRVTQDVGIEHHVSISSKLEDFNNLFRKIITAAQHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGKSRK Y+R +NR LM
Sbjct  602  TEAGKSRKHYNRKINRFLM  620



>emb|CDY19722.1| BnaA09g03750D [Brassica napus]
Length=842

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDG + L SS ++LA CD+A+FV+DSS E+SWKRASELLV+VA++GEATGYE+P L
Sbjct  482  REIPEDGAQGLFSSMESLAKCDIAVFVYDSSDESSWKRASELLVEVANHGEATGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+AKDD+      IQDSTRV+Q+MGIE  + IS+KL D +NLF++I+ AA+ PHLSIPE
Sbjct  542  MVSAKDDIVSSQIPIQDSTRVTQEMGIEPHVSISSKLEDFNNLFRKIITAAQHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGKSRK Y+R +NR LM
Sbjct  602  TEAGKSRKHYNRKINRFLM  620



>ref|XP_007162421.1| hypothetical protein PHAVU_001G150700g [Phaseolus vulgaris]
 gb|ESW34415.1| hypothetical protein PHAVU_001G150700g [Phaseolus vulgaris]
Length=643

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V  +LS KD LAACDVA+FV+DSS E SWK++ +LL  VA  G+ TGY +P L
Sbjct  478  REIPESKVSNVLSKKDYLAACDVAVFVYDSSDELSWKKSRDLLEKVARQGDLTGYRVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL PYL  +QDS +V+Q++GIEAPI +S KLGD SN++ +IV+AAE PHLSIPE
Sbjct  538  LIAAKDDLTPYLRAVQDSVKVTQELGIEAPIHVSMKLGDSSNVYNKIVHAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RKQYHRL+  SL+F S
Sbjct  598  TEIGKKRKQYHRLLQNSLVFAS  619



>ref|XP_010524876.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=648

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 118/144 (82%), Gaps = 2/144 (1%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVK+LLSSK++LA CD+A+F++D+S E+S+KR +ELLV++A++GE TG+E+P L
Sbjct  481  REIPEDGVKELLSSKESLAECDIAVFMYDNSDESSYKRTTELLVEIATHGEDTGFEVPCL  540

Query  550  IVAAKDDLDPYLTE--IQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSI  377
            +V+AKDD D +     +Q+  RV+QDMGIE PIP+S+KLGD  NLF++I+ AA  PHL I
Sbjct  541  VVSAKDDRDSFSIHQTVQEPFRVTQDMGIEPPIPVSSKLGDFGNLFRKILTAAGHPHLGI  600

Query  376  PETEAGKSRKQYHRLVNRSLMFVS  305
            PETEA KSRK+Y RL+NRSL  VS
Sbjct  601  PETEARKSRKRYRRLINRSLTVVS  624



>gb|KEH32598.1| Rho GTPase-like protein [Medicago truncatula]
Length=651

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGVK LL++K++LA+CD+AI VHD S E+SW+ +S+LLVD+A++GE +G+E+P LI
Sbjct  488  EIPEDGVKGLLANKESLASCDIAIIVHDRSDESSWRASSKLLVDIAAHGEDSGFEVPCLI  547

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAER-PHLSIPE  371
            VAAKDD   +    Q+STRVSQDMG+EAPIPIS  LG+L++LF RIV AA + PHLSIPE
Sbjct  548  VAAKDDQVSFTMAAQESTRVSQDMGVEAPIPISLLLGNLNDLFLRIVTAATKHPHLSIPE  607

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T+ GKSRK Y RLVN +++FVS
Sbjct  608  TDVGKSRKLYTRLVNNTVLFVS  629



>ref|XP_011032722.1| PREDICTED: mitochondrial Rho GTPase 1 isoform X2 [Populus euphratica]
Length=647

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK LS K++L++ DVA+FV+DSS E SWKR++ELLV+VA +GE +GY +PSL
Sbjct  484  QEIPEDGVKKFLSDKESLSSSDVAVFVYDSSDEYSWKRSNELLVEVARHGEESGYGVPSL  543

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            I+AAKDDLDP+   +Q S  V Q++G+ A IPIS+KLGD++N+F RI++AAE PHL+IPE
Sbjct  544  IIAAKDDLDPHPMSVQKS--VCQELGVGASIPISSKLGDMNNVFCRILSAAEHPHLNIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T AG+ RKQ+H+LVN SL+F+S
Sbjct  602  TVAGRKRKQFHQLVNHSLLFMS  623



>ref|XP_006644996.1| PREDICTED: mitochondrial Rho GTPase 1-like [Oryza brachyantha]
Length=646

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V  LLS K++LA CD+A+ V+DS  E SW+RA +LLV VA++G+ TGYE+P L
Sbjct  479  REIPEGDVGSLLSDKESLAPCDIAVCVYDSCDEFSWQRARDLLVKVAAHGKNTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDD    L  +QDSTRVS  MGIE P+P+S +L DL+N+F RIVNAA +PHL+IPE
Sbjct  539  IVAAKDDHGQSLMALQDSTRVSHGMGIETPVPVSVRLNDLNNIFCRIVNAARQPHLNIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TEAG++R+QY +L+NRSL  VS
Sbjct  599  TEAGRTRRQYRQLLNRSLTVVS  620



>ref|NP_001044775.1| Os01g0843300 [Oryza sativa Japonica Group]
 dbj|BAF06689.1| Os01g0843300 [Oryza sativa Japonica Group]
Length=597

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E  V  LLS K++LA CDVA+ V+DS  E SW+RA ELLV VA+ G+ TGYE+P LI
Sbjct  433  EISEGDVGPLLSDKESLAPCDVAVIVYDSGDEVSWQRARELLVQVATRGKNTGYEVPCLI  492

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD     +QDSTRVS DMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPET
Sbjct  493  VAAKDDLDQSPLALQDSTRVSHDMGIETPIPISVRLRDLNNIFCRIVHAAQQPHLSIPET  552

Query  367  EAGKSRKQYHRLVNRSL  317
            EAGK+ +QY +L+NRSL
Sbjct  553  EAGKTHRQYRQLLNRSL  569



>dbj|BAD81741.1| putative mitochondrial Rho 1 [Oryza sativa Japonica Group]
Length=594

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI E  V  LLS K++LA CDVA+ V+DS  E SW+RA ELLV VA+ G+ TGYE+P L
Sbjct  429  REISEGDVGPLLSDKESLAPCDVAVIVYDSGDEVSWQRARELLVQVATRGKNTGYEVPCL  488

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +QDSTRVS DMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPE
Sbjct  489  IVAAKDDLDQSPLALQDSTRVSHDMGIETPIPISVRLRDLNNIFCRIVHAAQQPHLSIPE  548

Query  370  TEAGKSRKQYHRLVNRSL  317
            TEAGK+ +QY +L+NRSL
Sbjct  549  TEAGKTHRQYRQLLNRSL  566



>gb|KJB23092.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=620

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLS+K+ LAACDVA+F++DSS E SWKR+ ELL+DVA  GE +GY +P L
Sbjct  478  QEIPEDGVKKLLSNKECLAACDVAVFLYDSSDEYSWKRSRELLLDVARRGEESGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP+   +Q+S RV+Q +G+EAPIP+  KL D  ++F RIV+AAE PHLSIPE
Sbjct  538  LIAAKDDLDPFPMSLQNSARVTQQLGMEAPIPVGVKLRDSKSVFSRIVSAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RK+Y RLVN SLMFVS
Sbjct  598  TEKGKKRKRYRRLVNSSLMFVS  619



>ref|XP_007050628.1| Mitochondrial Rho GTPase [Theobroma cacao]
 gb|EOX94785.1| Mitochondrial Rho GTPase [Theobroma cacao]
Length=641

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKK LSSK+ LAACDVA+F++DSS E SWKR+ ELL+DVA  GE +GY +P L
Sbjct  478  QEIPEDGVKKFLSSKECLAACDVAVFMYDSSDEYSWKRSRELLLDVARQGEESGYRVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDPY   +Q+S RV+Q +G+EAPIP+  KL D   +F RI+NAAE PHLSIPE
Sbjct  538  LIAAKDDLDPYPMALQNSARVTQQLGMEAPIPLGVKLRDSKTVFSRIINAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TE GK RK+Y RLVN SLMF
Sbjct  598  TEKGKKRKKYRRLVNSSLMF  617



>ref|XP_008235402.1| PREDICTED: mitochondrial Rho GTPase 1 [Prunus mume]
Length=636

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK  LS K  LAACDVA+FVHDSS E SWKR+ ELLV+VA  GE +GY +P L
Sbjct  471  REIPEDEVKTFLSKKTFLAACDVAVFVHDSSSEHSWKRSRELLVEVAKQGEESGYGVPCL  530

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDPY   ++DS  +SQ++GIEAP+ +S KL  ++++F RI++ AE PHLSIPE
Sbjct  531  LIAAKDDLDPYPMAVRDSLGISQELGIEAPVRVSMKLNTMNDVFNRILSVAEHPHLSIPE  590

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE  K+RK+Y ++VNRSLM VS
Sbjct  591  TETRKNRKKYLQVVNRSLMCVS  612



>gb|KJB23094.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=643

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLS+K+ LAACDVA+F++DSS E SWKR+ ELL+DVA  GE +GY +P L
Sbjct  478  QEIPEDGVKKLLSNKECLAACDVAVFLYDSSDEYSWKRSRELLLDVARRGEESGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP+   +Q+S RV+Q +G+EAPIP+  KL D  ++F RIV+AAE PHLSIPE
Sbjct  538  LIAAKDDLDPFPMSLQNSARVTQQLGMEAPIPVGVKLRDSKSVFSRIVSAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RK+Y RLVN SLMFVS
Sbjct  598  TEKGKKRKRYRRLVNSSLMFVS  619



>gb|EEC71783.1| hypothetical protein OsI_04400 [Oryza sativa Indica Group]
Length=618

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI E  V  LLS K++LA CDVA+ V+DS  E SW+RA ELLV VA+ G+ TGYE+P L
Sbjct  453  REISEGDVGPLLSDKESLAPCDVAVIVYDSGDEVSWQRARELLVQVATRGKNTGYEVPCL  512

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +QDSTRVS DMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPE
Sbjct  513  IVAAKDDLDQSPLALQDSTRVSHDMGIETPIPISVRLRDLNNIFCRIVHAAQQPHLSIPE  572

Query  370  TEAGKSRKQYHRLVNRSL  317
            TEAGK+ +QY +L+NRSL
Sbjct  573  TEAGKTHRQYRQLLNRSL  590



>gb|EEE55655.1| hypothetical protein OsJ_04046 [Oryza sativa Japonica Group]
Length=628

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E  V  LLS K++LA CDVA+ V+DS  E SW+RA ELLV VA+ G+ TGYE+P LI
Sbjct  464  EISEGDVGPLLSDKESLAPCDVAVIVYDSGDEVSWQRARELLVQVATRGKNTGYEVPCLI  523

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD     +QDSTRVS DMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPET
Sbjct  524  VAAKDDLDQSPLALQDSTRVSHDMGIETPIPISVRLRDLNNIFCRIVHAAQQPHLSIPET  583

Query  367  EAGKSRKQYHRLVNRSL  317
            EAGK+ +QY +L+NRSL
Sbjct  584  EAGKTHRQYRQLLNRSL  600



>ref|XP_003520566.1| PREDICTED: mitochondrial Rho GTPase 1-like [Glycine max]
Length=644

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE  +  +LS+KD LAACDVA+FV+DSS E SWK++ +LL  VA  G+ TGY +P L+
Sbjct  480  EIPESEISNVLSNKDYLAACDVAVFVYDSSDEHSWKKSRDLLEKVAQQGDLTGYRVPCLL  539

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL PY   +QDS +V+Q++GIEAPI +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  540  IAAKDDLTPYPRALQDSVKVTQELGIEAPIHVSMKLGDSSNVYHKIVNAAEHPHLSIPET  599

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E G+ RKQ HRL+  SL+F S
Sbjct  600  EIGRKRKQCHRLLQHSLVFAS  620



>ref|XP_004493664.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Cicer 
arietinum]
Length=648

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V  +LS++D LAACDVA+FV+DSS + SWK++ +LL  VA  G+ TGY +P L
Sbjct  476  REIPESEVSIVLSNQDYLAACDVAVFVYDSSDQYSWKKSRDLLEKVAGQGDLTGYRVPCL  535

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL PY   +QDS +V+Q++GIEAPI +S KLGD SN++ +IV AAE PHLSIPE
Sbjct  536  LIAAKDDLTPYPRAVQDSVKVTQELGIEAPIHVSMKLGDSSNVYNKIVRAAEHPHLSIPE  595

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RKQYHRL+  SL+F S
Sbjct  596  TEIGKKRKQYHRLLQNSLIFAS  617



>ref|XP_004493665.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Cicer 
arietinum]
Length=641

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V  +LS++D LAACDVA+FV+DSS + SWK++ +LL  VA  G+ TGY +P L
Sbjct  476  REIPESEVSIVLSNQDYLAACDVAVFVYDSSDQYSWKKSRDLLEKVAGQGDLTGYRVPCL  535

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL PY   +QDS +V+Q++GIEAPI +S KLGD SN++ +IV AAE PHLSIPE
Sbjct  536  LIAAKDDLTPYPRAVQDSVKVTQELGIEAPIHVSMKLGDSSNVYNKIVRAAEHPHLSIPE  595

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RKQYHRL+  SL+F S
Sbjct  596  TEIGKKRKQYHRLLQNSLIFAS  617



>ref|XP_010090397.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXB39367.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=603

 Score =   182 bits (463),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDG KK LS+ + L  CDVA+F++DSS E SWKR+ ELLVDVA  GE +GY +P L
Sbjct  437  REIPEDGFKKFLSNNEFLGPCDVAVFLYDSSDEYSWKRSQELLVDVARQGEESGYGVPFL  496

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +V+ K DL+PY   IQDS RV   +GI+API +S K G+L+N+F RIV+ A RPHL+IPE
Sbjct  497  LVSTKTDLNPYPVAIQDSMRVCLKLGIDAPISVSVKSGNLNNIFNRIVDVAVRPHLNIPE  556

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+SRK Y +LV+RSLM +S
Sbjct  557  TEMGRSRKHYQQLVSRSLMCIS  578



>gb|KEH23750.1| Rho GTPase [Medicago truncatula]
Length=639

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V K LS++D LAACDVAIFV+DSS E SWK++ +LL  VA  G+ TGY +P L
Sbjct  474  REIPESEVSKFLSNQDYLAACDVAIFVYDSSDEYSWKKSRDLLEKVAGQGDLTGYRVPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL PY   +QDS +V+ ++GIEAPI +S KLGD +N++ +IV+AAE PHLSIPE
Sbjct  534  LIAAKDDLTPYPRAVQDSVKVTLELGIEAPIHVSMKLGDSNNVYNKIVSAAEHPHLSIPE  593

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RKQY+RLV  SL+F S
Sbjct  594  TEIGKKRKQYNRLVQNSLIFAS  615



>gb|KEH23751.1| Rho GTPase [Medicago truncatula]
Length=643

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V K LS++D LAACDVAIFV+DSS E SWK++ +LL  VA  G+ TGY +P L
Sbjct  478  REIPESEVSKFLSNQDYLAACDVAIFVYDSSDEYSWKKSRDLLEKVAGQGDLTGYRVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL PY   +QDS +V+ ++GIEAPI +S KLGD +N++ +IV+AAE PHLSIPE
Sbjct  538  LIAAKDDLTPYPRAVQDSVKVTLELGIEAPIHVSMKLGDSNNVYNKIVSAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE GK RKQY+RLV  SL+F S
Sbjct  598  TEIGKKRKQYNRLVQNSLIFAS  619



>ref|XP_007199739.1| hypothetical protein PRUPE_ppa002696mg [Prunus persica]
 gb|EMJ00938.1| hypothetical protein PRUPE_ppa002696mg [Prunus persica]
Length=644

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK   S K  LAACDVA+FVHDSS E SWKR+ ELLV+VA  GE +GY +P L
Sbjct  479  REIPEDEVKTFFSKKTFLAACDVAVFVHDSSSEHSWKRSRELLVEVAKQGEESGYGVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDPY   ++DS  +SQ++GIEAP+ +S KL  ++++F RI++ AE PHLSIPE
Sbjct  539  LIAAKDDLDPYPMAVRDSLGISQELGIEAPVRVSMKLNTMNDVFNRILSVAEHPHLSIPE  598

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE  K+RK+Y ++VNRSLM VS
Sbjct  599  TETRKNRKKYLQVVNRSLMCVS  620



>ref|XP_006604431.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Glycine 
max]
Length=621

 Score =   182 bits (462),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE  V  +LS+K  LAACDVA+FV+DSS E SWK++ +LL  V   G+ TGY +P L+
Sbjct  457  EIPESEVSNVLSNKGYLAACDVAVFVYDSSDEHSWKKSRDLLEKVGRQGDLTGYRVPCLL  516

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL PY   +QDS +V++++GIEAPI +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  517  IAAKDDLTPYPRAVQDSVKVTEELGIEAPIHVSMKLGDSSNVYHKIVNAAEHPHLSIPET  576

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E G+ RKQYHRL+  SL+F S
Sbjct  577  EIGRKRKQYHRLLQHSLVFAS  597



>ref|XP_003554248.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Glycine 
max]
Length=644

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE  V  +LS+K  LAACDVA+FV+DSS E SWK++ +LL  V   G+ TGY +P L+
Sbjct  480  EIPESEVSNVLSNKGYLAACDVAVFVYDSSDEHSWKKSRDLLEKVGRQGDLTGYRVPCLL  539

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL PY   +QDS +V++++GIEAPI +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  540  IAAKDDLTPYPRAVQDSVKVTEELGIEAPIHVSMKLGDSSNVYHKIVNAAEHPHLSIPET  599

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E G+ RKQYHRL+  SL+F S
Sbjct  600  EIGRKRKQYHRLLQHSLVFAS  620



>gb|KHN45356.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=654

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPE  V  +LS+K  LAACDVA+FV+DSS E SWK++ +LL  V   G+ TGY +P L+
Sbjct  490  EIPESEVSNVLSNKGYLAACDVAVFVYDSSDEHSWKKSRDLLEKVGRQGDLTGYRVPCLL  549

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL PY   +QDS +V++++GIEAPI +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  550  IAAKDDLTPYPRAVQDSVKVTEELGIEAPIHVSMKLGDSSNVYHKIVNAAEHPHLSIPET  609

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E G+ RKQYHRL+  SL+F S
Sbjct  610  EIGRKRKQYHRLLQHSLVFAS  630



>gb|KJB23090.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=641

 Score =   181 bits (459),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLS+K+ LAACDVA+F++DSS E SWKR+ ELL+DVA  GE +GY +P L
Sbjct  478  QEIPEDGVKKLLSNKECLAACDVAVFLYDSSDEYSWKRSRELLLDVARRGEESGYGVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP+   +Q+S RV+Q +G+EAPIP+  KL D  ++F RIV+AAE PHLSIPE
Sbjct  538  LIAAKDDLDPFPMSLQNSARVTQQLGMEAPIPVGVKLRDSKSVFSRIVSAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TE GK RK+Y RLVN SLMF
Sbjct  598  TEKGKKRKRYRRLVNSSLMF  617



>gb|KJB23091.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=662

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGVKKLLS+K+ LAACDVA+F++DSS E SWKR+ ELL+DVA  GE +GY +P L
Sbjct  499  QEIPEDGVKKLLSNKECLAACDVAVFLYDSSDEYSWKRSRELLLDVARRGEESGYGVPCL  558

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP+   +Q+S RV+Q +G+EAPIP+  KL D  ++F RIV+AAE PHLSIPE
Sbjct  559  LIAAKDDLDPFPMSLQNSARVTQQLGMEAPIPVGVKLRDSKSVFSRIVSAAEHPHLSIPE  618

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TE GK RK+Y RLVN SLMF
Sbjct  619  TEKGKKRKRYRRLVNSSLMF  638



>ref|XP_009631945.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana tomentosiformis]
Length=643

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK LLS+K++LA+CDVA+FV+DSS E S KRASELL+ VA  GE +G+ +P L 
Sbjct  479  EIPEDEVKMLLSNKESLASCDVAVFVYDSSDEYSLKRASELLMTVARRGEISGFMMPCLF  538

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDLD Y   I+DS ++ Q  GIEAPI IS K  DL+++F RIV AAE PH+S+PET
Sbjct  539  VAAKDDLDSYPMAIKDSAKICQSFGIEAPIHISVKERDLNSVFNRIVTAAEHPHISVPET  598

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E G+S+K+Y  LVNRSLMF S
Sbjct  599  EVGRSQKRYRHLVNRSLMFTS  619



>ref|XP_006349667.1| PREDICTED: mitochondrial Rho GTPase 1-like [Solanum tuberosum]
Length=643

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK +LS+K++LA+CDVA+F +DSS E S KRASELL+ VA  GE +G+ +P L
Sbjct  478  REIPEDEVKMILSTKESLASCDVAVFAYDSSDEYSLKRASELLMTVARRGEVSGFMVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
             VAAKDDLD Y   I+DS ++ Q+ GI+API IS K  DL+++F RIV AAE PHLS+PE
Sbjct  538  FVAAKDDLDSYPMAIKDSAKICQNFGIDAPIHISVKERDLNSMFNRIVTAAEHPHLSVPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+S+K+Y  LVNRSLMF S
Sbjct  598  TEVGRSQKRYRHLVNRSLMFTS  619



>ref|XP_004247162.1| PREDICTED: mitochondrial Rho GTPase 1 [Solanum lycopersicum]
Length=643

 Score =   179 bits (455),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK +LS+K++LA+CDVA+F +DSS E S KRASELL+ VA  GE +G+ +P L
Sbjct  478  REIPEDEVKMILSTKESLASCDVAVFAYDSSDEYSLKRASELLMTVARRGEVSGFMVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
             VAAKDDLD Y   I+DS ++ Q+ GI+API IS K  DL+++F RIV AAE PHLS+PE
Sbjct  538  FVAAKDDLDSYPMAIKDSAKICQNFGIDAPIHISVKERDLNSMFNRIVTAAEHPHLSVPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+S+K+Y  LVNRSLMF S
Sbjct  598  TEVGRSQKRYRHLVNRSLMFTS  619



>gb|AES96221.2| Rho GTPase [Medicago truncatula]
Length=320

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV KLL++K +LA+CD+AIFV+D S E+SWK + ELL+ +  +GE TG+++P L+
Sbjct  156  EISEGGVTKLLANKKSLASCDIAIFVYDRSDESSWKASYELLLKIVRHGEDTGFQVPCLM  215

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDD D +   I++ T VSQDM ++APIPIS KLG+ +N+F RIV+AAE PHLSIPET
Sbjct  216  VAAKDDKDSFTMVIEEETTVSQDMEVDAPIPISVKLGNFNNVFHRIVSAAEPPHLSIPET  275

Query  367  EAGKSRKQYHRLVNRSL  317
            EAGK+ K +H +++RSL
Sbjct  276  EAGKTHKPFHTVIDRSL  292



>ref|XP_009787210.1| PREDICTED: mitochondrial Rho GTPase 1-like [Nicotiana sylvestris]
Length=643

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK LLS+K++LA+CDVA+FV+DSS E S KRASELL+ VA  GE +G+ +P L
Sbjct  478  REIPEDEVKMLLSNKESLASCDVAVFVYDSSDEYSLKRASELLMTVARRGEISGFMMPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
             VAAKDDLD Y   I+DS ++ Q  GI+API IS K  DL+++F RIV AAE PHLS+PE
Sbjct  538  FVAAKDDLDSYPMAIKDSAKICQSFGIDAPIHISVKERDLNSVFNRIVAAAEHPHLSVPE  597

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+S+K+Y  LVNRSLMF S
Sbjct  598  TEVGRSQKRYRHLVNRSLMFTS  619



>ref|XP_010513798.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=252

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +G+  P L
Sbjct  89   REIPEERVKKFLTNKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGHGTPCL  148

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  D+GI+ P+ +S KLG+ ++LF RIV+ AE PHLSIPE
Sbjct  149  LVAAKDDLDPYPMSVQESDRVCMDLGIDVPVSLSMKLGEPNSLFSRIVSTAENPHLSIPE  208

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   +LVN SL+FVS
Sbjct  209  TESGRRSKNIRQLVNSSLLFVS  230



>ref|XP_011079844.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial Rho GTPase 1 [Sesamum 
indicum]
Length=645

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+PEDGVKKLLS+K++LA+CDVA+FV+DSS E S+K A+ELL  VA  GE +G+ +PSL
Sbjct  480  REVPEDGVKKLLSNKESLASCDVAVFVYDSSSEYSFKGATELLSYVARQGEESGFGMPSL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAK+DL    T  QDS ++  DMGI+APIP+S K  DL+++F RIVNAAE PHLS+PE
Sbjct  540  LIAAKNDLGSNPTVNQDSAKICLDMGIDAPIPVSVKERDLNDVFSRIVNAAEHPHLSVPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE G+S+K+Y +LVNR+LM +S
Sbjct  600  TELGRSQKRYRQLVNRALMCIS  621



>ref|XP_003613256.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES96214.1| Rho GTPase-like protein [Medicago truncatula]
Length=621

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV KLL++K++L +CD+A+FVHD S ++SWK +SELL  +A +GE TG+++P L 
Sbjct  459  EISEGGVTKLLANKESLGSCDIAVFVHDRS-DSSWKTSSELLSKIAGHGEDTGFQVPCLT  517

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VA  DD D +   IQ++T VSQ +G+EAP+PIS KLGD +N+F +IV AAE PHL+IP+T
Sbjct  518  VAVNDDQDSFTMAIQETTMVSQYIGVEAPMPISVKLGDSNNIFHQIVTAAEHPHLNIPKT  577

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E  K+ KQYHRL++RSLMFVS
Sbjct  578  EGRKTCKQYHRLIDRSLMFVS  598



>gb|EAZ29014.1| hypothetical protein OsJ_13062 [Oryza sativa Japonica Group]
Length=609

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED V+ LL+ +++LA CDVA+FV+DS  E SW+R  +LLV+VA++GE TGYE+P L
Sbjct  477  REIPEDDVRPLLADRESLAPCDVAVFVYDSCDEFSWQRTRDLLVEVATHGENTGYEVPCL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS +L DL+N+F RIV+AA++PHLSIPE
Sbjct  537  IVAAKDDLDQSPLALQESTRVSQDMGIEMPIPISVRLRDLNNIFCRIVHAAQQPHLSIPE  596

Query  370  TEAGKS  353
            TEAGK+
Sbjct  597  TEAGKT  602



>ref|XP_004290658.1| PREDICTED: mitochondrial Rho GTPase 2 [Fragaria vesca subsp. 
vesca]
Length=645

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 110/141 (78%), Gaps = 1/141 (1%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYG-EATGYEIPS  554
             EIPED VK LLS K++LAACDVA+FV+DSS E SWKR+ ELL +VAS G E+  Y +P 
Sbjct  479  REIPEDEVKFLLSKKNSLAACDVAVFVYDSSDEHSWKRSKELLAEVASKGDESEDYLVPC  538

Query  553  LIVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
            L++AAKDDLDPY   ++DS  VSQ++GIEAPI +S K  +L+N+F RIV AAE PHLSIP
Sbjct  539  LLIAAKDDLDPYPMAVRDSLGVSQELGIEAPIRVSMKQSNLNNVFGRIVYAAEHPHLSIP  598

Query  373  ETEAGKSRKQYHRLVNRSLMF  311
            ETE  K+R++Y +L NRSL F
Sbjct  599  ETETRKNRRKYRQLFNRSLTF  619



>gb|KFK35451.1| hypothetical protein AALP_AA5G286100 [Arabis alpina]
Length=642

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +GY  P L
Sbjct  482  REIPEDRVKKFLANKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGYGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  D+GI+ P+ +S KLGD +NLF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPMSVQESDRVCMDLGIDIPVSLSMKLGDPNNLFSRIVSTAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   + VN SL+FVS
Sbjct  602  TESGRRSKNIRQFVNNSLVFVS  623



>gb|KFK35452.1| hypothetical protein AALP_AA5G286100 [Arabis alpina]
Length=645

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +GY  P L
Sbjct  482  REIPEDRVKKFLANKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGYGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  D+GI+ P+ +S KLGD +NLF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPMSVQESDRVCMDLGIDIPVSLSMKLGDPNNLFSRIVSTAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   + VN SL+FVS
Sbjct  602  TESGRRSKNIRQFVNNSLVFVS  623



>ref|XP_003613263.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=469

 Score =   173 bits (439),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV KLL++K +LA+CD+AIFV+D S E+SWK + ELL+ +  +GE TG+++P L+
Sbjct  305  EISEGGVTKLLANKKSLASCDIAIFVYDRSDESSWKASYELLLKIVRHGEDTGFQVPCLM  364

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDD D +   I++ T VSQDM ++APIPIS KLG+ +N+F RIV+AAE PHLSIPET
Sbjct  365  VAAKDDKDSFTMVIEEETTVSQDMEVDAPIPISVKLGNFNNVFHRIVSAAEPPHLSIPET  424

Query  367  EAGKSRKQYHRLVNRSL  317
            EAGK+ K +H +++RSL
Sbjct  425  EAGKTHKPFHTVIDRSL  441



>ref|XP_003613772.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=682

 Score =   175 bits (443),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV KLL++K++LA+CD+A+FV+D S E+SW  A ELLV +A +G  TG+E+P L+
Sbjct  481  EISEGGVTKLLANKESLASCDIAVFVYDRSDESSWDAAYELLVKIAEHGTYTGFEMPCLM  540

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDD D +   I+++T VSQDMG+EAPIPIS   GDL+++F++IV+AAE PHLSIP T
Sbjct  541  VAAKDDKDSFTMGIRETTGVSQDMGVEAPIPISVMSGDLNDVFRQIVSAAEHPHLSIPVT  600

Query  367  EAGKSRKQYHRLVNRSLMF  311
            EAGK  K++HRL+  SL F
Sbjct  601  EAGKRHKKFHRLIKGSLQF  619



>gb|AES96730.2| Rho GTPase-like protein [Medicago truncatula]
Length=656

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV KLL++K++LA+CD+A+FV+D S E+SW  A ELLV +A +G  TG+E+P L+
Sbjct  481  EISEGGVTKLLANKESLASCDIAVFVYDRSDESSWDAAYELLVKIAEHGTYTGFEMPCLM  540

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDD D +   I+++T VSQDMG+EAPIPIS   GDL+++F++IV+AAE PHLSIP T
Sbjct  541  VAAKDDKDSFTMGIRETTGVSQDMGVEAPIPISVMSGDLNDVFRQIVSAAEHPHLSIPVT  600

Query  367  EAGKSRKQYHRLVNRSLMF  311
            EAGK  K++HRL+  SL F
Sbjct  601  EAGKRHKKFHRLIKGSLQF  619



>ref|XP_001775852.1| predicted protein [Physcomitrella patens]
 gb|EDQ59391.1| predicted protein [Physcomitrella patens]
Length=638

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             E+ E+ V  LL  KDAL  CDVA FV+DSS  ASW RA ELLV VA+YGE  G E+P L
Sbjct  474  REVNEESVTSLLGKKDALTDCDVAAFVYDSSDAASWNRAHELLVAVAAYGEMNGMEMPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDLDP  +  Q++ RV  +MG+E PI +S KLGD+ NLF+RIV+AA+RPHLSIPE
Sbjct  534  LIAAKDDLDPDSSCSQNAIRVCNEMGVEPPISVSMKLGDIGNLFRRIVDAAQRPHLSIPE  593

Query  370  TEAGKSRKQYHRLVNRSL  317
            TE G+  K Y RL+ RSL
Sbjct  594  TEQGRVNKHYRRLIQRSL  611



>ref|XP_007144632.1| hypothetical protein PHAVU_007G171800g [Phaseolus vulgaris]
 gb|ESW16626.1| hypothetical protein PHAVU_007G171800g [Phaseolus vulgaris]
Length=643

 Score =   172 bits (435),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDG+ + LS++D LAACDVA+FV+DSS E SWK++ +LL  V  +GE TGY  P L+
Sbjct  479  EIPEDGLPEFLSNQDCLAACDVAVFVYDSSDEYSWKKSRDLLEKVVRHGELTGYRTPCLV  538

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDL P    + DS +V+Q++GI+AP+ +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  539  VAAKDDLSPLPRAVLDSFKVTQELGIKAPVHVSMKLGDSSNVYNKIVNAAEHPHLSIPET  598

Query  367  EAGKSRKQYHRLVNRSLMF  311
            E  + +KQ+H+L +RSL+F
Sbjct  599  EISRRKKQHHQL-HRSLIF  616



>ref|XP_010552819.1| PREDICTED: mitochondrial Rho GTPase 1-like [Tarenaya hassleriana]
Length=333

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK+ L+++++LAACDVA+ V+DSS E SWK++ ++L++VA  GE +GY  P L
Sbjct  170  REIPEDRVKEFLANRESLAACDVAVIVYDSSDEYSWKKSRDILMEVARRGEESGYGTPCL  229

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   ++DS     ++G++ PI +S KLGD ++LF RIV+ AE PHLSIPE
Sbjct  230  LVAAKDDLDPYPLSVRDSDMACLELGMDVPISLSMKLGDPNSLFSRIVSTAENPHLSIPE  289

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  KQ  ++VN SL+FVS
Sbjct  290  TESGRRSKQIRQIVNSSLIFVS  311



>ref|XP_008368856.1| PREDICTED: mitochondrial Rho GTPase 1 [Malus domestica]
Length=642

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  L ACDVA+FVHDSS E SWKR+ ELLVDVA   E +GY +P L+
Sbjct  478  EIPEDKVKTYLSDKTFLTACDVAVFVHDSSSEHSWKRSRELLVDVAKQVEQSGYGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL  Y   ++DS  +S ++GI AP+ +S KL  ++++F +IVNAAE PHLSIPET
Sbjct  538  IAAKDDLGAYPMAVRDSXVISHELGIGAPVRVSMKLSTMNDVFYKIVNAAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLM  314
            EA ++RK+Y +LVNRSLM
Sbjct  598  EAMRNRKKYLQLVNRSLM  615



>ref|XP_002878499.1| hypothetical protein ARALYDRAFT_486817 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54758.1| hypothetical protein ARALYDRAFT_486817 [Arabidopsis lyrata subsp. 
lyrata]
Length=643

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED +KK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +GY  P L
Sbjct  480  REIPEDRIKKFLTNKESLAACDVAVVVYDSSDIYSWKKAREILMEVARRGEESGYGTPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S KLG+ ++LF RIV+ AE PHLSIPE
Sbjct  540  LVAAKDDLDPYPMSVQESDRVCMELGIDIPVSLSMKLGEPNSLFSRIVSTAENPHLSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   +LVN SL+FVS
Sbjct  600  TESGRRSKNIRQLVNSSLVFVS  621



>ref|XP_010512723.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +G+  P L
Sbjct  482  REIPEERVKKFLTNKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGHGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  D+GI+ P+ +S KLG+ ++LF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPMSVQESDRVCMDLGIDVPVSLSMKLGEPNSLFSRIVSTAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   +LVN SL+FVS
Sbjct  602  TESGRRSKNIRQLVNSSLLFVS  623



>ref|XP_009367694.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=649

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  LAACDVA+FVH SS E SWKR+ ELLV+VA  GE +G+ +P L+
Sbjct  478  EIPEDDVKTHLSDKTFLAACDVAVFVHSSSSEHSWKRSRELLVEVAKQGEESGFGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL  Y   ++DS  +S ++GIEAP+ +S KL  ++++F +IVN AE PHLSIPET
Sbjct  538  IAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSMKLSTMNDVFYKIVNVAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA ++RK+Y ++VN+SL+ VS
Sbjct  598  EARRNRKKYLQVVNQSLLCVS  618



>ref|XP_009367695.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=642

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  LAACDVA+FVH SS E SWKR+ ELLV+VA  GE +G+ +P L+
Sbjct  478  EIPEDDVKTHLSDKTFLAACDVAVFVHSSSSEHSWKRSRELLVEVAKQGEESGFGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL  Y   ++DS  +S ++GIEAP+ +S KL  ++++F +IVN AE PHLSIPET
Sbjct  538  IAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSMKLSTMNDVFYKIVNVAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA ++RK+Y ++VN+SL+ VS
Sbjct  598  EARRNRKKYLQVVNQSLLCVS  618



>ref|XP_003536499.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Glycine 
max]
Length=650

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDG+ + LS++D LAACDVA+FV+DSS E SWK++ +LL  V   GE TGY  P L+
Sbjct  486  EIPEDGLLQFLSNQDCLAACDVAVFVYDSSDEYSWKKSRDLLEKVVRQGELTGYRTPCLL  545

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL P    + DS +V+Q +GI+API +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  546  IAAKDDLAPVPRTVLDSVKVTQALGIKAPIHVSMKLGDSSNVYNKIVNAAEHPHLSIPET  605

Query  367  EAGKSRKQYHRLVNRSLMF  311
            E  + +KQ+++L++ SL+F
Sbjct  606  ETARRKKQHNQLLHHSLIF  624



>ref|XP_009355477.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=642

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  LAACDVA+FVH SS E SWKR+ ELLV+VA  GE +G+ +P L+
Sbjct  478  EIPEDEVKTHLSDKTFLAACDVAVFVHSSSSEHSWKRSRELLVEVAKQGEESGFGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL  Y   ++DS  +S ++GIEAP+ +S KL  ++++F +IVN AE PHLSIPET
Sbjct  538  IAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSMKLSTMNDVFYKIVNVAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA ++RK+Y ++VN+SL+ VS
Sbjct  598  EARRNRKKYLQVVNQSLLCVS  618



>ref|XP_009355476.1| PREDICTED: mitochondrial Rho GTPase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=649

 Score =   169 bits (429),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  LAACDVA+FVH SS E SWKR+ ELLV+VA  GE +G+ +P L+
Sbjct  478  EIPEDEVKTHLSDKTFLAACDVAVFVHSSSSEHSWKRSRELLVEVAKQGEESGFGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL  Y   ++DS  +S ++GIEAP+ +S KL  ++++F +IVN AE PHLSIPET
Sbjct  538  IAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSMKLSTMNDVFYKIVNVAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA ++RK+Y ++VN+SL+ VS
Sbjct  598  EARRNRKKYLQVVNQSLLCVS  618



>ref|XP_008386506.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=642

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPED VK  LS K  LAACDVA+FVH SS E SWKR+ ELLV+VA  GE +G+ +P L+
Sbjct  478  EIPEDEVKTHLSDKTFLAACDVAVFVHASSSEHSWKRSRELLVEVAKQGEESGFGVPCLL  537

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAKDDL  Y   ++DS  +S ++GIEAP+ +S KL  ++++F +IVN AE PHLSIPET
Sbjct  538  VAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSMKLSTMNDVFYKIVNVAEHPHLSIPET  597

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA ++RK+Y ++VN+SL+ VS
Sbjct  598  EARRNRKKYLQVVNQSLLCVS  618



>gb|KHN03795.1| Mitochondrial Rho GTPase 1 [Glycine soja]
Length=735

 Score =   169 bits (429),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDG+ + LS++D LAACDVA+FV+DSS E SWK++ +LL  V   GE TGY  P L+
Sbjct  571  EIPEDGLLQFLSNQDCLAACDVAVFVYDSSDEYSWKKSRDLLEKVVRQGELTGYRTPCLL  630

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            +AAKDDL P    + DS +V+Q +GI+API +S KLGD SN++ +IVNAAE PHLSIPET
Sbjct  631  IAAKDDLAPVPRTVLDSVKVTQALGIKAPIHVSMKLGDSSNVYNKIVNAAEHPHLSIPET  690

Query  367  EAGKSRKQYHRLVNRSLMF  311
            E  + +KQ+++L++ SL+F
Sbjct  691  ETARRKKQHNQLLHHSLIF  709



>gb|AAL25592.1| AT3g63150/T20O10_250 [Arabidopsis thaliana]
 gb|AAM98282.1| At3g63150/T20O10_250 [Arabidopsis thaliana]
Length=643

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K++LAACDVA+ V+DSS   SW++A E+L++VA  GE  GY  P L
Sbjct  480  REIPEDRVKKFLTNKESLAACDVAVVVYDSSDVYSWRKAREILMEVARRGEERGYGTPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S KLG+ ++LF RIV+ AE PH+SIPE
Sbjct  540  LVAAKDDLDPYPMSVQESDRVCMELGIDIPVSLSMKLGEPNSLFSRIVSTAENPHMSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  +   +LVN SL+FVS
Sbjct  600  TESGRRSRNIRQLVNSSLLFVS  621



>ref|NP_567139.1| MIRO-related GTP-ase 2 [Arabidopsis thaliana]
 sp|F4J0W4.1|MIRO2_ARATH RecName: Full=Mitochondrial Rho GTPase 2; Short=AtMIRO2; AltName: 
Full=Calcium-binding GTPase; Short=AtCBG; AltName: Full=Miro-related 
GTPase 2 [Arabidopsis thaliana]
 gb|AEE80441.1| MIRO-related GTP-ase 2 [Arabidopsis thaliana]
Length=643

 Score =   168 bits (425),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K++LAACDVA+ V+DSS   SW++A E+L++VA  GE  GY  P L
Sbjct  480  REIPEDRVKKFLTNKESLAACDVAVVVYDSSDVYSWRKAREILMEVARRGEERGYGTPCL  539

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S KLG+ ++LF RIV+ AE PH+SIPE
Sbjct  540  LVAAKDDLDPYPMSVQESDRVCMELGIDIPVSLSMKLGEPNSLFSRIVSTAENPHMSIPE  599

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  +   +LVN SL+FVS
Sbjct  600  TESGRRSRNIRQLVNSSLLFVS  621



>ref|XP_010413192.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +G+  P L
Sbjct  482  REIPEERVKKFLTNKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGHGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S KLG+ ++LF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPMSVQESDRVCMELGIDVPVSLSMKLGEPNSLFSRIVSIAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   +LVN SL+FVS
Sbjct  602  TESGRRSKNIRQLVNSSLLFVS  623



>ref|XP_010552773.1| PREDICTED: mitochondrial Rho GTPase 1 [Tarenaya hassleriana]
Length=645

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VK+ L+++++LAACDVA+ V+DSS E SWK++ ++L++VA  GE +GY  P L
Sbjct  482  REIPEDRVKEFLANRESLAACDVAVIVYDSSDEYSWKKSRDILMEVARRGEESGYGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   ++DS     ++G++ PI +S KLGD ++LF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPLSVRDSDMACLELGMDVPISLSMKLGDPNSLFSRIVSTAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  KQ  ++VN SL+FVS
Sbjct  602  TESGRRSKQIRQIVNSSLIFVS  623



>ref|XP_010468881.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=645

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ VKK L++K++LAACDVA+ V+DSS   SWK+A E+L++VA  GE +G+  P L
Sbjct  482  REIPEERVKKFLTNKESLAACDVAVVVYDSSDVYSWKKAREILMEVARRGEESGHGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S +LG+ ++LF RIV+ AE PHLSIPE
Sbjct  542  LVAAKDDLDPYPMSVQESDRVCMELGIDVPVSLSMRLGEPNSLFSRIVSTAENPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   + VN SL+FVS
Sbjct  602  TESGRRSKNIRQFVNSSLLFVS  623



>ref|XP_006402304.1| hypothetical protein EUTSA_v10005831mg [Eutrema salsugineum]
 gb|ESQ43757.1| hypothetical protein EUTSA_v10005831mg [Eutrema salsugineum]
Length=645

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIP D VKK L++K+ LAACDVA+ V+DSS   SWK+A E+L++VA  GE +GY  P L
Sbjct  482  REIPADRVKKFLANKETLAACDVAVVVYDSSDVYSWKKAREILMEVARKGEESGYGTPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLD Y   +Q+S RV  ++GI+ P+ IS KLG+ ++LF RIV+ AE PH+S+PE
Sbjct  542  LVAAKDDLDAYPMSVQESDRVCMELGIDVPVSISMKLGETNSLFSRIVSTAENPHMSVPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   +LVN SL+FVS
Sbjct  602  TESGRRSKNIRQLVNSSLVFVS  623



>dbj|BAJ85941.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=599

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/120 (66%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V+ LL++K++LA CD A+FV+DS  E SW+RA +LLV VAS+GE TGYE+P L
Sbjct  477  REIPEGDVRSLLNNKESLAPCDAAVFVYDSCDEFSWQRARDLLVQVASHGENTGYEVPCL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+++F RIV+AA+RPHLSIP+
Sbjct  537  IVAAKDDLDQSPVALQESTRVSQDMGIETPIPISVKLKDLNSIFCRIVHAAQRPHLSIPD  596



>ref|XP_002882407.1| hypothetical protein ARALYDRAFT_477819 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58666.1| hypothetical protein ARALYDRAFT_477819 [Arabidopsis lyrata subsp. 
lyrata]
Length=647

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -1

Query  724  IPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIV  545
            I EDG   +LS+K ALAACDVAIF++DSS E+SW RA +LL +VA+ G+  GY  P L+V
Sbjct  491  IQEDGF--MLSNK-ALAACDVAIFIYDSSDESSWNRAIDLLAEVATIGKDAGYVFPCLMV  547

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAK DLDP+   IQ+STRV+QD+GI+APIPIS+KLGD  NLF++I+ AAE PHL+IP  E
Sbjct  548  AAKTDLDPFPMAIQESTRVTQDIGIDAPIPISSKLGDFGNLFRKILTAAEHPHLNIPAIE  607

Query  364  AGKSRKQYHRLVNRSLMFVS  305
            + K R    +L+NRSLM VS
Sbjct  608  SKKKRS--CKLINRSLMAVS  625



>ref|NP_187182.1| MIRO-related GTP-ase 3 [Arabidopsis thaliana]
 sp|Q9MA88.1|MIRO3_ARATH RecName: Full=Mitochondrial Rho GTPase 3; Short=AtMIRO3; AltName: 
Full=Miro-related GTPase 3 [Arabidopsis thaliana]
 gb|AAF27037.1|AC009177_27 unknown protein [Arabidopsis thaliana]
 gb|AEE74218.1| MIRO-related GTP-ase 3 [Arabidopsis thaliana]
Length=648

 Score =   164 bits (415),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = -1

Query  724  IPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIV  545
            I +DG    + SK+ALAACDVAIF++DSS E SW RA ++L +VA+  + +GY  P L+V
Sbjct  492  IKDDG---FMLSKEALAACDVAIFIYDSSDEYSWNRAVDMLAEVATIAKDSGYVFPCLMV  548

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAK DLDP+   IQ+STRV+QD+GI+APIPIS+KLGD+SNLF++I+ AAE PHL+IPE E
Sbjct  549  AAKTDLDPFPVAIQESTRVTQDIGIDAPIPISSKLGDVSNLFRKILTAAENPHLNIPEIE  608

Query  364  AGKSRKQYHRLVNRSLMFVS  305
            + K R    +L NRSLM VS
Sbjct  609  SKKKRS--CKLNNRSLMAVS  626



>gb|EMS67255.1| Mitochondrial Rho GTPase 1 [Triticum urartu]
Length=623

 Score =   164 bits (414),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 14/137 (10%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDS--------------SREASWKRASELLVDV  593
             EIPE  V+ LL++K++LA CDVA+FV+DS                E SW+RA +LLV V
Sbjct  451  REIPEGDVRSLLNNKESLAPCDVAVFVYDSYTIAYWPYQINDSCCDEFSWQRARDLLVQV  510

Query  592  ASYGEATGYEIPSLIVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQR  413
            AS+GE TGYE+P LIVAAKDDLD     +Q+STRVSQDMGIE PIPIS KL DL+++F R
Sbjct  511  ASHGENTGYEVPCLIVAAKDDLDQSPVALQESTRVSQDMGIETPIPISVKLKDLNSIFCR  570

Query  412  IVNAAERPHLSIPETEA  362
            IV+AA+RPHLSIPETEA
Sbjct  571  IVHAAQRPHLSIPETEA  587



>gb|AES96178.2| Rho GTPase [Medicago truncatula]
Length=517

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 108/141 (77%), Gaps = 4/141 (3%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV +LL++K++LA+CD+     ++SR+AS    SELL+ +A +GE TG+++P LI
Sbjct  322  EISECGVTELLANKESLASCDMQFLSDETSRKAS----SELLLKIARHGEDTGFQVPCLI  377

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            V AKDD D +   IQ++T +SQ++G+EAPIP+  KLGD +N+F RIV AAE+PHLSIP+T
Sbjct  378  VVAKDDQDSFTMAIQEATMLSQNIGVEAPIPVGVKLGDSNNIFHRIVTAAEQPHLSIPKT  437

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA  + KQYHRL+ RSLM+ S
Sbjct  438  EAETTCKQYHRLIGRSLMYAS  458



>ref|XP_003571671.1| PREDICTED: mitochondrial Rho GTPase 1-like [Brachypodium distachyon]
Length=635

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 110/139 (79%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  +  LLS K++LA CDVA FV+DSS E SW++A E+LV VA++GE TGY +P L
Sbjct  471  REIPEVDISSLLSKKESLAPCDVAAFVYDSSDELSWQKAKEMLVQVATHGENTGYSVPCL  530

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVA KDDL      +Q+S RVSQDMG+E PIPIS KL  L+ +F RIV+AA++PHLSIPE
Sbjct  531  IVACKDDLARSPLALQESIRVSQDMGMETPIPISVKLDGLNYIFCRIVHAAQKPHLSIPE  590

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TEAGK+R++Y+RL+NRSLM
Sbjct  591  TEAGKARRRYNRLLNRSLM  609



>gb|EYU46588.1| hypothetical protein MIMGU_mgv1a002738mg [Erythranthe guttata]
Length=642

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV+KLLS K++LAA DVA+FV+DSS E S K A ELL +VA  GE TG  +P L
Sbjct  477  REIPEDGVQKLLSDKESLAASDVAVFVYDSSSEHSLKAAIELLSNVARQGEETGVGMPCL  536

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAK+DLD   T  +DS ++  DM ++APIP+S K  DL+++F RIVNAAERPHLSIPE
Sbjct  537  LIAAKNDLDSNSTVNKDSAKICLDMRMDAPIPVSVKERDLNDVFSRIVNAAERPHLSIPE  596

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T+  +SRK+Y ++V+ + M +S
Sbjct  597  TDLSRSRKRYRQIVSNTFMCLS  618



>gb|KEH32396.1| Rho GTPase, putative [Medicago truncatula]
Length=181

 Score =   152 bits (384),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/157 (51%), Positives = 109/157 (69%), Gaps = 24/157 (15%)
 Frame = -1

Query  706  KKLLSSKDALAACDVAIFVHDS------SREASWKRASELLVDVASYGEATGYEIPSLIV  545
            ++LL++K++LA+CD+AIFVHD       S E+SWK +S+LLV++A +GE TG+++P LIV
Sbjct  6    RELLANKESLASCDIAIFVHDKQELIFKSNESSWKASSKLLVEIARHGEHTGFKVPCLIV  65

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAKDD   +   +Q+STR S+     + IPIS  LG+L++LF RIV AAE PHLSIP+TE
Sbjct  66   AAKDDQYSFPMAVQESTR-SEHGSRGSYIPISAMLGNLNSLFHRIVTAAEHPHLSIPKTE  124

Query  364  AGKSRKQ-----------------YHRLVNRSLMFVS  305
             GK+RKQ                 YHRLVN++LMFVS
Sbjct  125  VGKNRKQYHRLHVPETEDENQRKLYHRLVNQTLMFVS  161



>ref|XP_003613220.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=514

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 106/141 (75%), Gaps = 7/141 (5%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E GV +LL++K++LA+CD+       S E S K +SELL+ +A +GE TG+++P LI
Sbjct  322  EISECGVTELLANKESLASCDM-------SDETSRKASSELLLKIARHGEDTGFQVPCLI  374

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            V AKDD D +   IQ++T +SQ++G+EAPIP+  KLGD +N+F RIV AAE+PHLSIP+T
Sbjct  375  VVAKDDQDSFTMAIQEATMLSQNIGVEAPIPVGVKLGDSNNIFHRIVTAAEQPHLSIPKT  434

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            EA  + KQYHRL+ RSLM+ S
Sbjct  435  EAETTCKQYHRLIGRSLMYAS  455



>ref|XP_006298991.1| hypothetical protein CARUB_v10015117mg [Capsella rubella]
 gb|EOA31889.1| hypothetical protein CARUB_v10015117mg [Capsella rubella]
Length=648

 Score =   159 bits (401),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 106/140 (76%), Gaps = 5/140 (4%)
 Frame = -1

Query  724  IPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIV  545
            I EDG    + S +ALAACDVAIF++DSS E+SW RA +LL +VA+  +  GY  P L+V
Sbjct  492  IQEDGS---MLSNEALAACDVAIFIYDSSDESSWNRAIDLLAEVATIAKDAGYVFPCLMV  548

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAK DLD +   IQ+STRV+QD+G++APIPIS+KLGD  NLF++I+ AAE PHL+IPE E
Sbjct  549  AAKSDLDSFEMAIQESTRVTQDIGLDAPIPISSKLGDFGNLFRKILTAAEHPHLNIPEIE  608

Query  364  AGKSRKQYHRLVNRSLMFVS  305
            + K  K+  +L+N+SLM VS
Sbjct  609  SKK--KKSRKLINKSLMAVS  626



>ref|XP_009138638.1| PREDICTED: mitochondrial Rho GTPase 1 [Brassica rapa]
Length=645

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K+ALAACDVA+ V+DSS   SW++A E+L++VA  GE +GY  P +
Sbjct  482  REIPEDRVKKFLANKEALAACDVAVVVYDSSDVYSWRKAREMLMEVARKGEESGYGTPCV  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLD Y   +Q+S RV  ++GI+ P+ +S K  + ++LF++IV+ AE PH+S+PE
Sbjct  542  LVAAKDDLDAYPMSVQESDRVCMELGIDIPVSVSMKDDERNSLFRKIVSTAENPHMSVPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   ++VN SL+FVS
Sbjct  602  TESGRRSKNIRQVVNSSLLFVS  623



>emb|CDX89176.1| BnaA04g00100D [Brassica napus]
Length=645

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K+ALAACDVA+ V+DSS   SW++A E+L++VA  GE +GY  P +
Sbjct  482  REIPEDRVKKFLANKEALAACDVAVVVYDSSDVYSWRKAREMLMEVARKGEESGYGTPCV  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLD Y   +Q+S RV  ++GI+ P+ +S K  + ++LF++IV+ AE PH+S+PE
Sbjct  542  LVAAKDDLDAYPMSVQESDRVCMELGIDIPVSVSMKDDERNSLFRKIVSTAENPHMSVPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   ++VN SL+FVS
Sbjct  602  TESGRRSKNIRQVVNSSLLFVS  623



>emb|CDX93929.1| BnaC04g20880D [Brassica napus]
Length=645

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K+ALAACDVA+ V+DSS   SW++A E+L++VA  GE +GY  P +
Sbjct  482  REIPEDRVKKFLANKEALAACDVAVVVYDSSDVYSWRKAREMLMEVARKGEESGYGTPCV  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLD Y   +Q+S RV  ++GI+ P+ +S K  + ++LF++IV+ AE PH+S+PE
Sbjct  542  LVAAKDDLDAYPMSVQESDRVCMELGIDIPVSVSMKDDERNSLFRKIVSTAENPHMSVPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  K   ++VN SL+FVS
Sbjct  602  TESGRRSKNIRQVVNSSLLFVS  623



>ref|XP_001779282.1| predicted protein [Physcomitrella patens]
 gb|EDQ55884.1| predicted protein [Physcomitrella patens]
Length=650

 Score =   155 bits (392),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 99/139 (71%), Gaps = 0/139 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI ED V   L +K+ALA C+VA FV+D   E S KRA+ELL  VA +GE  GYE+P +
Sbjct  478  REISEDSVSAFLENKEALAPCNVAAFVYDRCVEESLKRAAELLEQVAVHGECFGYEVPCV  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDD +   + I +S R+   MG+E PIP+S KLGD +NLF+RIV AA+RPHLSIPE
Sbjct  538  LIAAKDDEESNPSCITNSARICTTMGLETPIPVSLKLGDNNNLFRRIVEAAQRPHLSIPE  597

Query  370  TEAGKSRKQYHRLVNRSLM  314
            TE GKS KQ+   + RS++
Sbjct  598  TEVGKSTKQHRHQIQRSVV  616



>ref|XP_001778992.1| predicted protein [Physcomitrella patens]
 gb|EDQ56138.1| predicted protein [Physcomitrella patens]
Length=622

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 98/137 (72%), Gaps = 0/137 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EI E+ V  L   K AL++CDVA FV+D +   SWKRA ELLV V ++ E TGYEIP +I
Sbjct  479  EIIEESVSSLFEKKHALSSCDVAAFVYDCADAQSWKRAYELLVQVIAHQEITGYEIPCMI  538

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            ++AKDDL+   +  + STRV  DMG+EA I +STKLGD+ NLFQ+IV+AA+ PH SIP+T
Sbjct  539  ISAKDDLESVPSCTKGSTRVCTDMGLEATISVSTKLGDVGNLFQKIVDAAQHPHRSIPKT  598

Query  367  EAGKSRKQYHRLVNRSL  317
            EAG+  K Y  L+  SL
Sbjct  599  EAGRKFKHYRCLIQWSL  615



>ref|XP_010425682.1| PREDICTED: mitochondrial Rho GTPase 1 [Camelina sativa]
Length=649

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 105/140 (75%), Gaps = 4/140 (3%)
 Frame = -1

Query  724  IPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIV  545
            I EDG    + S +ALAACDVAIF++DSS E+SW RA +LL +VA+  +  GY  P L+V
Sbjct  492  IQEDGS---MLSTEALAACDVAIFIYDSSDESSWNRAIDLLAEVATSAKDAGYVFPCLMV  548

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAK DLD +   IQ++TRV+QD+GI+APIPIS+KLGD  NLF++I+ AAE PHL+IPE E
Sbjct  549  AAKTDLDSFPMAIQETTRVTQDIGIDAPIPISSKLGDFDNLFRKILTAAEHPHLNIPEIE  608

Query  364  AGKSRKQYHRLVNRSLMFVS  305
            + K +K    ++N+SL+ VS
Sbjct  609  S-KKKKSRKLIINKSLLAVS  627



>emb|CAB87760.1| rac-GTP binding protein-like [Arabidopsis thaliana]
Length=676

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 104/142 (73%), Gaps = 7/142 (5%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED VKK L++K++LAACDVA+ V+D       ++A E+L++VA  GE  GY  P L
Sbjct  520  REIPEDRVKKFLTNKESLAACDVAVVVYD-------RKAREILMEVARRGEERGYGTPCL  572

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +VAAKDDLDPY   +Q+S RV  ++GI+ P+ +S KLG+ ++LF RIV+ AE PH+SIPE
Sbjct  573  LVAAKDDLDPYPMSVQESDRVCMELGIDIPVSLSMKLGEPNSLFSRIVSTAENPHMSIPE  632

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            TE+G+  +   +LVN SL+FVS
Sbjct  633  TESGRRSRNIRQLVNSSLLFVS  654



>ref|XP_010464053.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=650

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 77/141 (55%), Positives = 104/141 (74%), Gaps = 4/141 (3%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            +I EDG    +   +ALAACDVAIF++DSS E+SW R  +LL DVA+  +  GY  P L+
Sbjct  492  QIQEDGS---MLPNEALAACDVAIFIYDSSDESSWNRTIDLLADVATTAKDAGYVFPCLM  548

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAK DLD +   IQ++TRV+QD+GI+APIPIS+KLGD  NLF++I+ AAE PHL+IPE 
Sbjct  549  VAAKTDLDSFPMAIQETTRVTQDIGIDAPIPISSKLGDFDNLFRKILTAAEHPHLNIPEI  608

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            E+ K +K    ++N+SL+ VS
Sbjct  609  ES-KKKKSRKLIINKSLLAVS  628



>ref|XP_003590652.1| Mitochondrial Rho GTPase [Medicago truncatula]
 gb|AES60903.1| Rho GTPase [Medicago truncatula]
Length=640

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED V   LS+KD LAACDVA FVHDSS   SWKR+ +LL  V + GE TG+  PSL
Sbjct  478  REIPEDEVSNFLSNKDCLAACDVAAFVHDSSDGYSWKRSIDLLEKVVNQGELTGHRFPSL  537

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL P+   + DS +V+Q++ I+API +S K  D +N++ +I+NAAE PHLSIPE
Sbjct  538  LIAAKDDLTPFPRAVLDSVKVAQELKIDAPIRLSIKSDDSNNVYSKIINAAEHPHLSIPE  597

Query  370  TEAGKSRKQYHRLVN  326
            TE  + RKQ+ +L++
Sbjct  598  TEFVRKRKQHQQLLH  612



>ref|XP_006408091.1| hypothetical protein EUTSA_v10020270mg [Eutrema salsugineum]
 gb|ESQ49544.1| hypothetical protein EUTSA_v10020270mg [Eutrema salsugineum]
Length=644

 Score =   153 bits (387),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 5/138 (4%)
 Frame = -1

Query  718  EDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAA  539
            EDG    L S ++LAACDVAIFV+DSS E+SWKRA +LL +VA+  +  G+E P L+VAA
Sbjct  490  EDG---FLLSDESLAACDVAIFVYDSSDESSWKRAIDLLAEVAATSKDAGFEFPCLMVAA  546

Query  538  KDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAG  359
            K DLD +   IQ+STRV+QD+GIEAPIPIS+KL D  NLF +I+ +AE PHL IP  ++ 
Sbjct  547  KTDLDSFPMAIQESTRVAQDIGIEAPIPISSKLRDFDNLFLKILTSAEHPHLGIPAIKSK  606

Query  358  KSRKQYHRLVNRSLMFVS  305
            K R    +L+NRSLM +S
Sbjct  607  KKRS--FKLINRSLMAIS  622



>ref|XP_003610221.1| Mitochondrial Rho GTPase [Medicago truncatula]
Length=635

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 102/140 (73%), Gaps = 8/140 (6%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV++LL++  +LA+CDVA+FVHD S       +SELLV++A +GE  G+E+P L
Sbjct  482  REIPEDGVRELLANNKSLASCDVAVFVHDRS-------SSELLVEIARHGEDNGFEVPCL  534

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            IVAAKD+ D +    Q+ TRVS+D+G+EAPIPIS  LG L+ LF+RIV A   P LSIP 
Sbjct  535  IVAAKDEQDSFPMATQELTRVSRDLGVEAPIPISVMLGSLNGLFRRIVTAPC-PPLSIPV  593

Query  370  TEAGKSRKQYHRLVNRSLMF  311
            TEAG S K Y RL+N  L+F
Sbjct  594  TEAGNSCKLYDRLINDPLLF  613



>ref|XP_004495205.1| PREDICTED: mitochondrial Rho GTPase 1-like [Cicer arietinum]
Length=643

 Score =   151 bits (382),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPED V   LS++D LAACDVA+FVHDSS   SWK++ +LL  V  +GE TG+++P L
Sbjct  481  REIPEDEVSSFLSNRDCLAACDVAVFVHDSSDGYSWKKSIDLLEQVVDHGERTGHKVPCL  540

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAKDDL  +   + DS +V+Q++ I+API +S K GD + L+ RIVNAAE PHLS+PE
Sbjct  541  LIAAKDDLTLFPRTVLDSVKVAQELKIDAPIRLSVKSGDSNALYSRIVNAAEHPHLSLPE  600

Query  370  TEAGKSRKQYHRLVN  326
            TE  K RKQ  +L++
Sbjct  601  TEFVKKRKQNQQLMH  615



>ref|XP_006841411.1| hypothetical protein AMTR_s00003p00022810 [Amborella trichopoda]
 gb|ERN03086.1| hypothetical protein AMTR_s00003p00022810 [Amborella trichopoda]
Length=157

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = -1

Query  643  SSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLTEIQDSTRVSQDMGIEA  464
            SS E+SWKRA+ELLV+VA++GE TGY+IP LIVAAKDDLDPY   I DSTRVSQDMGIEA
Sbjct  68   SSDESSWKRATELLVEVATHGEVTGYDIPCLIVAAKDDLDPYPLAISDSTRVSQDMGIEA  127

Query  463  PIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
            PI +S +LGD++NLF+RI+NA + PHLSIP
Sbjct  128  PITVSMRLGDVNNLFRRIINAVQHPHLSIP  157



>emb|CDY40707.1| BnaC03g34230D [Brassica napus]
Length=666

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            ++ EDG    L S +AL ACDVAIF++DSS E+SWKRA +LLV VA+  E  G E P L+
Sbjct  509  QMQEDG---FLPSNEALGACDVAIFLYDSSDESSWKRAIDLLVKVATTSEDAGLEFPCLM  565

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAK DLD +   IQ++TR +QD+GIEAPIPIS+KLGDL NLFQ+I  AAE PHL IP+ 
Sbjct  566  VAAKTDLDSFPEAIQETTRATQDIGIEAPIPISSKLGDLDNLFQKISTAAEHPHLGIPKI  625

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            ++   +K+  +L+ RSLM VS
Sbjct  626  KS--KKKRSRKLMKRSLMVVS  644



>emb|CDX74148.1| BnaA03g28990D [Brassica napus]
Length=346

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            ++ EDG    L S +AL ACDVAIF++DSS E+SWKRA +LLV VA+  E  G E P L+
Sbjct  189  QMQEDG---FLPSNEALGACDVAIFLYDSSDESSWKRAIDLLVKVATTSEDAGLEFPCLM  245

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAK DLD +   IQ++TR +Q++ IEAPIPIS+KLGDL NLFQ+I+ AAE PHL IP+ 
Sbjct  246  VAAKTDLDSFPEAIQEATRATQEIRIEAPIPISSKLGDLDNLFQKILTAAEHPHLGIPKI  305

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            ++   +K+  +L+ RSLM VS
Sbjct  306  KS--KKKRSRKLMKRSLMVVS  324



>ref|XP_009134822.1| PREDICTED: mitochondrial Rho GTPase 2 [Brassica rapa]
Length=647

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 105/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            ++ EDG    LSS +AL ACDVAIF++DSS E+SWK+A +LLV VA+  E  G + P L+
Sbjct  490  QMQEDG---FLSSNEALGACDVAIFLYDSSDESSWKKAIDLLVKVATASEDAGLKFPCLM  546

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAK DLD +   IQ++TR +QD+GIEAPIPIS+KLGD  NLFQ+I+ AAE PHL IP+ 
Sbjct  547  VAAKTDLDSFPEAIQEATRATQDLGIEAPIPISSKLGDCDNLFQKILTAAEHPHLGIPKI  606

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            ++ K R +  +L+ RSLM VS
Sbjct  607  KSKKKRSR--KLMKRSLMLVS  625



>ref|XP_001767645.1| predicted protein [Physcomitrella patens]
 gb|EDQ67604.1| predicted protein [Physcomitrella patens]
Length=648

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EI E  V   L  K+ALA C+VA FV+DSS E S KRA+ELL  VA   E +GYE+P L
Sbjct  482  REINEASVSAFLEDKEALAPCNVAAFVYDSSSEESLKRAAELLEQVAVSSECSGYEVPCL  541

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            ++AAK+D +   + I  S R+   MG+E P P+S KLGD +NLF RIV AA+ PHLSIPE
Sbjct  542  LLAAKNDEESNPSCITRSARICSTMGLETPTPVSMKLGDNNNLFLRIVEAAQHPHLSIPE  601

Query  370  TEAGKSRKQYHRLVNRSLMFV  308
            TE GKS KQ+ +L+ +S+ FV
Sbjct  602  TELGKSTKQHRQLIQQSVGFV  622



>ref|XP_010485971.1| PREDICTED: mitochondrial Rho GTPase 1-like [Camelina sativa]
Length=649

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 101/140 (72%), Gaps = 4/140 (3%)
 Frame = -1

Query  724  IPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIV  545
            I EDG    + S + LA CDVAIF++DSS E+SW R  +LL + A+  + +GY  P L+V
Sbjct  492  IQEDGS---MLSNEPLAGCDVAIFIYDSSDESSWNRTIDLLAEAATTAKDSGYVFPCLMV  548

Query  544  AAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            AAK DLD +   IQ++TRV+QD+G++APIPIS+KLGD  NLF++I+ AAE PHL+IPE E
Sbjct  549  AAKTDLDSFPMAIQETTRVTQDIGLDAPIPISSKLGDFDNLFRKILTAAEHPHLNIPEIE  608

Query  364  AGKSRKQYHRLVNRSLMFVS  305
            + K +K    +V +SL+ VS
Sbjct  609  S-KKKKSRKLIVKKSLLAVS  627



>emb|CDY66986.1| BnaAnng23350D [Brassica napus]
Length=643

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            ++ EDG    L S +AL ACDVAIF++DSS E+SWKRA +LLV VA+  E  G E P L+
Sbjct  486  QMQEDG---FLPSNEALGACDVAIFLYDSSDESSWKRAIDLLVKVATTSEDAGLEFPCLM  542

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPET  368
            VAAK DLD +   IQ++TR +Q++ IEAPIPIS+KLGDL NLFQ+I+ AAE PHL IP+ 
Sbjct  543  VAAKTDLDSFPEAIQEATRATQEIRIEAPIPISSKLGDLDNLFQKILTAAEHPHLGIPKI  602

Query  367  EAGKSRKQYHRLVNRSLMFVS  305
            ++   +K+  +L+ RSLM VS
Sbjct  603  KS--KKKRSRKLMKRSLMVVS  621



>gb|EPS67784.1| hypothetical protein M569_06990, partial [Genlisea aurea]
Length=284

 Score =   140 bits (354),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGVKKLLS K++LAACDV++FV+DSS   S+ RA ELL +VA  GE T Y +P L+
Sbjct  119  EIPEDGVKKLLSDKESLAACDVSVFVYDSSDSDSFHRAIELLSNVARLGEETVYGMPCLL  178

Query  547  VAAKDDLDPYLTEIQDST-RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
            +AAK DL+     I+D+   +  DM ++AP+P+S K G+  ++F +IV AAE PH SIPE
Sbjct  179  IAAKYDLNSKPVNIKDAAEEICLDMNVDAPVPMSAKEGNPDDVFLKIVEAAEHPHRSIPE  238

Query  370  TEAGKSRKQYHRLVNRSLMFVS  305
            T+AG+  K+  R V   L+ +S
Sbjct  239  TQAGRDGKRNRRRVYNGLLSIS  260



>gb|KFK37959.1| hypothetical protein AALP_AA3G052000 [Arabis alpina]
Length=348

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = -1

Query  700  LLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDP  521
             + S +ALA+CDVAIFV+DSS E+SWKRA +LL +VA+  +  G++ P L+VA+K DLDP
Sbjct  199  FILSNEALASCDVAIFVYDSSDESSWKRAIDLLAEVATTSKDAGFKFPCLMVASKTDLDP  258

Query  520  YLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQY  341
            +    ++STRV++++GIE PI IS+KLG+   LF+ I+ AAE PH+SIP  E+ K R+  
Sbjct  259  FPMANEESTRVTEEIGIEDPIQISSKLGEFGKLFEIILAAAEHPHMSIPNIESEKKRR--  316

Query  340  HRLVNRSLMFV  308
             +L+ +SLM V
Sbjct  317  CKLIKKSLMIV  327



>ref|XP_009124073.1| PREDICTED: mitochondrial Rho GTPase 2-like [Brassica rapa]
Length=635

 Score =   140 bits (354),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = -1

Query  718  EDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAA  539
            EDG    L S +ALA+CDVA+FV+DSS E+SWKRA  ++ +VA+  E  G+  P L+VAA
Sbjct  495  EDG---FLLSDEALASCDVAVFVYDSSDESSWKRAIYMVSEVATISEDAGFVFPCLMVAA  551

Query  538  KDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAG  359
            K DLD +   IQ+STR +Q++GIEAPIPIS+KLG++ NLF +I+ AAE PHL IP+ E+ 
Sbjct  552  KMDLDSFPMAIQESTRATQEIGIEAPIPISSKLGNVDNLFHKILTAAEHPHLCIPKIES-  610

Query  358  KSRKQYHRLVN  326
              RK+  +L+N
Sbjct  611  -KRKRVLKLIN  620



>ref|XP_008350070.1| PREDICTED: uncharacterized protein LOC103413383 [Malus domestica]
Length=146

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = -1

Query  625  WKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPIST  446
            WKR+ ELLV+VA  GE +G+ +P L+VAAKDDL  Y   ++DS  +S ++GIEAP+ +S 
Sbjct  16   WKRSRELLVEVAKQGEESGFGVPCLLVAAKDDLGAYPMAVRDSVAISHELGIEAPVRVSM  75

Query  445  KLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLMFVS  305
            KL  ++++F +IVN AE PHLSIPETEA ++RK+Y ++VN+SL+ VS
Sbjct  76   KLSTMNDVFYKIVNVAEHPHLSIPETEARRNRKKYLQVVNQSLLCVS  122



>gb|KDO56331.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
Length=430

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLV+VASYGE TG+E+P L
Sbjct  340  REIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCL  399

Query  550  IVAAKDDLDPYLTEIQDSTRV  488
            IVAAKDDLD +   IQDSTRV
Sbjct  400  IVAAKDDLDSFAMAIQDSTRV  420



>gb|AES92418.2| Rho GTPase [Medicago truncatula]
Length=613

 Score =   129 bits (323),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 85/111 (77%), Gaps = 7/111 (6%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            EIPEDGV++LL++  +LA+CDVA+FVHD S       +SELLV++A +GE  G+E+P LI
Sbjct  507  EIPEDGVRELLANNKSLASCDVAVFVHDRS-------SSELLVEIARHGEDNGFEVPCLI  559

Query  547  VAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAE  395
            VAAKD+ D +    Q+ TRVS+D+G+EAPIPIS  LG L+ LF+RIV AA+
Sbjct  560  VAAKDEQDSFPMATQELTRVSRDLGVEAPIPISVMLGSLNGLFRRIVTAAD  610



>ref|XP_010094555.1| Mitochondrial Rho GTPase 2 [Morus notabilis]
 gb|EXB56309.1| Mitochondrial Rho GTPase 2 [Morus notabilis]
Length=600

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = -1

Query  643  SSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLTEIQD-STRVSQDMGIE  467
            SS E+SWKRA++LLV+V+S+GE TG+++P LIVAAK D   +   IQ  STRVSQ +G+E
Sbjct  446  SSDESSWKRATKLLVEVSSHGEDTGFKVPFLIVAAKYDSVSFGLAIQHHSTRVSQYLGVE  505

Query  466  APIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHR  335
            APIPI  KLGDL+N+F +I++ AE PHLSIP+TEA ++RKQY R
Sbjct  506  APIPICAKLGDLNNVFYKIISTAEHPHLSIPKTEAVRTRKQYDR  549



>gb|KDO56330.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
Length=514

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLV+VASYGE TG+E+P L
Sbjct  424  REIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCL  483

Query  550  IVAAKDDLDPYLTEIQDSTRV  488
            IVAAKDDLD +   IQDSTRV
Sbjct  484  IVAAKDDLDSFAMAIQDSTRV  504



>gb|KDO56328.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
 gb|KDO56329.1| hypothetical protein CISIN_1g008223mg [Citrus sinensis]
Length=573

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE+ V KLLS+KD+LAACD+A+FVHDSS E+SWKRA+ELLV+VASYGE TG+E+P L
Sbjct  483  REIPEEAVAKLLSNKDSLAACDIAVFVHDSSDESSWKRATELLVEVASYGEDTGFEVPCL  542

Query  550  IVAAKDDLDPYLTEIQDSTRV  488
            IVAAKDDLD +   IQDSTRV
Sbjct  543  IVAAKDDLDSFAMAIQDSTRV  563



>gb|KJB26438.1| hypothetical protein B456_004G241600 [Gossypium raimondii]
Length=568

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 71/82 (87%), Gaps = 0/82 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPEDGV KLLSSK++LA CD+A+FV+DSS E+SWKRA+ELL+DVA +GE TGYE+P L
Sbjct  479  REIPEDGVSKLLSSKESLAPCDIAVFVYDSSDESSWKRATELLMDVAGHGEDTGYEVPCL  538

Query  550  IVAAKDDLDPYLTEIQDSTRVS  485
            IVAAKDDLD +   IQ+STRVS
Sbjct  539  IVAAKDDLDSFPMAIQNSTRVS  560



>gb|KJB41366.1| hypothetical protein B456_007G101100 [Gossypium raimondii]
Length=82

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -1

Query  478  MGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLMFVS  305
            MGIEAPIPIS+KL D +N+F+RIVNAAE P LSIPETEAG+SRKQYHRL+NRSLM VS
Sbjct  1    MGIEAPIPISSKLSDFNNIFRRIVNAAEHPRLSIPETEAGRSRKQYHRLINRSLMVVS  58



>gb|KEH23752.1| Rho GTPase [Medicago truncatula]
Length=567

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V K LS++D LAACDVAIFV+DSS E SWK++ +LL  VA  G+ TGY +P L
Sbjct  478  REIPESEVSKFLSNQDYLAACDVAIFVYDSSDEYSWKKSRDLLEKVAGQGDLTGYRVPCL  537

Query  550  IVAAKDDLDPYLTEIQDSTRV  488
            ++AAKDDL PY   +QDS +V
Sbjct  538  LIAAKDDLTPYPRAVQDSVKV  558



>gb|KEH23753.1| Rho GTPase [Medicago truncatula]
Length=563

 Score =   101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSL  551
             EIPE  V K LS++D LAACDVAIFV+DSS E SWK++ +LL  VA  G+ TGY +P L
Sbjct  474  REIPESEVSKFLSNQDYLAACDVAIFVYDSSDEYSWKKSRDLLEKVAGQGDLTGYRVPCL  533

Query  550  IVAAKDDLDPYLTEIQDSTRV  488
            ++AAKDDL PY   +QDS +V
Sbjct  534  LIAAKDDLTPYPRAVQDSVKV  554



>gb|KGN57777.1| hypothetical protein Csa_3G298060 [Cucumis sativus]
Length=96

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLM  314
            R  QDMGIE  I ISTKLGD +N+ +RI +A E PHLSIPE EAG+SRK YH+L N SLM
Sbjct  4    RKCQDMGIEPTILISTKLGDFNNVCRRITSAIEHPHLSIPENEAGRSRKHYHKLKNHSLM  63

Query  313  FVS  305
            FVS
Sbjct  64   FVS  66



>ref|XP_004145864.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Cucumis 
sativus]
Length=140

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLM  314
            R  QDMGIE  I ISTKLGD +N+ +RI +A E PHLSIPE EAG+SRK YH+L N SLM
Sbjct  4    RKCQDMGIEPTILISTKLGDFNNVCRRITSAIEHPHLSIPENEAGRSRKHYHKLKNHSLM  63

Query  313  FVS  305
            FVS
Sbjct  64   FVS  66



>ref|XP_004513893.1| PREDICTED: uncharacterized protein LOC101499029 isoform X1 [Cicer 
arietinum]
 ref|XP_004513894.1| PREDICTED: uncharacterized protein LOC101499029 isoform X2 [Cicer 
arietinum]
Length=135

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = -1

Query  550  IVAAKDDLDPYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPE  371
             + AKDDL PY   +QDS +V+Q++GI+A I +S KLGD SN++ +IV  A+  H SIPE
Sbjct  44   FLTAKDDLTPYPRVVQDSVKVNQELGIKASIHVSMKLGDSSNVYNKIVMTAKHSHFSIPE  103

Query  370  TEAGKSRKQYHRLVN  326
             E  K RKQYH+L+ 
Sbjct  104  LEFWKKRKQYHQLLQ  118



>gb|AFK36587.1| unknown [Lotus japonicus]
Length=181

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 50/64 (78%), Gaps = 0/64 (0%)
 Frame = -1

Query  727  EIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLI  548
            E+PE  V K+LS++D LAACDVA+FV+DSS E+SWK++ +LL  VA   + TG+ +P L+
Sbjct  116  EMPEGEVSKVLSNQDCLAACDVAVFVYDSSDESSWKKSRDLLEKVAMQRDLTGHRVPCLL  175

Query  547  VAAK  536
            +AAK
Sbjct  176  IAAK  179



>ref|XP_010098381.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
 gb|EXB74905.1| Mitochondrial Rho GTPase 1 [Morus notabilis]
Length=358

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  646  DSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLTEIQDSTRVS  485
            +SS E+S +RA+ELLV+V+S+GE TG+E+P L+VAAK DL  +   IQ STRV 
Sbjct  302  ESSDESSRRRATELLVEVSSHGEDTGFEVPCLVVAAKSDLVSFPLAIQHSTRVC  355



>ref|XP_005847786.1| hypothetical protein CHLNCDRAFT_133936 [Chlorella variabilis]
 gb|EFN55684.1| hypothetical protein CHLNCDRAFT_133936 [Chlorella variabilis]
Length=586

 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 68/123 (55%), Gaps = 8/123 (7%)
 Frame = -1

Query  670  CDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDD-LDPYLTEIQDST  494
            CDVA F+ D+S+  S++ A E ++ VA+   A+G  +P L + A D+   P L E   + 
Sbjct  413  CDVAAFLFDASQPGSFEAARERMLAVAT---ASGDALPCLFLQANDNEATPQLAERIGA-  468

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGKSRKQYHRLVNRSLM  314
                ++ +   +P S  L   +  +Q I   A++P L+IPET + K+ +QY R++ R L+
Sbjct  469  -ACSELAVR--LPASYTLRPSAAAYQAIALTAQQPELAIPETPSLKAARQYRRMLRRGLL  525

Query  313  FVS  305
            +  
Sbjct  526  YAG  528



>emb|CBI23980.3| unnamed protein product [Vitis vinifera]
Length=195

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  646  DSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPY  518
             SS  + WKRA+EL V VAS GE   YE+P LI+A  DDLDPY
Sbjct  106  SSSDGSLWKRAAELHVGVASQGENASYEMPCLIIAVTDDLDPY  148



>ref|XP_001876187.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR13689.1| predicted protein [Laccaria bicolor S238N-H82]
Length=645

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -1

Query  667  DVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLT--EIQDST  494
            DV ++VHDSS   S+   S L        + +   IP+L VA K DLD  L   E+Q   
Sbjct  492  DVIVYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV  545

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
               + +G++ P+ +S K G  ++LF  I + A +PH +IP
Sbjct  546  YCRR-LGLQVPVAVSVKAGQTADLFHAICSVALKPHTAIP  584



>gb|KIK06177.1| hypothetical protein K443DRAFT_286142 [Laccaria amethystina LaAM-08-1]
Length=645

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -1

Query  667  DVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLT--EIQDST  494
            DV ++VHDSS   S+   S L        + +   IP+L VA K DLD  L   E+Q   
Sbjct  492  DVIVYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV  545

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
               + +G++ P+ +S K G  ++LF  I + A +PH +IP
Sbjct  546  YCRR-LGLQVPVAVSVKAGQTADLFHAICSVALKPHTAIP  584



>ref|XP_010094580.1| hypothetical protein L484_024876 [Morus notabilis]
 gb|EXB56334.1| hypothetical protein L484_024876 [Morus notabilis]
Length=61

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  487  SQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETE  365
            SQ MG+EAP+P+S KL DL+ +   I+N AE PH SIPE +
Sbjct  15   SQYMGVEAPVPVSAKLDDLNIISHIILNTAEHPHSSIPERQ  55



>gb|EJT98761.1| mitochondrial Rho 1 [Dacryopinax sp. DJM-731 SS1]
Length=659

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (52%), Gaps = 9/112 (8%)
 Frame = -1

Query  703  KLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLD  524
            ++L ++  L   DV +FVHDSS   S+   S L        + +   +PSL VA K DLD
Sbjct  496  EVLRNQKKLDMADVIVFVHDSSDTNSFSYISNL------RQQYSLDSLPSLFVATKSDLD  549

Query  523  --PYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
                  E+Q  T   + +G++ P+ +S + G +++LFQ I   A  P  +IP
Sbjct  550  LAQQRHEVQPDTYCRR-LGLQVPVAVSARTGQIADLFQTICRIAMDPVHAIP  600



>gb|KJB23093.1| hypothetical protein B456_004G080500 [Gossypium raimondii]
Length=507

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHD  644
             EIPEDGVKKLLS+K+ LAACDVA+F++D
Sbjct  478  QEIPEDGVKKLLSNKECLAACDVAVFLYD  506



>gb|KIM43100.1| hypothetical protein M413DRAFT_443915 [Hebeloma cylindrosporum 
h7]
Length=631

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -1

Query  667  DVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLT--EIQDST  494
            DV ++VHDSS   S+   S L        + +   IP+L VA K DLD  L   E+Q   
Sbjct  478  DVIVYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV  531

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
               + +G++ P+ +S K G  +++F  I N A +P ++IP
Sbjct  532  YCRR-LGLQVPVAVSVKTGQTADVFHAICNIAMKPLVAIP  570



>ref|XP_008364027.1| PREDICTED: mitochondrial Rho GTPase 1-like [Malus domestica]
Length=584

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHD  644
             EIPEDGV+K L +K+ALAACD+A+FVHD
Sbjct  555  REIPEDGVEKFLRNKEALAACDIAVFVHD  583



>ref|XP_007346086.1| mitochondrial Rho GTPase [Auricularia delicata TFB-10046 SS5]
 gb|EJD45659.1| mitochondrial Rho GTPase [Auricularia delicata TFB-10046 SS5]
Length=649

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 9/107 (8%)
 Frame = -1

Query  697  LSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLD--  524
            L +   L   DV I+VHDSS   S+   S L        + +   IP+L VA K DLD  
Sbjct  482  LRASKKLDLADVIIYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLA  535

Query  523  PYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHL  383
                E+Q      + +G++ P+ +S + G+L+++FQ IV  A RP++
Sbjct  536  HQRHEVQPDVYCRR-LGLQVPVAVSVRAGELADVFQTIVGIAIRPYV  581



>dbj|GAN04132.1| mitochondrial Rho 1 [Mucor ambiguus]
Length=646

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 67/133 (50%), Gaps = 11/133 (8%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYE-IPS  554
             E+  + V ++LSSK  L  CD+  FV+D+S   S+         VA+  E    + +P+
Sbjct  470  QEVEPNQVAEILSSKKRLDQCDLLCFVYDTSDANSFGY-------VAALREKYKIDHVPT  522

Query  553  LIVAAKDDLD--PYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLS  380
            +IVA K +LD      E+Q      +++G+  P+ +S K   +++L+  +   A  P ++
Sbjct  523  VIVATKCELDLVTQRCEVQPDI-YCRNLGLAVPLSVSVKENQMADLYHILTGVAMNPTIA  581

Query  379  IPETEAGKSRKQY  341
             P +   K+ K +
Sbjct  582  TPGSNKDKTEKPW  594



>gb|KDQ25557.1| hypothetical protein PLEOSDRAFT_1057842 [Pleurotus ostreatus 
PC15]
Length=645

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 9/100 (9%)
 Frame = -1

Query  667  DVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLT--EIQDST  494
            DV ++VHDSS   S+   S L        + +   IP+L VA K DLD  L   E+Q   
Sbjct  492  DVIVYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV  545

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
               + +G++ P+ +S K G ++++F  I + A  P+ SIP
Sbjct  546  YCRR-LGLQVPVAVSVKTGQMADVFHAICSIAMSPNSSIP  584



>gb|KJA23989.1| hypothetical protein HYPSUDRAFT_162448 [Hypholoma sublateritium 
FD-334 SS-4]
Length=645

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 9/100 (9%)
 Frame = -1

Query  667  DVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLDPYLT--EIQDST  494
            DVA++VHDSS   S+   S L        + +   IP+L VA K DLD  L   E+Q   
Sbjct  492  DVAVYVHDSSDTNSFSYISNL------RQQYSLDHIPTLFVATKSDLDLALQRHEVQPDV  545

Query  493  RVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIP  374
               + +G++ P+ +S K G  +++F  I + A  P  +IP
Sbjct  546  YCRR-LGLQVPVAVSVKTGQTADVFHAICSIAMNPMTAIP  584



>gb|AFR95905.1| mitochondrial Rho GTPase 1 [Cryptococcus neoformans var. grubii 
H99]
Length=686

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 65/130 (50%), Gaps = 10/130 (8%)
 Frame = -1

Query  703  KLLSSKDALAACDVAIFVHDSSREASWKRASELLVDVASYGEATGYEIPSLIVAAKDDLD  524
            ++L +   L   D+ I+VHDSS   S+   S L        + +   IPS+ VA K DLD
Sbjct  526  EILRNSKRLDMADIIIYVHDSSDTNSFSYISNL------RQQYSLDHIPSIFVATKSDLD  579

Query  523  --PYLTEIQDSTRVSQDMGIEAPIPISTKLGDLSNLFQRIVNAAERPHLSIPETEAGK-S  353
                  E+Q      + +G++AP+ +S++LG L NL+  I   A  P  S+P   + + S
Sbjct  580  LAQQRHEVQPDVYCRR-LGLQAPMAVSSRLGPLHNLWVAITRVALDPTSSLPRGPSSQMS  638

Query  352  RKQYHRLVNR  323
              Q  R+V R
Sbjct  639  PAQRIRVVAR  648



>gb|KDO68750.1| hypothetical protein CISIN_1g005908mg [Citrus sinensis]
Length=507

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -1

Query  730  HEIPEDGVKKLLSSKDALAACDVAIFVHD  644
             EIPE+GVKK+LS+K+ALA+CDV IFV+D
Sbjct  478  QEIPEEGVKKILSNKEALASCDVTIFVYD  506



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470