BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031E06

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO50622.1|  hypothetical protein CISIN_1g0088521mg                  435   3e-149   Citrus sinensis [apfelsine]
emb|CAN73717.1|  hypothetical protein VITISV_038844                     437   7e-149   Vitis vinifera
ref|XP_009769588.1|  PREDICTED: probable nucleolar protein 5-2          438   3e-148   Nicotiana sylvestris
emb|CBI34244.3|  unnamed protein product                                435   4e-148   Vitis vinifera
dbj|BAB41076.1|  MAR-binding protein                                    437   4e-148   Nicotiana tabacum [American tobacco]
ref|XP_006491841.1|  PREDICTED: probable nucleolar protein 5-1-like     437   8e-148   Citrus sinensis [apfelsine]
ref|XP_006432265.1|  hypothetical protein CICLE_v10000758mg             437   8e-148   Citrus clementina [clementine]
gb|KDO43234.1|  hypothetical protein CISIN_1g013537mg                   432   1e-147   Citrus sinensis [apfelsine]
ref|XP_009591833.1|  PREDICTED: probable nucleolar protein 5-2          435   4e-147   Nicotiana tomentosiformis
ref|XP_007208461.1|  hypothetical protein PRUPE_ppa003941mg             434   7e-147   Prunus persica
ref|XP_006436388.1|  hypothetical protein CICLE_v10031140mg             434   1e-146   Citrus clementina [clementine]
ref|XP_002273273.2|  PREDICTED: probable nucleolar protein 5-2          434   2e-146   Vitis vinifera
ref|XP_008218165.1|  PREDICTED: probable nucleolar protein 5-2          432   2e-146   Prunus mume [ume]
ref|XP_006468095.1|  PREDICTED: probable nucleolar protein 5-2-li...    433   4e-146   Citrus sinensis [apfelsine]
ref|XP_006468094.1|  PREDICTED: probable nucleolar protein 5-2-li...    432   4e-146   Citrus sinensis [apfelsine]
ref|XP_006468097.1|  PREDICTED: probable nucleolar protein 5-2-li...    434   5e-146   Citrus sinensis [apfelsine]
ref|XP_006468096.1|  PREDICTED: probable nucleolar protein 5-2-li...    432   7e-146   Citrus sinensis [apfelsine]
ref|XP_010243588.1|  PREDICTED: probable nucleolar protein 5-1          430   9e-145   Nelumbo nucifera [Indian lotus]
ref|XP_006362168.1|  PREDICTED: probable nucleolar protein 5-2-li...    424   9e-143   
gb|KJB26510.1|  hypothetical protein B456_004G245100                    418   2e-142   Gossypium raimondii
ref|XP_011099781.1|  PREDICTED: probable nucleolar protein 5-2          422   1e-141   Sesamum indicum [beniseed]
ref|XP_004239682.1|  PREDICTED: probable nucleolar protein 5-2          420   1e-141   Solanum lycopersicum
ref|XP_010546633.1|  PREDICTED: probable nucleolar protein 5-2          421   1e-141   Tarenaya hassleriana [spider flower]
ref|XP_011099778.1|  PREDICTED: probable nucleolar protein 5-2          421   2e-141   Sesamum indicum [beniseed]
gb|KJB26512.1|  hypothetical protein B456_004G245100                    419   3e-141   Gossypium raimondii
ref|XP_011013586.1|  PREDICTED: probable nucleolar protein 5-1          420   4e-141   Populus euphratica
ref|XP_010025094.1|  PREDICTED: probable nucleolar protein 5-2          421   4e-141   Eucalyptus grandis [rose gum]
emb|CAK22424.1|  matrix attachment region binding protein               420   5e-141   Beta vulgaris [beet]
gb|KJB26509.1|  hypothetical protein B456_004G245100                    420   5e-141   Gossypium raimondii
ref|XP_011032532.1|  PREDICTED: probable nucleolar protein 5-1          419   6e-141   Populus euphratica
ref|XP_010687356.1|  PREDICTED: probable nucleolar protein 5-2          420   7e-141   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004247627.1|  PREDICTED: probable nucleolar protein 5-2          419   7e-141   
ref|XP_010422824.1|  PREDICTED: probable nucleolar protein 5-2          419   8e-141   Camelina sativa [gold-of-pleasure]
gb|KHN25404.1|  Putative nucleolar protein 5-2                          418   2e-140   Glycine soja [wild soybean]
ref|XP_003540996.1|  PREDICTED: probable nucleolar protein 5-2-like     418   2e-140   Glycine max [soybeans]
gb|KDP35364.1|  hypothetical protein JCGZ_10348                         418   2e-140   Jatropha curcas
gb|KHG01259.1|  putative nucleolar 5-2 -like protein                    417   2e-140   Gossypium arboreum [tree cotton]
ref|XP_010485906.1|  PREDICTED: probable nucleolar protein 5-2          417   3e-140   Camelina sativa [gold-of-pleasure]
ref|XP_010550954.1|  PREDICTED: probable nucleolar protein 5-2          417   3e-140   Tarenaya hassleriana [spider flower]
ref|XP_006382714.1|  hypothetical protein POPTR_0005s04710g             417   4e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010241470.1|  PREDICTED: probable nucleolar protein 5-2 is...    417   6e-140   Nelumbo nucifera [Indian lotus]
ref|XP_010241493.1|  PREDICTED: probable nucleolar protein 5-2 is...    417   8e-140   Nelumbo nucifera [Indian lotus]
ref|XP_003537858.1|  PREDICTED: probable nucleolar protein 5-2-like     416   9e-140   Glycine max [soybeans]
gb|KDP23603.1|  hypothetical protein JCGZ_23436                         416   2e-139   Jatropha curcas
gb|KJB82560.1|  hypothetical protein B456_013G202500                    415   3e-139   Gossypium raimondii
ref|XP_003611089.1|  SAR DNA-binding protein-1                          412   3e-139   
ref|XP_006394992.1|  hypothetical protein EUTSA_v10003966mg             414   5e-139   Eutrema salsugineum [saltwater cress]
ref|XP_006297275.1|  hypothetical protein CARUB_v10013290mg             415   8e-139   
ref|XP_008388628.1|  PREDICTED: probable nucleolar protein 5-2          414   9e-139   
ref|XP_010464014.1|  PREDICTED: probable nucleolar protein 5-2          413   2e-138   Camelina sativa [gold-of-pleasure]
ref|XP_006345813.1|  PREDICTED: probable nucleolar protein 5-2-like     412   2e-138   Solanum tuberosum [potatoes]
ref|XP_003611088.1|  SAR DNA-binding protein-1                          414   3e-138   Medicago truncatula
gb|EYU23803.1|  hypothetical protein MIMGU_mgv1a003693mg                413   3e-138   Erythranthe guttata [common monkey flower]
ref|XP_010938712.1|  PREDICTED: probable nucleolar protein 5-2          414   4e-138   Elaeis guineensis
ref|XP_002319598.1|  hypothetical protein POPTR_0013s03260g             412   5e-138   Populus trichocarpa [western balsam poplar]
ref|XP_008796213.1|  PREDICTED: probable nucleolar protein 5-2 is...    413   5e-138   Phoenix dactylifera
ref|XP_008796212.1|  PREDICTED: probable nucleolar protein 5-2 is...    412   5e-138   Phoenix dactylifera
ref|NP_187157.1|  putative SAR DNA-binding protein                      411   6e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008370662.1|  PREDICTED: probable nucleolar protein 5-2          411   9e-138   
ref|XP_009411704.1|  PREDICTED: probable nucleolar protein 5-1          412   9e-138   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006408115.1|  hypothetical protein EUTSA_v10020473mg             410   9e-138   Eutrema salsugineum [saltwater cress]
ref|XP_009382561.1|  PREDICTED: probable nucleolar protein 5-2          412   1e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011003824.1|  PREDICTED: probable nucleolar protein 5-2          411   1e-137   Populus euphratica
gb|KHG00213.1|  putative nucleolar 5-2 -like protein                    410   2e-137   Gossypium arboreum [tree cotton]
ref|XP_004139213.1|  PREDICTED: probable nucleolar protein 5-2-li...    410   2e-137   Cucumis sativus [cucumbers]
gb|KJB45047.1|  hypothetical protein B456_007G287100                    410   3e-137   Gossypium raimondii
ref|XP_008455669.1|  PREDICTED: probable nucleolar protein 5-2          410   3e-137   Cucumis melo [Oriental melon]
ref|XP_008799299.1|  PREDICTED: probable nucleolar protein 5-2          407   4e-137   Phoenix dactylifera
ref|XP_007030687.1|  NOP56-like pre RNA processing ribonucleoprot...    409   4e-137   
ref|XP_004139212.1|  PREDICTED: probable nucleolar protein 5-2-li...    410   4e-137   
ref|XP_010674932.1|  PREDICTED: probable nucleolar protein 5-2          410   5e-137   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006287421.1|  hypothetical protein CARUB_v10000627mg             409   5e-137   
ref|XP_010421655.1|  PREDICTED: probable nucleolar protein 5-1 is...    404   6e-137   Camelina sativa [gold-of-pleasure]
ref|XP_009342020.1|  PREDICTED: probable nucleolar protein 5-2          409   6e-137   Pyrus x bretschneideri [bai li]
ref|XP_009364569.1|  PREDICTED: probable nucleolar protein 5-2          409   6e-137   Pyrus x bretschneideri [bai li]
ref|XP_002884489.1|  hypothetical protein ARALYDRAFT_896572             408   9e-137   Arabidopsis lyrata subsp. lyrata
gb|EYU23804.1|  hypothetical protein MIMGU_mgv1a003941mg                408   1e-136   Erythranthe guttata [common monkey flower]
ref|XP_007030686.1|  NOP56-like pre RNA processing ribonucleoprot...    408   2e-136   
gb|KHG01423.1|  putative nucleolar 5-2 -like protein                    407   5e-136   Gossypium arboreum [tree cotton]
ref|XP_010421656.1|  PREDICTED: probable nucleolar protein 5-1 is...    405   7e-136   Camelina sativa [gold-of-pleasure]
ref|XP_010904781.1|  PREDICTED: probable nucleolar protein 5-2          407   1e-135   Elaeis guineensis
ref|XP_009111930.1|  PREDICTED: probable nucleolar protein 5-1          404   2e-135   Brassica rapa
ref|XP_010494044.1|  PREDICTED: probable nucleolar protein 5-1          404   3e-135   Camelina sativa [gold-of-pleasure]
emb|CDY00004.1|  BnaC09g02970D                                          404   4e-135   
emb|CDY19706.1|  BnaA09g03590D                                          403   5e-135   Brassica napus [oilseed rape]
ref|XP_010455156.1|  PREDICTED: probable nucleolar protein 5-1          403   8e-135   Camelina sativa [gold-of-pleasure]
ref|NP_198064.1|  putative SAR DNA-binding protein                      403   9e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004507477.1|  PREDICTED: probable nucleolar protein 5-1-like     403   1e-134   Cicer arietinum [garbanzo]
ref|XP_002512277.1|  nucleolar protein nop56, putative                  403   3e-134   Ricinus communis
emb|CDX80674.1|  BnaC07g27700D                                          399   2e-133   
ref|XP_003562489.1|  PREDICTED: probable nucleolar protein 5-2          400   2e-133   Brachypodium distachyon [annual false brome]
dbj|BAA31260.1|  SAR DNA binding protein                                397   3e-133   Oryza sativa [red rice]
ref|XP_009151230.1|  PREDICTED: probable nucleolar protein 5-1          398   5e-133   Brassica rapa
gb|KJB26511.1|  hypothetical protein B456_004G245100                    395   6e-133   Gossypium raimondii
gb|ABF95925.1|  Nucleolar protein NOP5, putative, expressed             397   4e-132   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050112.1|  Os03g0350100                                       397   5e-132   
ref|NP_001050113.1|  Os03g0350300                                       396   7e-132   
ref|XP_007131795.1|  hypothetical protein PHAVU_011G042200g             395   1e-131   Phaseolus vulgaris [French bean]
gb|EMS65034.1|  hypothetical protein TRIUR3_04158                       394   6e-131   Triticum urartu
gb|AAB61073.1|  similar to S. cerevisiae SIK1P (PID:g984964)            389   1e-130   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85748.1|  unknown                                                 392   2e-130   Medicago truncatula
ref|XP_006650080.1|  PREDICTED: probable nucleolar protein 5-2-like     392   3e-130   Oryza brachyantha
gb|EEC75255.1|  hypothetical protein OsI_11566                          395   3e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_006838803.1|  hypothetical protein AMTR_s00002p00260990          393   3e-130   Amborella trichopoda
ref|XP_002874406.1|  hypothetical protein ARALYDRAFT_489610             390   5e-130   
ref|XP_003606983.1|  SAR DNA-binding protein-1                          391   6e-130   
gb|KFK37913.1|  hypothetical protein AALP_AA3G046300                    389   2e-129   Arabis alpina [alpine rockcress]
emb|CDP04715.1|  unnamed protein product                                385   2e-129   Coffea canephora [robusta coffee]
gb|AAC16330.1|  SAR DNA-binding protein-1                               389   3e-129   Pisum sativum [garden pea]
ref|XP_002456868.1|  hypothetical protein SORBIDRAFT_03g044260          389   8e-129   
ref|XP_007030688.1|  NOP56-like pre RNA processing ribonucleoprot...    384   1e-128   
gb|EEE59058.1|  hypothetical protein OsJ_10836                          386   2e-128   Oryza sativa Japonica Group [Japonica rice]
gb|AFW88399.1|  hypothetical protein ZEAMMB73_019419                    383   4e-128   
gb|AAC16331.1|  SAR DNA-binding protein-2                               385   9e-128   Pisum sativum [garden pea]
ref|XP_003557835.1|  PREDICTED: probable nucleolar protein 5-2          385   1e-127   Brachypodium distachyon [annual false brome]
ref|XP_008660157.1|  PREDICTED: probable nucleolar protein 5-2          384   4e-127   Zea mays [maize]
ref|XP_011457678.1|  PREDICTED: probable nucleolar protein 5-2          384   5e-127   Fragaria vesca subsp. vesca
ref|XP_008655653.1|  PREDICTED: probable nucleolar protein 5-2          384   8e-127   Zea mays [maize]
ref|XP_002533223.1|  nucleolar protein nop56, putative                  383   1e-126   Ricinus communis
ref|XP_004984387.1|  PREDICTED: probable nucleolar protein 5-2-like     382   4e-126   Setaria italica
ref|XP_004984388.1|  PREDICTED: probable nucleolar protein 5-2-like     382   5e-126   Setaria italica
emb|CDY50583.1|  BnaC02g39570D                                          377   7e-125   Brassica napus [oilseed rape]
emb|CDY52494.1|  BnaAnng11410D                                          377   1e-124   Brassica napus [oilseed rape]
gb|AAN72071.1|  SAR DNA-binding protein - like                          373   1e-124   Arabidopsis thaliana [mouse-ear cress]
emb|CAE45597.1|  SAR DNA-binding protein-like protein                   376   3e-124   Lotus japonicus
dbj|BAN15014.1|  SAR DNA binding protein                                369   1e-121   Bromus inermis [awnless brome grass]
tpg|DAA45361.1|  TPA: hypothetical protein ZEAMMB73_906298              365   4e-121   
ref|XP_001753892.1|  predicted protein                                  343   9e-111   
ref|XP_001756465.1|  predicted protein                                  339   2e-109   
ref|XP_002985284.1|  hypothetical protein SELMODRAFT_121625             331   3e-106   Selaginella moellendorffii
ref|XP_002970093.1|  hypothetical protein SELMODRAFT_146841             330   5e-106   Selaginella moellendorffii
gb|KFK23538.1|  hypothetical protein AALP_AAs63573U000200               323   4e-104   Arabis alpina [alpine rockcress]
gb|KJB82563.1|  hypothetical protein B456_013G202500                    320   5e-104   Gossypium raimondii
gb|KJB45049.1|  hypothetical protein B456_007G287100                    319   1e-103   Gossypium raimondii
ref|XP_010097360.1|  hypothetical protein L484_010238                   322   3e-103   
ref|XP_007030689.1|  NOP56-like pre RNA processing ribonucleoprot...    315   3e-102   
ref|XP_002946402.1|  hypothetical protein VOLCADRAFT_102990             319   3e-102   Volvox carteri f. nagariensis
ref|XP_003077976.1|  SAR DNA-binding protein-1-garden pea (ISS)         305   3e-99    
ref|XP_001690352.1|  nucleolar protein, component of C/D snoRNPs        311   4e-99    Chlamydomonas reinhardtii
ref|XP_001416562.1|  predicted protein                                  308   1e-98    Ostreococcus lucimarinus CCE9901
emb|CEF96991.1|  NOSIC                                                  306   9e-98    Ostreococcus tauri
ref|XP_003056558.1|  nucleolar RNA binding protein                      305   1e-97    Micromonas pusilla CCMP1545
gb|KDO24106.1|  hypothetical protein SPRG_10894                         299   5e-95    Saprolegnia parasitica CBS 223.65
ref|XP_008872332.1|  hypothetical protein H310_08394                    299   9e-95    Aphanomyces invadans
gb|EPS70798.1|  hypothetical protein M569_03961                         295   1e-94    Genlisea aurea
ref|XP_002874404.1|  hypothetical protein ARALYDRAFT_326985             296   3e-94    
ref|XP_008618047.1|  hypothetical protein SDRG_13728                    297   4e-94    Saprolegnia diclina VS20
ref|XP_008423022.1|  PREDICTED: nucleolar protein 58                    298   7e-94    Poecilia reticulata
ref|XP_009836884.1|  hypothetical protein H257_11594                    297   8e-94    Aphanomyces astaci
ref|XP_007565432.1|  PREDICTED: nucleolar protein 58 isoform X1         298   1e-93    
ref|XP_004874566.1|  PREDICTED: nucleolar protein 58-like               293   1e-93    
ref|XP_007565433.1|  PREDICTED: nucleolar protein 58 isoform X2         297   1e-93    Poecilia formosa
ref|XP_007908792.1|  PREDICTED: nucleolar protein 58                    297   2e-93    Callorhinchus milii [Australian ghost shark]
ref|XP_004899183.1|  PREDICTED: nucleolar protein 58-like               291   4e-93    
ref|XP_004601337.1|  PREDICTED: nucleolar protein 58                    295   7e-93    Sorex araneus [Eurasian shrew]
ref|XP_006636806.1|  PREDICTED: nucleolar protein 58-like               295   7e-93    
emb|CAH91951.1|  hypothetical protein                                   293   7e-93    Pongo abelii [orang utan]
gb|EFB14929.1|  hypothetical protein PANDA_007776                       293   8e-93    Ailuropoda melanoleuca
ref|XP_005808115.1|  PREDICTED: nucleolar protein 58-like               295   9e-93    Xiphophorus maculatus
ref|XP_005574021.1|  PREDICTED: nucleolar protein 58 isoform X2         293   1e-92    Macaca fascicularis [crab eating macaque]
ref|XP_004674881.1|  PREDICTED: nucleolar protein 58                    293   1e-92    Condylura cristata
ref|XP_007654286.1|  PREDICTED: nucleolar protein 58                    293   2e-92    
ref|XP_009442289.1|  PREDICTED: nucleolar protein 58 isoform X3         292   2e-92    Pan troglodytes
ref|XP_008972452.1|  PREDICTED: nucleolar protein 58 isoform X2         292   2e-92    Pan paniscus [bonobo]
ref|XP_004626797.1|  PREDICTED: nucleolar protein 58                    293   2e-92    Octodon degus
ref|XP_005574022.1|  PREDICTED: nucleolar protein 58 isoform X3         292   2e-92    
ref|XP_007090044.1|  PREDICTED: nucleolar protein 58 isoform X2         292   2e-92    Panthera tigris altaica
ref|XP_004426861.1|  PREDICTED: nucleolar protein 58                    294   2e-92    Ceratotherium simum simum [southern square-lipped rhinoceros]
emb|CAB55989.2|  hypothetical protein                                   291   2e-92    Homo sapiens [man]
gb|ACA96503.1|  MAR-binding protein                                     294   2e-92    Dunaliella salina
ref|XP_008515600.1|  PREDICTED: nucleolar protein 58 isoform X1         292   2e-92    Equus przewalskii [Przewalski horse]
emb|CAJ82550.1|  nucleolar protein 5                                    292   3e-92    Xenopus tropicalis [western clawed frog]
ref|XP_005640605.1|  PREDICTED: nucleolar protein 58 isoform X3         292   3e-92    Canis lupus familiaris [dogs]
ref|XP_007964076.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-92    Chlorocebus sabaeus
ref|XP_006921427.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-92    Pteropus alecto
ref|XP_007190604.1|  PREDICTED: nucleolar protein 58 isoform X3         292   3e-92    Balaenoptera acutorostrata scammoni
ref|XP_006935541.1|  PREDICTED: nucleolar protein 58 isoform X2         292   3e-92    
ref|XP_007117842.1|  PREDICTED: nucleolar protein 58 isoform X2         292   3e-92    Physeter catodon
ref|XP_011223163.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-92    Ailuropoda melanoleuca
ref|XP_009442288.1|  PREDICTED: nucleolar protein 58 isoform X2         292   3e-92    Pan troglodytes
ref|XP_007190605.1|  PREDICTED: nucleolar protein 58 isoform X4         291   3e-92    Balaenoptera acutorostrata scammoni
ref|XP_008685595.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-92    Ursus maritimus [white bear]
gb|AAH09306.1|  NOP58 protein                                           293   4e-92    Homo sapiens [man]
ref|NP_057018.1|  nucleolar protein 58                                  293   4e-92    Homo sapiens [man]
ref|XP_007190603.1|  PREDICTED: nucleolar protein 58 isoform X2         292   4e-92    Balaenoptera acutorostrata scammoni
ref|XP_010970137.1|  PREDICTED: nucleolar protein 58 isoform X2         291   4e-92    Camelus bactrianus [camel]
gb|ETL31667.1|  hypothetical protein L916_15560                         292   4e-92    Phytophthora parasitica
gb|AAI30064.1|  LOC398558 protein                                       292   5e-92    Xenopus laevis [clawed frog]
gb|AAH44082.1|  LOC398558 protein                                       292   5e-92    Xenopus laevis [clawed frog]
gb|ETI38018.1|  hypothetical protein F443_16119                         292   5e-92    Phytophthora parasitica P1569
ref|XP_003925690.1|  PREDICTED: nucleolar protein 58                    291   5e-92    Saimiri boliviensis boliviensis
ref|XP_008515601.1|  PREDICTED: nucleolar protein 58 isoform X2         293   5e-92    Equus przewalskii [Przewalski horse]
ref|XP_010614436.1|  PREDICTED: nucleolar protein 58 isoform X2         291   5e-92    Fukomys damarensis [Damara mole rat]
ref|XP_002903084.1|  nucleolar protein NOP5                             292   6e-92    Phytophthora infestans T30-4
dbj|BAG51244.1|  unnamed protein product                                291   6e-92    Homo sapiens [man]
ref|XP_003820813.1|  PREDICTED: nucleolar protein 58 isoform X1         293   6e-92    Pan paniscus [bonobo]
ref|XP_516036.2|  PREDICTED: nucleolar protein 58 isoform X1            293   6e-92    Pan troglodytes
ref|NP_001248115.1|  nucleolar protein 58                               293   6e-92    Macaca mulatta [rhesus macaque]
ref|XP_003966575.1|  PREDICTED: nucleolar protein 58-like               292   6e-92    Takifugu rubripes [tiger puffer]
ref|XP_005338975.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    293   7e-92    
ref|XP_005640604.1|  PREDICTED: nucleolar protein 58 isoform X2         293   7e-92    
ref|XP_007964075.1|  PREDICTED: nucleolar protein 58 isoform X1         293   7e-92    Chlorocebus sabaeus
gb|EHB15488.1|  Nucleolar protein 58                                    291   7e-92    Heterocephalus glaber [naked mole rat]
ref|NP_989298.1|  NOP58 ribonucleoprotein                               293   7e-92    Xenopus tropicalis [western clawed frog]
ref|XP_004393512.1|  PREDICTED: nucleolar protein 58 isoform 2          292   7e-92    Odobenus rosmarus divergens
ref|XP_005202671.1|  PREDICTED: nucleolar protein 58 isoform X3         291   7e-92    Bos taurus [bovine]
ref|XP_007117841.1|  PREDICTED: nucleolar protein 58 isoform X1         293   7e-92    
ref|XP_006921426.1|  PREDICTED: nucleolar protein 58 isoform X1         292   7e-92    Pteropus alecto
ref|XP_005397115.1|  PREDICTED: nucleolar protein 58                    293   7e-92    Chinchilla lanigera
ref|XP_004262889.1|  PREDICTED: nucleolar protein 58 isoform 2          292   8e-92    
ref|XP_007090043.1|  PREDICTED: nucleolar protein 58 isoform X1         293   8e-92    Panthera tigris altaica
ref|XP_007190602.1|  PREDICTED: nucleolar protein 58 isoform X1         292   9e-92    Balaenoptera acutorostrata scammoni
ref|XP_005601801.1|  PREDICTED: nucleolar protein 58                    293   9e-92    
ref|XP_006935540.1|  PREDICTED: nucleolar protein 58 isoform X1         293   9e-92    
ref|XP_005640603.1|  PREDICTED: nucleolar protein 58 isoform X1         293   9e-92    Canis lupus familiaris [dogs]
ref|XP_004393511.1|  PREDICTED: nucleolar protein 58 isoform 1          292   9e-92    Odobenus rosmarus divergens
ref|XP_005202670.1|  PREDICTED: nucleolar protein 58 isoform X2         291   9e-92    Bos taurus [bovine]
ref|XP_004262888.1|  PREDICTED: nucleolar protein 58 isoform 1          292   1e-91    Orcinus orca [Orca]
ref|XP_010600740.1|  PREDICTED: nucleolar protein 58 isoform X2         290   1e-91    Loxodonta africana [African bush elephant]
ref|XP_005676440.1|  PREDICTED: nucleolar protein 58 isoform X3         290   1e-91    
ref|XP_006080610.1|  PREDICTED: nucleolar protein 58 isoform X3         291   1e-91    Bubalus bubalis [domestic water buffalo]
ref|XP_006153112.1|  PREDICTED: nucleolar protein 58-like isoform X3    290   1e-91    Tupaia chinensis
ref|XP_011223162.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Ailuropoda melanoleuca
ref|XP_005995462.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Latimeria chalumnae
ref|XP_005995463.1|  PREDICTED: nucleolar protein 58 isoform X2         292   1e-91    Latimeria chalumnae
ref|XP_008911207.1|  hypothetical protein PPTG_15671                    291   1e-91    Phytophthora parasitica INRA-310
ref|XP_008685594.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Ursus maritimus [white bear]
ref|XP_006205257.1|  PREDICTED: nucleolar protein 58 isoform X2         292   1e-91    
ref|XP_004904636.1|  PREDICTED: nucleolar protein 58                    292   1e-91    
ref|XP_006205258.1|  PREDICTED: nucleolar protein 58 isoform X3         292   1e-91    
ref|XP_006189993.1|  PREDICTED: nucleolar protein 58 isoform X3         292   1e-91    
ref|XP_006189992.1|  PREDICTED: nucleolar protein 58 isoform X2         292   1e-91    
ref|XP_006189991.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Camelus ferus
ref|XP_006205256.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Vicugna pacos
ref|XP_006153111.1|  PREDICTED: nucleolar protein 58-like isoform X2    291   1e-91    Tupaia chinensis
ref|XP_004570503.1|  PREDICTED: nucleolar protein 58-like isoform X1    292   1e-91    Maylandia zebra
ref|XP_004570504.1|  PREDICTED: nucleolar protein 58-like isoform X2    292   1e-91    Maylandia zebra
ref|XP_010614435.1|  PREDICTED: nucleolar protein 58 isoform X1         292   1e-91    Fukomys damarensis [Damara mole rat]
ref|XP_005858299.1|  PREDICTED: nucleolar protein 58 isoform X3         290   1e-91    Myotis brandtii
ref|XP_004764236.1|  PREDICTED: nucleolar protein 58 isoform X3         290   2e-91    Mustela putorius furo [black ferret]
ref|XP_008833673.1|  PREDICTED: nucleolar protein 58 isoform X2         290   2e-91    Nannospalax galili
ref|XP_009530825.1|  hypothetical protein PHYSODRAFT_246404             290   2e-91    Phytophthora sojae
gb|ELR50156.1|  Nucleolar protein 58                                    291   2e-91    Bos mutus
ref|XP_005943429.1|  PREDICTED: nucleolar protein 58-like isoform X2    291   2e-91    Haplochromis burtoni
gb|ELW62707.1|  Nucleolar protein 58                                    291   2e-91    Tupaia chinensis
ref|XP_003406179.1|  PREDICTED: nucleolar protein 58 isoform X1         291   2e-91    Loxodonta africana [African bush elephant]
ref|NP_001179886.1|  nucleolar protein 58                               291   2e-91    Bos taurus [bovine]
ref|XP_005904317.1|  PREDICTED: nucleolar protein 58                    291   2e-91    Bos mutus
ref|XP_004004885.1|  PREDICTED: nucleolar protein 58                    291   2e-91    
ref|XP_003254003.1|  PREDICTED: nucleolar protein 58                    291   2e-91    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005943428.1|  PREDICTED: nucleolar protein 58-like isoform X1    291   2e-91    Haplochromis burtoni
ref|XP_005202669.1|  PREDICTED: nucleolar protein 58 isoform X1         291   2e-91    Bos taurus [bovine]
gb|AAI51726.1|  NOP58 protein                                           291   2e-91    Bos taurus [bovine]
gb|AAI06292.1|  LOC398558 protein                                       291   2e-91    Xenopus laevis [clawed frog]
ref|XP_006153110.1|  PREDICTED: nucleolar protein 58-like isoform X1    291   2e-91    Tupaia chinensis
ref|XP_008997474.1|  PREDICTED: nucleolar protein 58 isoform X2         289   3e-91    Callithrix jacchus [common marmoset]
ref|XP_004378293.1|  PREDICTED: nucleolar protein 58                    291   3e-91    Trichechus manatus latirostris
ref|XP_007501979.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-91    Monodelphis domestica
ref|XP_004764235.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-91    
ref|XP_005676439.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-91    
ref|XP_009181067.1|  PREDICTED: nucleolar protein 58 isoform X3         286   3e-91    
ref|XP_005676438.1|  PREDICTED: nucleolar protein 58 isoform X1         291   3e-91    Capra hircus [domestic goat]
ref|XP_005980258.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-91    Pantholops hodgsonii [Tibetan antelope]
ref|XP_006756295.1|  PREDICTED: nucleolar protein 58 isoform X2         289   3e-91    Myotis davidii
ref|XP_001371978.1|  PREDICTED: nucleolar protein 58 isoform X1         291   3e-91    Monodelphis domestica
ref|XP_005980257.1|  PREDICTED: nucleolar protein 58 isoform X1         291   3e-91    Pantholops hodgsonii [Tibetan antelope]
gb|AAH77204.1|  MGC78950 protein                                        291   3e-91    Xenopus laevis [clawed frog]
ref|XP_007469243.1|  PREDICTED: nucleolar protein 58 isoform X2         291   3e-91    Lipotes vexillifer [baiji]
ref|NP_001086628.1|  NOP58 ribonucleoprotein                            291   3e-91    Xenopus laevis [clawed frog]
ref|XP_004764234.1|  PREDICTED: nucleolar protein 58 isoform X1         291   3e-91    Mustela putorius furo [black ferret]
ref|XP_008257210.1|  PREDICTED: nucleolar protein 58 isoform X3         289   3e-91    Oryctolagus cuniculus [domestic rabbit]
gb|AAH44394.1|  Nop58 protein                                           290   3e-91    Danio rerio [leopard danio]
ref|XP_007501981.1|  PREDICTED: nucleolar protein 58 isoform X4         291   4e-91    Monodelphis domestica
ref|XP_007501980.1|  PREDICTED: nucleolar protein 58 isoform X3         291   4e-91    Monodelphis domestica
ref|XP_003474493.1|  PREDICTED: nucleolar protein 58                    290   4e-91    
ref|XP_008323109.1|  PREDICTED: nucleolar protein 58                    292   4e-91    
ref|XP_007469242.1|  PREDICTED: nucleolar protein 58 isoform X1         291   4e-91    Lipotes vexillifer [baiji]
ref|XP_008257209.1|  PREDICTED: nucleolar protein 58 isoform X2         290   4e-91    Oryctolagus cuniculus [domestic rabbit]
dbj|BAE21954.1|  unnamed protein product                                288   4e-91    Mus musculus [mouse]
ref|XP_008283621.1|  PREDICTED: nucleolar protein 58 isoform X2         291   4e-91    
ref|XP_008063382.1|  PREDICTED: nucleolar protein 58                    290   4e-91    
ref|XP_008283620.1|  PREDICTED: nucleolar protein 58 isoform X1         291   4e-91    
ref|NP_001009889.1|  nucleolar protein 58                               290   5e-91    
ref|XP_005858297.1|  PREDICTED: nucleolar protein 58 isoform X1         290   5e-91    
ref|XP_005858298.1|  PREDICTED: nucleolar protein 58 isoform X2         290   5e-91    
gb|KDD76960.1|  putative snoRNA binding domain-containing protein       289   5e-91    
ref|XP_009181066.1|  PREDICTED: nucleolar protein 58 isoform X2         286   5e-91    
ref|XP_007520557.1|  PREDICTED: nucleolar protein 58                    290   5e-91    
ref|XP_008144676.1|  PREDICTED: nucleolar protein 58                    290   5e-91    
ref|XP_004458929.1|  PREDICTED: nucleolar protein 58 isoform 2          288   5e-91    
ref|XP_007248939.1|  PREDICTED: nucleolar protein 58-like               291   5e-91    
ref|XP_006809619.1|  PREDICTED: nucleolar protein 58-like               290   6e-91    
ref|XP_007512606.1|  predicted protein                                  289   6e-91    
ref|XP_008833672.1|  PREDICTED: nucleolar protein 58 isoform X1         290   6e-91    
ref|XP_781458.2|  PREDICTED: nucleolar protein 58                       290   6e-91    
ref|XP_003907873.1|  PREDICTED: nucleolar protein 58 isoform X1         287   6e-91    
ref|XP_002712586.1|  PREDICTED: nucleolar protein 58 isoform X1         290   6e-91    
ref|XP_002749695.1|  PREDICTED: nucleolar protein 58 isoform X1         290   6e-91    
ref|XP_006756294.1|  PREDICTED: nucleolar protein 58 isoform X1         290   7e-91    
gb|AAI55195.1|  Nop58 protein                                           290   7e-91    
ref|XP_005165784.1|  PREDICTED: nucleolar protein 58 isoform X1         291   7e-91    
ref|XP_006082477.1|  PREDICTED: nucleolar protein 58                    290   7e-91    
ref|XP_003785079.1|  PREDICTED: nucleolar protein 58                    290   8e-91    
gb|EPQ02705.1|  Nucleolar protein 58                                    291   9e-91    
gb|AAI51885.1|  Nop58 protein                                           290   1e-90    
ref|XP_006734635.1|  PREDICTED: nucleolar protein 58 isoform X2         290   1e-90    
ref|XP_004701594.1|  PREDICTED: nucleolar protein 58                    289   1e-90    
ref|XP_004458928.1|  PREDICTED: nucleolar protein 58 isoform 1          289   1e-90    
ref|XP_006734634.1|  PREDICTED: nucleolar protein 58 isoform X1         289   2e-90    
gb|KJE95676.1|  nucleolar protein NOP5/NOP58                            287   2e-90    
dbj|BAE22082.1|  unnamed protein product                                288   2e-90    
gb|AAC08435.1|  SIK similar protein                                     287   2e-90    
ref|XP_006862038.1|  PREDICTED: nucleolar protein 58                    288   2e-90    
ref|XP_006975092.1|  PREDICTED: nucleolar protein 58 isoform X2         287   3e-90    
ref|XP_008650437.1|  PREDICTED: probable nucleolar protein 5-2          286   3e-90    
ref|XP_006496212.1|  PREDICTED: nucleolar protein 58 isoform X1         286   3e-90    
ref|XP_010738555.1|  PREDICTED: nucleolar protein 58                    288   4e-90    
ref|XP_002116484.1|  hypothetical protein TRIADDRAFT_30778              286   4e-90    
ref|XP_005574023.1|  PREDICTED: nucleolar protein 58 isoform X4         285   4e-90    
ref|XP_005097537.1|  PREDICTED: nucleolar protein 58-like               288   4e-90    
ref|XP_004653773.1|  PREDICTED: nucleolar protein 58                    288   5e-90    
ref|XP_006889153.1|  PREDICTED: nucleolar protein 58                    288   5e-90    
ref|XP_007933244.1|  PREDICTED: nucleolar protein 58                    286   5e-90    
ref|XP_006975091.1|  PREDICTED: nucleolar protein 58 isoform X1         288   6e-90    
ref|XP_005366385.1|  PREDICTED: nucleolar protein 58 isoform X2         287   6e-90    
ref|XP_007190607.1|  PREDICTED: nucleolar protein 58 isoform X6         285   6e-90    
ref|NP_061356.2|  nucleolar protein 58                                  288   7e-90    
dbj|BAC31822.1|  unnamed protein product                                288   7e-90    
gb|EMC81163.1|  Nucleolar protein 58                                    285   7e-90    
gb|AAC23535.1|  unknown                                                 285   7e-90    
ref|NP_001133496.1|  Nucleolar protein 5                                287   8e-90    
ref|XP_001641027.1|  predicted protein                                  287   8e-90    
ref|XP_005366384.1|  PREDICTED: nucleolar protein 58 isoform X1         287   8e-90    
ref|XP_004345693.1|  nucleolar protein NOP5/NOP58                       286   1e-89    
gb|AAZ31075.2|  MAR-binding protein                                     287   1e-89    
ref|XP_006245075.1|  PREDICTED: nucleolar protein 58 isoform X1         285   2e-89    
ref|XP_005465917.1|  PREDICTED: nucleolar protein 58                    286   2e-89    
tpg|DAA42144.1|  TPA: hypothetical protein ZEAMMB73_016967              280   2e-89    
ref|XP_002507734.1|  nucleolar RNA binding protein                      284   2e-89    
ref|XP_003766066.1|  PREDICTED: nucleolar protein 58                    288   3e-89    
ref|XP_006130811.1|  PREDICTED: nucleolar protein 58                    286   3e-89    
ref|XP_005837542.1|  hypothetical protein GUITHDRAFT_66997              285   3e-89    
emb|CDH51673.1|  loc398558 protein                                      285   4e-89    
ref|NP_068522.1|  nucleolar protein 58                                  285   4e-89    
ref|XP_008666415.1|  PREDICTED: probable nucleolar protein 5-2          282   4e-89    
tpg|DAA47457.1|  TPA: hypothetical protein ZEAMMB73_782083              283   4e-89    
ref|XP_005650009.1|  Nop-domain-containing protein                      286   4e-89    
emb|CDS04923.1|  hypothetical protein LRAMOSA07453                      284   5e-89    
gb|EPY77232.1|  nucleolar protein 58                                    281   6e-89    
gb|EOB03329.1|  Nucleolar protein 5                                     283   6e-89    
ref|XP_009500411.1|  PREDICTED: nucleolar protein 58                    281   6e-89    
ref|XP_009054674.1|  hypothetical protein LOTGIDRAFT_144966             283   7e-89    
ref|XP_005070655.1|  PREDICTED: nucleolar protein 58 isoform X2         285   7e-89    
ref|XP_005070654.1|  PREDICTED: nucleolar protein 58 isoform X1         285   8e-89    
ref|XP_010784446.1|  PREDICTED: nucleolar protein 58 isoform X2         284   1e-88    
ref|XP_010784445.1|  PREDICTED: nucleolar protein 58 isoform X1         284   1e-88    
ref|XP_007610015.1|  PREDICTED: nucleolar protein 58 isoform X2         283   1e-88    
ref|XP_005511378.1|  PREDICTED: nucleolar protein 58                    284   1e-88    
gb|AAB61074.1|  similar to S. cerevisiae SIK1P (PID:g984964)            281   2e-88    
ref|XP_003483763.1|  PREDICTED: nucleolar protein 58                    284   2e-88    
ref|XP_793578.3|  PREDICTED: nucleolar protein 58-like                  275   2e-88    
emb|CCA22673.1|  nucleolar protein NOP5 putative                        282   3e-88    
gb|ERE81087.1|  nucleolar protein 58                                    284   3e-88    
ref|XP_010885076.1|  PREDICTED: nucleolar protein 58                    283   3e-88    
emb|CCI10534.1|  unnamed protein product                                282   3e-88    
ref|XP_003497458.1|  PREDICTED: nucleolar protein 58 isoform X1         283   3e-88    
gb|ERE81088.1|  nucleolar protein 58                                    283   4e-88    
gb|EGW06125.1|  Nucleolar protein 58                                    276   4e-88    
gb|EPZ35482.1|  NOSIC domain-containing protein                         277   4e-88    
ref|XP_005016922.1|  PREDICTED: nucleolar protein 58 isoform X2         282   5e-88    
ref|XP_005016921.1|  PREDICTED: nucleolar protein 58 isoform X1         282   5e-88    
ref|NP_198066.1|  NOP56-like pre RNA processing ribonucleoprotein       280   5e-88    
ref|XP_421942.1|  PREDICTED: nucleolar protein 58                       282   5e-88    
gb|AFW84118.1|  hypothetical protein ZEAMMB73_870642                    284   5e-88    
gb|KFW89632.1|  Nucleolar protein 58                                    282   6e-88    
ref|XP_008671899.1|  PREDICTED: probable nucleolar protein 5-2          279   7e-88    
ref|XP_010711773.1|  PREDICTED: nucleolar protein 58                    282   7e-88    
ref|XP_010303171.1|  PREDICTED: nucleolar protein 58                    279   7e-88    
sp|O04656.2|NOP5C_ARATH  RecName: Full=Putative nucleolar protein...    280   8e-88    
ref|XP_006681446.1|  hypothetical protein BATDEDRAFT_33621              281   1e-87    
gb|AAH87637.1|  Nol5 protein                                            279   1e-87    
ref|XP_010190416.1|  PREDICTED: nucleolar protein 58                    278   1e-87    
gb|KFP74755.1|  Nucleolar protein 58                                    281   1e-87    
gb|KGL80295.1|  Nucleolar protein 58                                    281   1e-87    
ref|XP_009704053.1|  PREDICTED: nucleolar protein 58                    281   2e-87    
gb|KFV18563.1|  Nucleolar protein 58                                    281   2e-87    
gb|KFP67783.1|  Nucleolar protein 58                                    281   2e-87    
ref|XP_009067494.1|  PREDICTED: nucleolar protein 58                    281   2e-87    
gb|KGL97403.1|  Nucleolar protein 58                                    280   2e-87    
ref|XP_010284480.1|  PREDICTED: nucleolar protein 58                    277   2e-87    
gb|KFQ17268.1|  Nucleolar protein 58                                    280   2e-87    
ref|XP_009573536.1|  PREDICTED: nucleolar protein 58                    277   3e-87    
gb|KFZ53794.1|  Nucleolar protein 58                                    280   3e-87    
ref|XP_005306284.1|  PREDICTED: nucleolar protein 58 isoform X2         279   3e-87    
ref|XP_010161415.1|  PREDICTED: nucleolar protein 58                    281   3e-87    
ref|XP_010141276.1|  PREDICTED: nucleolar protein 58                    280   3e-87    
gb|KFP02491.1|  Nucleolar protein 58                                    278   3e-87    
ref|XP_005049217.1|  PREDICTED: nucleolar protein 58                    280   3e-87    
gb|KFR14872.1|  Nucleolar protein 58                                    278   4e-87    
ref|XP_009086324.1|  PREDICTED: nucleolar protein 58                    280   4e-87    
gb|KFO59877.1|  Nucleolar protein 58                                    280   4e-87    
ref|XP_009985382.1|  PREDICTED: nucleolar protein 58                    281   4e-87    
ref|XP_002189225.1|  PREDICTED: nucleolar protein 58                    280   4e-87    
ref|XP_007071996.1|  PREDICTED: nucleolar protein 58                    281   4e-87    
gb|KFZ49164.1|  Nucleolar protein 58                                    280   4e-87    
gb|KFW61788.1|  Nucleolar protein 58                                    280   4e-87    
ref|XP_010022316.1|  PREDICTED: nucleolar protein 58                    276   5e-87    
gb|KFW86979.1|  Nucleolar protein 58                                    279   5e-87    
gb|KFU84958.1|  Nucleolar protein 58                                    280   5e-87    
ref|XP_010405578.1|  PREDICTED: nucleolar protein 58                    280   6e-87    
ref|XP_008633036.1|  PREDICTED: nucleolar protein 58                    280   6e-87    
gb|KFO12035.1|  Nucleolar protein 58                                    279   6e-87    
ref|XP_009950323.1|  PREDICTED: nucleolar protein 58                    276   6e-87    
gb|KFM11174.1|  Nucleolar protein 58                                    279   7e-87    
gb|KFV86118.1|  Nucleolar protein 58                                    279   7e-87    
emb|CEP14638.1|  hypothetical protein                                   278   7e-87    
ref|XP_005306283.1|  PREDICTED: nucleolar protein 58 isoform X1         280   7e-87    
ref|XP_005416180.1|  PREDICTED: nucleolar protein 58                    280   8e-87    
ref|XP_009888542.1|  PREDICTED: nucleolar protein 58                    280   8e-87    
gb|KFQ83091.1|  Nucleolar protein 58                                    279   9e-87    
ref|XP_010563240.1|  PREDICTED: nucleolar protein 58 isoform X2         278   9e-87    
gb|ELT87939.1|  hypothetical protein CAPTEDRAFT_162695                  281   9e-87    
ref|XP_009682520.1|  PREDICTED: nucleolar protein 58                    280   9e-87    
ref|XP_010202697.1|  PREDICTED: nucleolar protein 58                    279   1e-86    
ref|XP_009558103.1|  PREDICTED: nucleolar protein 58                    279   1e-86    
ref|XP_008947581.1|  PREDICTED: nucleolar protein 58                    281   1e-86    
gb|EFX84998.1|  hypothetical protein DAPPUDRAFT_300779                  279   1e-86    
gb|KFH73769.1|  hypothetical protein MVEG_00983                         278   1e-86    
ref|XP_010217344.1|  PREDICTED: nucleolar protein 58                    280   1e-86    
ref|XP_973420.1|  PREDICTED: nucleolar protein 58                       280   1e-86    
gb|KFP26270.1|  Nucleolar protein 58                                    278   1e-86    
gb|KFV10796.1|  Nucleolar protein 58                                    278   1e-86    
gb|KFH64217.1|  hypothetical protein MVEG_10042                         278   1e-86    
gb|KFV64288.1|  Nucleolar protein 58                                    278   1e-86    
ref|XP_009938133.1|  PREDICTED: nucleolar protein 58                    278   1e-86    
ref|XP_009331224.1|  PREDICTED: nucleolar protein 58                    279   2e-86    
ref|XP_009912989.1|  PREDICTED: nucleolar protein 58                    278   2e-86    
ref|XP_009894776.1|  PREDICTED: nucleolar protein 58                    278   2e-86    
gb|KFP19825.1|  Nucleolar protein 58                                    278   2e-86    
gb|KFQ40527.1|  Nucleolar protein 58                                    278   2e-86    
gb|KFO75339.1|  Nucleolar protein 58                                    278   2e-86    
ref|XP_005484291.1|  PREDICTED: nucleolar protein 58                    279   2e-86    
gb|KFQ00730.1|  Nucleolar protein 58                                    278   2e-86    
gb|KFQ74083.1|  Nucleolar protein 58                                    278   2e-86    
ref|XP_010076307.1|  PREDICTED: nucleolar protein 58                    278   2e-86    
ref|XP_010563232.1|  PREDICTED: nucleolar protein 58 isoform X1         278   2e-86    
gb|KFQ94812.1|  Nucleolar protein 58                                    278   3e-86    
gb|KFW02653.1|  Nucleolar protein 58                                    278   3e-86    
ref|XP_010150930.1|  PREDICTED: nucleolar protein 58                    278   3e-86    
ref|XP_009809548.1|  PREDICTED: nucleolar protein 58                    275   3e-86    
ref|XP_010120485.1|  PREDICTED: nucleolar protein 58                    278   3e-86    
gb|KFP42804.1|  Nucleolar protein 58                                    278   3e-86    
ref|XP_010005686.1|  PREDICTED: nucleolar protein 58                    280   3e-86    
ref|XP_008929429.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    278   3e-86    
gb|KFQ66314.1|  Nucleolar protein 58                                    277   3e-86    
ref|XP_009489427.1|  PREDICTED: nucleolar protein 58                    277   4e-86    
gb|KFQ45269.1|  Nucleolar protein 58                                    277   4e-86    
gb|KFP88851.1|  Nucleolar protein 58                                    277   5e-86    
ref|XP_006273562.1|  PREDICTED: nucleolar protein 58                    277   5e-86    
ref|XP_006017720.1|  PREDICTED: nucleolar protein 58                    277   5e-86    
ref|XP_009867823.1|  PREDICTED: nucleolar protein 58                    276   6e-86    
gb|KFQ12269.1|  Nucleolar protein 58                                    276   7e-86    
ref|XP_002179343.1|  predicted protein                                  277   8e-86    
ref|XP_004990291.1|  nucleolar protein 5                                276   9e-86    
gb|KFV52995.1|  Nucleolar protein 58                                    273   9e-86    
gb|KFV47252.1|  Nucleolar protein 58                                    273   1e-85    
ref|XP_009962135.1|  PREDICTED: nucleolar protein 58                    273   1e-85    
ref|XP_011308274.1|  PREDICTED: nucleolar protein 58                    278   1e-85    
ref|XP_009641816.1|  PREDICTED: nucleolar protein 58                    277   1e-85    
gb|EPB89396.1|  hypothetical protein HMPREF1544_03765                   275   1e-85    
ref|XP_005144700.1|  PREDICTED: nucleolar protein 58                    276   2e-85    
dbj|GAN04212.1|  nop-domain-containing protein                          275   2e-85    
ref|XP_003384738.1|  PREDICTED: nucleolar protein 58-like               273   8e-85    
ref|XP_009282980.1|  PREDICTED: nucleolar protein 58                    278   8e-85    
ref|XP_008494188.1|  PREDICTED: nucleolar protein 58                    276   2e-84    
ref|XP_009460634.1|  PREDICTED: nucleolar protein 58                    275   3e-84    
ref|XP_005237133.1|  PREDICTED: nucleolar protein 58                    274   3e-84    
ref|XP_002737742.1|  PREDICTED: nucleolar protein 58-like               273   4e-84    
gb|EHB12153.1|  Nucleolar protein 58                                    265   5e-84    
ref|XP_001750802.1|  hypothetical protein                               271   5e-84    
ref|XP_003870798.1|  Nop5 protein                                       270   6e-84    
ref|XP_005434610.1|  PREDICTED: nucleolar protein 58                    273   7e-84    
ref|XP_002290153.1|  SAR DNA-binding protein                            269   8e-84    
emb|CCE39931.1|  hypothetical protein CPAR2_603490                      271   1e-83    
ref|XP_011432893.1|  PREDICTED: nucleolar protein 58-like               270   2e-83    
ref|XP_003701979.1|  PREDICTED: nucleolar protein 58-like               272   2e-83    
gb|EMD41003.1|  hypothetical protein CERSUDRAFT_71225                   268   2e-83    
ref|XP_011493283.1|  AAEL017437-PA                                      270   3e-83    
ref|XP_008113176.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar pr...    267   4e-83    
ref|XP_002493691.1|  Protein involved in pre-rRNA processing, 18S...    270   4e-83    
ref|XP_003230376.2|  PREDICTED: nucleolar protein 58-like               270   4e-83    
ref|XP_006567771.1|  PREDICTED: nucleolar protein 58-like               271   6e-83    
ref|XP_006618628.1|  PREDICTED: nucleolar protein 58-like               271   6e-83    
ref|XP_455471.1|  hypothetical protein                                  268   1e-82    
gb|ETE66100.1|  Nucleolar protein 58                                    268   1e-82    
gb|KDR23571.1|  Nucleolar protein 58                                    270   2e-82    
ref|XP_007212583.1|  hypothetical protein PRUPE_ppa015915mg             257   2e-82    
ref|XP_011399356.1|  putative nucleolar protein 5-2                     267   3e-82    
ref|XP_002052488.1|  GJ17567                                            267   3e-82    
ref|XP_001864867.1|  nucleolar protein NOP5                             268   4e-82    



>gb|KDO50622.1| hypothetical protein CISIN_1g0088521mg, partial [Citrus sinensis]
 gb|KDO50623.1| hypothetical protein CISIN_1g0088521mg, partial [Citrus sinensis]
Length=396

 Score =   435 bits (1118),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/240 (88%), Positives = 229/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA+LKEAAMISMGTEVSD+DL+NIKELC+QV+S +EYR QLYDYLKSR
Sbjct  62   KLDFSEILPEEVEAQLKEAAMISMGTEVSDLDLLNIKELCDQVLSLAEYRAQLYDYLKSR  121

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  122  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  181

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLA+KTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  182  GLIYHASLVGQAAPKHKGKISRSLASKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  241

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  E  A++D+ E
Sbjct  242  EGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLMENAASKDDEE  301



>emb|CAN73717.1| hypothetical protein VITISV_038844 [Vitis vinifera]
Length=472

 Score =   437 bits (1123),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 220/255 (86%), Positives = 231/255 (91%), Gaps = 4/255 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAAMISMGTEVSD+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAMISMGTEVSDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  E +A  +E E
Sbjct  397  EGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRIEDSAAREEEE  456

Query  37   L----EKMDAEAVKR  5
            +     K + + VKR
Sbjct  457  MIPKKRKKENQKVKR  471



>ref|XP_009769588.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana sylvestris]
Length=559

 Score =   438 bits (1126),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEA+MISMGTEVSD+DL NIK+LC+QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEASMISMGTEVSDLDLENIKDLCSQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL DSQD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALADSQDNTMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            EG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHTE
Sbjct  397  EGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHTE  447



>emb|CBI34244.3| unnamed protein product [Vitis vinifera]
Length=474

 Score =   435 bits (1118),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 225/241 (93%), Gaps = 0/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAAMISMGTEVSD+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAMISMGTEVSDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  E +A  +E E
Sbjct  397  EGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRIEDSAAREEEE  456

Query  37   L  35
            +
Sbjct  457  M  457



>dbj|BAB41076.1| MAR-binding protein [Nicotiana tabacum]
Length=555

 Score =   437 bits (1125),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 214/231 (93%), Positives = 224/231 (97%), Gaps = 0/231 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEA+MISMGTEVSD+DL NIK+LC+QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEASMISMGTEVSDLDLENIKDLCSQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL DSQD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALADSQDNTMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            EG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHTE
Sbjct  397  EGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHTE  447



>ref|XP_006491841.1| PREDICTED: probable nucleolar protein 5-1-like [Citrus sinensis]
Length=551

 Score =   437 bits (1123),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 211/240 (88%), Positives = 229/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA+LKEAAMISMGTEVSD+DL+NIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAQLKEAAMISMGTEVSDLDLLNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLA+KTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLASKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  E  A++D+ E
Sbjct  397  EGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLMENAASKDDEE  456



>ref|XP_006432265.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
 gb|ESR45505.1| hypothetical protein CICLE_v10000758mg [Citrus clementina]
Length=551

 Score =   437 bits (1123),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 211/240 (88%), Positives = 228/240 (95%), Gaps = 0/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA+LKEAAMISMGTEVSD+DL+NIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAQLKEAAMISMGTEVSDLDLLNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLA+KTALAIRYDALGD QD+ MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLASKTALAIRYDALGDGQDNCMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKGPGA+IT AK YNPAADS+LG  E  A++D+ E
Sbjct  397  EGKELGRAAGSAKGKPKIEVYDKDRKKGPGAMITAAKTYNPAADSILGLMENAASKDDEE  456



>gb|KDO43234.1| hypothetical protein CISIN_1g013537mg [Citrus sinensis]
Length=441

 Score =   432 bits (1112),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 229/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  107  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  166

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  167  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  226

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  227  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  286

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSVLG TE  A  D  E
Sbjct  287  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVLGLTENAA--DGNE  344

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  345  VEKASQEIV  353



>ref|XP_009591833.1| PREDICTED: probable nucleolar protein 5-2 [Nicotiana tomentosiformis]
Length=559

 Score =   435 bits (1119),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 213/231 (92%), Positives = 223/231 (97%), Gaps = 0/231 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEA+MISMGTEVSD+DL NIK+LC+QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEASMISMGTEVSDLDLENIKDLCSQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAK ALAIRYDAL DSQD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKAALAIRYDALADSQDNTMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            EG++LG+ AGSAKGKPKIEVYDKDRKKG GALITPAK YNPAADSV+GHTE
Sbjct  397  EGKELGKSAGSAKGKPKIEVYDKDRKKGAGALITPAKVYNPAADSVIGHTE  447



>ref|XP_007208461.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
 gb|EMJ09660.1| hypothetical protein PRUPE_ppa003941mg [Prunus persica]
Length=539

 Score =   434 bits (1116),  Expect = 7e-147, Method: Compositional matrix adjust.
 Identities = 213/232 (92%), Positives = 222/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAAMISMGTEVS++DL+NIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKEAAMISMGTEVSELDLINIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD+QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDNQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEP  62
            EGR+LGR AGSAKGKPKIEVYDKDRKKG G LIT AKAYNPAADSVLG T P
Sbjct  397  EGRELGRFAGSAKGKPKIEVYDKDRKKGAGGLITAAKAYNPAADSVLGQTTP  448



>ref|XP_006436388.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
 gb|ESR49628.1| hypothetical protein CICLE_v10031140mg [Citrus clementina]
Length=552

 Score =   434 bits (1115),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 229/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSVLG TE  A  D  E
Sbjct  397  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVLGLTENAA--DGNE  454

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  455  VEKASQEIV  463



>ref|XP_002273273.2| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
 ref|XP_010659961.1| PREDICTED: probable nucleolar protein 5-2 [Vitis vinifera]
Length=573

 Score =   434 bits (1116),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 225/241 (93%), Gaps = 0/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAAMISMGTEVSD+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAMISMGTEVSDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNPAADSVLG  E +A  +E E
Sbjct  397  EGRELGHSAGSAKGKPKIEVYDKDRKKGSGALITAAKTYNPAADSVLGRIEDSAAREEEE  456

Query  37   L  35
            +
Sbjct  457  M  457



>ref|XP_008218165.1| PREDICTED: probable nucleolar protein 5-2 [Prunus mume]
Length=538

 Score =   432 bits (1112),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/232 (91%), Positives = 222/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELK+AAMISMGTEVS++DL+NIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKDAAMISMGTEVSELDLINIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD+QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDNQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEP  62
            EGR+LGR AGSAKGKPKIEVYDKDRKKG G LIT AKAYNPAADSVLG T P
Sbjct  397  EGRELGRFAGSAKGKPKIEVYDKDRKKGAGGLITAAKAYNPAADSVLGQTTP  448



>ref|XP_006468095.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Citrus 
sinensis]
Length=573

 Score =   433 bits (1114),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 228/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G TE  A  D  E
Sbjct  397  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLTENAA--DGNE  454

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  455  VEKASEEIV  463



>ref|XP_006468094.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Citrus 
sinensis]
Length=549

 Score =   432 bits (1111),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 228/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G TE  A  D  E
Sbjct  397  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLTENAA--DGNE  454

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  455  VEKASEEIV  463



>ref|XP_006468097.1| PREDICTED: probable nucleolar protein 5-2-like isoform X4 [Citrus 
sinensis]
Length=588

 Score =   434 bits (1115),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 228/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G TE  A  D  E
Sbjct  397  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLTENAA--DGNE  454

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  455  VEKASEEIV  463



>ref|XP_006468096.1| PREDICTED: probable nucleolar protein 5-2-like isoform X3 [Citrus 
sinensis]
Length=565

 Score =   432 bits (1111),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 228/249 (92%), Gaps = 2/249 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEAAMISMGTEVSD+DL+NIKELCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAGLKEAAMISMGTEVSDLDLLNIKELCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAKTALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKTALAIRCDALGDDQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++L R AGSAKGKPK+EVYDKDRKKGPGA+IT AK YNPAADSV G TE  A  D  E
Sbjct  397  EGKELSRAAGSAKGKPKLEVYDKDRKKGPGAMITAAKTYNPAADSVFGLTENAA--DGNE  454

Query  37   LEKMDAEAV  11
            +EK   E V
Sbjct  455  VEKASEEIV  463



>ref|XP_010243588.1| PREDICTED: probable nucleolar protein 5-1 [Nelumbo nucifera]
Length=577

 Score =   430 bits (1105),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 215/241 (89%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEVSD+DLMNIK+LC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAVISMGTEVSDLDLMNIKDLCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIFHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-EPTANEDEP  41
            EGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YN AADSVLG T EP A + E 
Sbjct  397  EGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTAADSVLGRTAEPVAEKLEK  456

Query  40   E  38
            E
Sbjct  457  E  457



>ref|XP_006362168.1| PREDICTED: probable nucleolar protein 5-2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006362169.1| PREDICTED: probable nucleolar protein 5-2-like isoform X2 [Solanum 
tuberosum]
Length=548

 Score =   424 bits (1089),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 208/231 (90%), Positives = 219/231 (95%), Gaps = 2/231 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEA LKEA+MISMGTEVSD+DL NIK+LC QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAALKEASMISMGTEVSDLDLENIKDLCTQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL DSQD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALADSQDNTMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            EG++L + AGSAKGKPKIEVYDKDRKK  G LITPAK YNP+ADSV+GHTE
Sbjct  397  EGKELSKSAGSAKGKPKIEVYDKDRKK--GGLITPAKVYNPSADSVMGHTE  445



>gb|KJB26510.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=409

 Score =   418 bits (1074),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/238 (87%), Positives = 222/238 (93%), Gaps = 1/238 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  59   KLDFSEILPEEVETELKEAAVISMGTEVNDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  118

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  119  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  178

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  179  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  238

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T  +   DE
Sbjct  239  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQTTNSGALDE  295



>ref|XP_011099781.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=583

 Score =   422 bits (1085),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/237 (88%), Positives = 221/237 (93%), Gaps = 0/237 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAELKEAAMISMGTEVSD+DL NIK+LCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILQEEVEAELKEAAMISMGTEVSDLDLENIKDLCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAK ALAIR DALGD +D++MGLENRAKLEARLR+L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKAALAIRCDALGDGEDNSMGLENRAKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EGR+LGR AGS KGKPKIEVYDKDRKKG G LITPAK YNPAADSVLG TE  + ++
Sbjct  397  EGRELGRSAGSVKGKPKIEVYDKDRKKGSGGLITPAKTYNPAADSVLGLTESLSKDE  453



>ref|XP_004239682.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
 ref|XP_010321330.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=513

 Score =   420 bits (1079),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/228 (89%), Positives = 217/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAAMISMGTEVSD+DL NIK+LC+QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAMISMGTEVSDLDLENIKDLCSQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLTNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKI+RSLA+K +LAIRYDALGD QD+TMGLENR KLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKIARSLASKASLAIRYDALGDGQDNTMGLENRVKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LG+ AGSAKGKPKIE YDKDRKKG GALITPAK YNP+AD+VLG
Sbjct  397  EGKELGKSAGSAKGKPKIEAYDKDRKKGAGALITPAKVYNPSADAVLG  444



>ref|XP_010546633.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=563

 Score =   421 bits (1082),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/230 (89%), Positives = 220/230 (96%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAA+ISMGTE+SD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAVISMGTEISDLDLIHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHNTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAKTALA+R DALGDSQD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKTALAVRCDALGDSQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EGRDLGRL+GSAKGKPKIE YDKD+K G GALITPAK YN AADS+LG T
Sbjct  397  EGRDLGRLSGSAKGKPKIEAYDKDKKAGSGALITPAKTYNTAADSLLGQT  446



>ref|XP_011099778.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099779.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
 ref|XP_011099780.1| PREDICTED: probable nucleolar protein 5-2 [Sesamum indicum]
Length=585

 Score =   421 bits (1083),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 221/240 (92%), Gaps = 0/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVE ELKEAAMISMGTEVSD+DL NIK+LCNQV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILQEEVETELKEAAMISMGTEVSDLDLENIKDLCNQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAK ALAIR DALGD +D++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKAALAIRCDALGDGEDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR  GSAKGKPKIE YDKDRKKG G LITPAK YNPAADS+LG TE  + +D+ E
Sbjct  397  EGKELGRSVGSAKGKPKIEFYDKDRKKGSGGLITPAKTYNPAADSILGLTESLSKKDKYE  456



>gb|KJB26512.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=531

 Score =   419 bits (1078),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  181  KLDFSEILPEEVETELKEAAVISMGTEVNDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  240

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  241  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  300

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  301  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  360

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T  +   DE +
Sbjct  361  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQTTNSGALDEQD  419



>ref|XP_011013586.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011013588.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   420 bits (1080),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 207/241 (86%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAAMISMG++VSD+DLMNIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAMISMGSDVSDVDLMNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL+YHASL+GQA PK KGKISRSLAAK+ALAIRYDALGD+QD +MGLENR KLEARLRNL
Sbjct  337  GLLYHASLVGQAPPKMKGKISRSLAAKSALAIRYDALGDAQDDSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-EPTANEDEP  41
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T + TA + E 
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTPDSTARKFEV  456

Query  40   E  38
            E
Sbjct  457  E  457



>ref|XP_010025094.1| PREDICTED: probable nucleolar protein 5-2 [Eucalyptus grandis]
 gb|KCW61686.1| hypothetical protein EUGRSUZ_H04416 [Eucalyptus grandis]
Length=579

 Score =   421 bits (1081),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 212/251 (84%), Positives = 228/251 (91%), Gaps = 2/251 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFS ILPEEVEAELK A+ ISMGTEVSD+DL+NI+ELC+QV+S SEYRGQLYDYLKSR
Sbjct  217  KLDFSGILPEEVEAELKAASEISMGTEVSDLDLLNIRELCDQVLSLSEYRGQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIRYDALGD++D++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDTEDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA--NEDE  44
            EGR+LG  AGSAKGKPKIEVYDKDRKKG GALIT AK YNP+ADS LG T   A  N +E
Sbjct  397  EGRELGHSAGSAKGKPKIEVYDKDRKKGAGALITAAKTYNPSADSTLGQTLNNAAGNGEE  456

Query  43   PELEKMDAEAV  11
             E +K   E+V
Sbjct  457  AEKKKRKTESV  467



>emb|CAK22424.1| matrix attachment region binding protein [Beta vulgaris]
Length=572

 Score =   420 bits (1079),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEEVE  LKEAAMISMGTEVSD+DL+NIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEVETGLKEAAMISMGTEVSDLDLLNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD+ D+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDNPDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LGR AGSAKGKP+IEVYDKD KKG GALIT AK YNPAADS+LG
Sbjct  397  EGKELGRSAGSAKGKPQIEVYDKDHKKGAGALITAAKTYNPAADSILG  444



>gb|KJB26509.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=567

 Score =   420 bits (1079),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 208/240 (87%), Positives = 223/240 (93%), Gaps = 1/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAVISMGTEVNDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSVLG T  +   DE +
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVLGQTTNSGALDEQD  455



>ref|XP_011032532.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032533.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
 ref|XP_011032534.1| PREDICTED: probable nucleolar protein 5-1 [Populus euphratica]
Length=562

 Score =   419 bits (1078),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAAMISMG++VSD+DLMNIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAMISMGSDVSDVDLMNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL+YHASL+GQA PK KGKISRSLAAK+ALAIRYDALGD+QD +MGLENR KLEARLRNL
Sbjct  337  GLLYHASLVGQAPPKMKGKISRSLAAKSALAIRYDALGDAQDDSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-EPTANEDEP  41
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T + TA + E 
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTPDSTARKFEV  456

Query  40   E  38
            E
Sbjct  457  E  457



>ref|XP_010687356.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=572

 Score =   420 bits (1079),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/228 (90%), Positives = 218/228 (96%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEEVE  LKEAAMISMGTEVSD+DL+NIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEVETGLKEAAMISMGTEVSDLDLLNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD+ D+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDNPDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LGR AGSAKGKP+IEVYDKD KKG GALIT AK YNPAADS+LG
Sbjct  397  EGKELGRSAGSAKGKPQIEVYDKDHKKGAGALITAAKTYNPAADSILG  444



>ref|XP_004247627.1| PREDICTED: probable nucleolar protein 5-2 [Solanum lycopersicum]
Length=547

 Score =   419 bits (1077),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 205/230 (89%), Positives = 217/230 (94%), Gaps = 2/230 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE  LKEA+MISMGTEVSD+DL NIK+LC QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETALKEASMISMGTEVSDLDLENIKDLCTQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL DSQD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALADSQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG++L + AGSAKGKPKIEVYDKDRKK  G LITPAK YNP+ADSV+GHT
Sbjct  397  EGKELSKSAGSAKGKPKIEVYDKDRKK--GGLITPAKVYNPSADSVMGHT  444



>ref|XP_010422824.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=554

 Score =   419 bits (1077),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 203/237 (86%), Positives = 224/237 (95%), Gaps = 1/237 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EE+EA+LKEAA+ISMGTEVSD+DL++I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILSEEIEADLKEAAVISMGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR+DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRFDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T P  +ED
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLLGQT-PAKSED  452



>gb|KHN25404.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=553

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEILPEEVEAELKEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSRM
Sbjct  218  LDFSEILPEEVEAELKEASVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTAMVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGDSQD+TMGLENRAKLEARLRNLE
Sbjct  338  LIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDSQDNTMGLENRAKLEARLRNLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEPE  38
            G++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G    +A +ED  E
Sbjct  398  GKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQMVNSAMDEDAQE  457



>ref|XP_003540996.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
Length=556

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 206/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEILPEEVEAELKEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSRM
Sbjct  218  LDFSEILPEEVEAELKEASVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTAMVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGDSQD+TMGLENRAKLEARLRNLE
Sbjct  338  LIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDSQDNTMGLENRAKLEARLRNLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEPE  38
            G++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G    +A +ED  E
Sbjct  398  GKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQMVNSAMDEDAQE  457



>gb|KDP35364.1| hypothetical protein JCGZ_10348 [Jatropha curcas]
Length=565

 Score =   418 bits (1075),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 221/238 (93%), Gaps = 0/238 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILP+EVEAELKEAAMISMGTEVSD+DL+NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPDEVEAELKEAAMISMGTEVSDVDLLNIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL++HASL+GQA+ K KGKISRSLAAK ALAIRYDALGD QD++MGLENR KLEARLRNL
Sbjct  337  GLLFHASLVGQASSKMKGKISRSLAAKAALAIRYDALGDGQDNSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            EG++L R AGSAKGKPKIE YDKDRKKG GAL+T AK YNP+ADSVLG T  T N++E
Sbjct  397  EGKELSRSAGSAKGKPKIEAYDKDRKKGAGALLTAAKTYNPSADSVLGQTVSTGNDEE  454



>gb|KHG01259.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=548

 Score =   417 bits (1073),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/240 (86%), Positives = 222/240 (93%), Gaps = 1/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAVISMGTEVNDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK+YNPAADSV G T  +   DE +
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKSYNPAADSVRGQTTSSGALDEQD  455



>ref|XP_010485906.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
 ref|XP_010485908.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=535

 Score =   417 bits (1071),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 224/237 (95%), Gaps = 1/237 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EE+EA+LKEAA+ISMGTEVSD+DL++I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILSEEIEADLKEAAVISMGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGAR I+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARPISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK+ALAIR+DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKSALAIRFDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T P  +ED
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLLGQT-PAKSED  452



>ref|XP_010550954.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
 ref|XP_010550955.1| PREDICTED: probable nucleolar protein 5-2 [Tarenaya hassleriana]
Length=539

 Score =   417 bits (1072),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 204/234 (87%), Positives = 218/234 (93%), Gaps = 0/234 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLD SEILPEEVEAELKEAA+ISMGTEVSD+DLM+I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDLSEILPEEVEAELKEAAVISMGTEVSDLDLMHIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHNTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA  56
            EGRDLGRL+GS+KGKPKIE YDKD+K G GALITPAK YN AADS LG T  +A
Sbjct  397  EGRDLGRLSGSSKGKPKIEAYDKDKKAGSGALITPAKTYNTAADSFLGQTPKSA  450



>ref|XP_006382714.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 ref|XP_006382715.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60511.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
 gb|ERP60512.1| hypothetical protein POPTR_0005s04710g [Populus trichocarpa]
Length=562

 Score =   417 bits (1073),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 206/241 (85%), Positives = 224/241 (93%), Gaps = 1/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAAMISMG++VSD+DLMNIKELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAMISMGSDVSDVDLMNIKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL+YHASL+GQA PK KGKISRSLAAK+ALAIRYDALGD+QD +MGLENR KLEARLRNL
Sbjct  337  GLLYHASLVGQAPPKLKGKISRSLAAKSALAIRYDALGDAQDDSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-EPTANEDEP  41
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+VLG T + TA + E 
Sbjct  397  EGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVLGQTPDSTARKFEV  456

Query  40   E  38
            E
Sbjct  457  E  457



>ref|XP_010241470.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241474.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010241483.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   417 bits (1073),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 207/243 (85%), Positives = 221/243 (91%), Gaps = 6/243 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEVSD+DLMNI++LC+QV++ SEYR QLYDYLKSR
Sbjct  221  KLDFSEILPEEVETELKEAAVISMGTEVSDLDLMNIRDLCDQVLALSEYRAQLYDYLKSR  280

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MN IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  281  MNAIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  340

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  341  GLIFHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  400

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YN +ADS+LG T       EP 
Sbjct  401  EGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTSADSILGRTT------EPV  454

Query  37   LEK  29
            +EK
Sbjct  455  IEK  457



>ref|XP_010241493.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Nelumbo 
nucifera]
Length=580

 Score =   417 bits (1073),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 207/243 (85%), Positives = 221/243 (91%), Gaps = 6/243 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEVSD+DLMNI++LC+QV++ SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAVISMGTEVSDLDLMNIRDLCDQVLALSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MN IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNAIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIFHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+L R AGS KGKPKIE YDKDRKKG GALITPAK YN +ADS+LG T       EP 
Sbjct  397  EGRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNTSADSILGRTT------EPV  450

Query  37   LEK  29
            +EK
Sbjct  451  IEK  453



>ref|XP_003537858.1| PREDICTED: probable nucleolar protein 5-2-like [Glycine max]
 gb|KHN39811.1| Putative nucleolar protein 5-2 [Glycine soja]
Length=551

 Score =   416 bits (1070),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 205/240 (85%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEILPEEVEAELKEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSRM
Sbjct  218  LDFSEILPEEVEAELKEASVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTAMVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNLE
Sbjct  338  LIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEPE  38
            G++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+ADSV+G    +A +ED  E
Sbjct  398  GKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADSVIGQMVDSAIDEDAQE  457



>gb|KDP23603.1| hypothetical protein JCGZ_23436 [Jatropha curcas]
Length=577

 Score =   416 bits (1069),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 209/251 (83%), Positives = 227/251 (90%), Gaps = 4/251 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPE+VEAELKEA++ISMGTEVS++DLMNI+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEDVEAELKEASLISMGTEVSEVDLMNIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASL+GQAA K KGKISRSLAAK ALAIRYDA GD QD++MGLENRAKLEARLRNL
Sbjct  337  GLIFHASLVGQAAAKTKGKISRSLAAKAALAIRYDAFGDGQDNSMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA---NED  47
            EGR+L R AGSAKGKPKIE YDKDRKKG G LITPAKAYNPAAD+VLG T P A   N +
Sbjct  397  EGRELSRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKAYNPAADAVLGQT-PNATDGNGE  455

Query  46   EPELEKMDAEA  14
            E   +K D EA
Sbjct  456  EIVPKKRDNEA  466



>gb|KJB82560.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82561.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82562.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82564.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82565.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
 gb|KJB82566.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=564

 Score =   415 bits (1067),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 204/240 (85%), Positives = 221/240 (92%), Gaps = 1/240 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEEVE ELKEAA+ISMGTE+SD+DLMNIK+LC+QV++ SEYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEVETELKEAAVISMGTEISDLDLMNIKDLCDQVLNLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADSVL     TA  DE +
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSVLSQITNTAALDEQD  455



>ref|XP_003611089.1| SAR DNA-binding protein-1 [Medicago truncatula]
Length=480

 Score =   412 bits (1059),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 205/246 (83%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAELKEAA+ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  107  KLDFSEILTEEVEAELKEAAVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSR  166

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  167  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  226

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  227  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNL  286

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEP  41
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADS++     +A +ED  
Sbjct  287  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSIIDKKSDSAMDEDTE  346

Query  40   ELEKMD  23
            EL   D
Sbjct  347  ELSAAD  352



>ref|XP_006394992.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
 gb|ESQ32278.1| hypothetical protein EUTSA_v10003966mg [Eutrema salsugineum]
Length=536

 Score =   414 bits (1063),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 203/238 (85%), Positives = 221/238 (93%), Gaps = 1/238 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVE ELKEAA+ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEGELKEAAVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T P A+  E
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNSAADSLLGQT-PKADSAE  453



>ref|XP_006297275.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
 gb|EOA30173.1| hypothetical protein CARUB_v10013290mg, partial [Capsella rubella]
Length=593

 Score =   415 bits (1067),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 201/237 (85%), Positives = 224/237 (95%), Gaps = 1/237 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EE+EA+LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  252  KLDFSEILAEEIEADLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  311

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  312  MNTVAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  371

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK+ALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  372  GLIYHASVVGQAAPKHKGKISRSLAAKSALAIRVDALGDGQDNTMGLENRAKLEARLRNL  431

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG T P  +ED
Sbjct  432  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLLGQT-PAKSED  487



>ref|XP_008388628.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=552

 Score =   414 bits (1063),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 205/242 (85%), Positives = 222/242 (92%), Gaps = 1/242 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELK+AAMISMGTEVS++DLMNIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKDAAMISMGTEVSELDLMNIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+AAPK KGKISRSLA+K ALAIR DALGDSQD++MG+EN  KLEARLRNL
Sbjct  337  GLIYHASLIGKAAPKLKGKISRSLASKAALAIRVDALGDSQDNSMGVENYQKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAAD+VLG T P+ N ++P 
Sbjct  397  EGRELGHFAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADAVLGKTTPS-NXEKPX  455

Query  37   LE  32
             E
Sbjct  456  AE  457



>ref|XP_010464014.1| PREDICTED: probable nucleolar protein 5-2 [Camelina sativa]
Length=553

 Score =   413 bits (1062),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 199/237 (84%), Positives = 224/237 (95%), Gaps = 1/237 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EE+EA+LKEAA+ISMGTEVSD+DL++I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILAEEIEADLKEAAVISMGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGG LLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLISHGGCLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGK+SRSLAAK+ALAIR+DALGD QD+TMGLE+RAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKMSRSLAAKSALAIRFDALGDGQDNTMGLEHRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+LG  +P  +ED
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLLGQ-KPAKSED  452



>ref|XP_006345813.1| PREDICTED: probable nucleolar protein 5-2-like [Solanum tuberosum]
Length=541

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAELKEAAMISMGTEVSD+DL NIK+LC+QV+SFSEYR QLYDYLKSR
Sbjct  217  KLDFSEILLEEVEAELKEAAMISMGTEVSDLDLENIKDLCSQVLSFSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKI+RSLA+K +LAIRYDALGD QD+TMGLENR KLE RLR L
Sbjct  337  GLIYHASLIGQAAPKHKGKIARSLASKASLAIRYDALGDGQDNTMGLENRVKLEVRLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEP  41
            EG++LG+ AGSAKGKPKIE YDKDRKKG GALITPAK YN +AD+VLG T   + ++ P
Sbjct  397  EGKELGKSAGSAKGKPKIEAYDKDRKKGAGALITPAKVYNLSADAVLGCTNNESVDEPP  455



>ref|XP_003611088.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES94046.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=590

 Score =   414 bits (1063),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 205/246 (83%), Positives = 221/246 (90%), Gaps = 1/246 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAELKEAA+ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILTEEVEAELKEAAVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEP  41
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADS++     +A +ED  
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSIIDKKSDSAMDEDTE  456

Query  40   ELEKMD  23
            EL   D
Sbjct  457  ELSAAD  462



>gb|EYU23803.1| hypothetical protein MIMGU_mgv1a003693mg [Erythranthe guttata]
Length=569

 Score =   413 bits (1061),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 220/239 (92%), Gaps = 0/239 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVEAELKEA+ ISMGTEVSD+DL NIK+LCNQVIS +EYR QL+DYLKSRM
Sbjct  244  LDFSEILQEEVEAELKEASNISMGTEVSDMDLDNIKDLCNQVISLAEYRAQLFDYLKSRM  303

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N+IAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  304  NSIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKYG  363

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPKHKGKISRSLAAK ALAIR DALG+ +D++MGLE+R KLEARLRNLE
Sbjct  364  LIYHASLIGQAAPKHKGKISRSLAAKAALAIRCDALGEGEDNSMGLESRLKLEARLRNLE  423

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            G++LGR AGSAKGKPKIE YDKDRKKG G +ITPAK YNPAADS+LG TE  +N D+ E
Sbjct  424  GKELGRSAGSAKGKPKIEFYDKDRKKGSGGMITPAKTYNPAADSILGLTESLSNNDKDE  482



>ref|XP_010938712.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=600

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 221/242 (91%), Gaps = 2/242 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            +LDFSEIL EE EAELKEAA+ISMGTEVSD+DL NI++LC+QV+S SEYR QLYDYL+SR
Sbjct  217  QLDFSEILSEETEAELKEAAVISMGTEVSDLDLANIRDLCDQVLSLSEYRAQLYDYLRSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD+TMGLENRAKLEARLR L
Sbjct  337  GLIFHASLIGQAAPKLKGKISRSLAAKTALAIRYDALGDGQDNTMGLENRAKLEARLRVL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTA-NEDE  44
            EGR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+ D VLG  TEP A + DE
Sbjct  397  EGRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSTDLVLGQSTEPAAKSADE  456

Query  43   PE  38
             E
Sbjct  457  QE  458



>ref|XP_002319598.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
 gb|EEE95521.1| hypothetical protein POPTR_0013s03260g [Populus trichocarpa]
Length=561

 Score =   412 bits (1059),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 199/230 (87%), Positives = 215/230 (93%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAA+ISMG++VSD+DLMNIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVEAELKEAAVISMGSDVSDVDLMNIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL+YHASL+GQA PK KGK+SRSLAAK AL IRYDALGD QD +MGLENR KLEARLRNL
Sbjct  337  GLLYHASLVGQAPPKMKGKMSRSLAAKAALTIRYDALGDGQDDSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD++LG T
Sbjct  397  EGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAILGQT  446



>ref|XP_008796213.1| PREDICTED: probable nucleolar protein 5-2 isoform X2 [Phoenix 
dactylifera]
Length=583

 Score =   413 bits (1061),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 207/251 (82%), Positives = 220/251 (88%), Gaps = 6/251 (2%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EE EAELKEAA+ISMGTEVSDIDL NI++LC+QV++ SEYR QLYDYL+SRM
Sbjct  218  LDFSEILSEETEAELKEAAVISMGTEVSDIDLANIRDLCDQVLALSEYRAQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAPK KGKISRSLAAK ALAIRYDALGDSQD+TMGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPKLKGKISRSLAAKAALAIRYDALGDSQDNTMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPEL  35
            GR+L R AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG +       EP  
Sbjct  398  GRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQST------EPAE  451

Query  34   EKMDAEAVKRP  2
               D + V RP
Sbjct  452  RSADEQVVARP  462



>ref|XP_008796212.1| PREDICTED: probable nucleolar protein 5-2 isoform X1 [Phoenix 
dactylifera]
Length=564

 Score =   412 bits (1059),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 207/251 (82%), Positives = 220/251 (88%), Gaps = 6/251 (2%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EE EAELKEAA+ISMGTEVSDIDL NI++LC+QV++ SEYR QLYDYL+SRM
Sbjct  218  LDFSEILSEETEAELKEAAVISMGTEVSDIDLANIRDLCDQVLALSEYRAQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAPK KGKISRSLAAK ALAIRYDALGDSQD+TMGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPKLKGKISRSLAAKAALAIRYDALGDSQDNTMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPEL  35
            GR+L R AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG +       EP  
Sbjct  398  GRELSRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQST------EPAE  451

Query  34   EKMDAEAVKRP  2
               D + V RP
Sbjct  452  RSADEQVVARP  462



>ref|NP_187157.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|Q9MAB3.1|NOP5B_ARATH RecName: Full=Probable nucleolar protein 5-2; AltName: Full=MAR-binding 
NOP56/58 homolog 2; AltName: Full=Nucleolar protein 
58-2 [Arabidopsis thaliana]
 gb|AAF27012.1|AC009177_2 putative SAR DNA-binding protein-1 [Arabidopsis thaliana]
 gb|AAG40837.1|AF302491_1 NOP58-like protein [Arabidopsis thaliana]
 gb|AAL06533.1|AF412080_1 AT3g05060/T12H1_2 [Arabidopsis thaliana]
 gb|AEE74181.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   411 bits (1056),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 219/230 (95%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EA+LK+AA+ISMGTEVSD+DL++I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  218  KLDFSEILADEIEADLKDAAVISMGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASL+GQAAPKHKGKISRSLAAKT LAIR DALGDSQD+TMGLENRAKLEARLRNL
Sbjct  338  GLIFHASLVGQAAPKHKGKISRSLAAKTVLAIRVDALGDSQDNTMGLENRAKLEARLRNL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GS+KGKPKIEVY+KD+K G G LITPAK YN AADS+LG T
Sbjct  398  EGKDLGRLSGSSKGKPKIEVYNKDKKMGSGGLITPAKTYNTAADSLLGET  447



>ref|XP_008370662.1| PREDICTED: probable nucleolar protein 5-2 [Malus domestica]
Length=553

 Score =   411 bits (1057),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 203/236 (86%), Positives = 217/236 (92%), Gaps = 0/236 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELK+AAMISMGTEVS++DLMNIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKDAAMISMGTEVSELDLMNIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+AAPK KGKISRSLA+K ALAIR DALGD QD++MG+EN  KLEARLRNL
Sbjct  337  GLIYHASLIGKAAPKLKGKISRSLASKAALAIRVDALGDGQDNSMGVENYQKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAADSVLG T P+  E
Sbjct  397  EGRELGHHAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADSVLGKTTPSKTE  452



>ref|XP_009411704.1| PREDICTED: probable nucleolar protein 5-1 [Musa acuminata subsp. 
malaccensis]
Length=588

 Score =   412 bits (1059),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 224/252 (89%), Gaps = 7/252 (3%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSE+L E+ EAELKEAA+ISMGTEVSD+DL NIKELC+QV++ SEYR QLYDYLKSRM
Sbjct  218  LDFSEVLSEDTEAELKEAAVISMGTEVSDLDLANIKELCDQVLALSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD+TMGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPKIKGKISRSLAAKTALAIRYDALGDGQDNTMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPEL  35
            GR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD VLG T       +P  
Sbjct  398  GRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVLGQTT------DPAP  451

Query  34   EKMDAE-AVKRP  2
            +K D+E  V RP
Sbjct  452  KKPDSEHEVARP  463



>ref|XP_006408115.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
 gb|ESQ49568.1| hypothetical protein EUTSA_v10020473mg [Eutrema salsugineum]
Length=541

 Score =   410 bits (1055),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 197/230 (86%), Positives = 217/230 (94%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK  LAIR DALGD +D+TMG+ENRAKLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAVLAIRCDALGDGEDNTMGIENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G L TPAK YN AADS+LG T
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLFTPAKTYNSAADSLLGQT  446



>ref|XP_009382561.1| PREDICTED: probable nucleolar protein 5-2 [Musa acuminata subsp. 
malaccensis]
Length=585

 Score =   412 bits (1058),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/229 (89%), Positives = 213/229 (93%), Gaps = 0/229 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSE+L EE EAELKEAA+ISMGTEVSD+DL NIKELC+QV++ SEYR QLYDYLKSRM
Sbjct  218  LDFSEVLSEETEAELKEAAVISMGTEVSDLDLANIKELCDQVLALSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAPK KGKISRSLAAKTALAIRYDALGD QD+TMGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPKIKGKISRSLAAKTALAIRYDALGDGQDNTMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            GR+LGR AGS KGKPKIE YDKDRKKG GALITPAK YNP+AD V G T
Sbjct  398  GRELGRSAGSTKGKPKIEFYDKDRKKGAGALITPAKTYNPSADLVFGQT  446



>ref|XP_011003824.1| PREDICTED: probable nucleolar protein 5-2 [Populus euphratica]
Length=563

 Score =   411 bits (1056),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/230 (86%), Positives = 215/230 (93%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAA+ISMG++VSD+DLMNIKELC+QV+S +EYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVEAELKEAAVISMGSDVSDVDLMNIKELCDQVLSLAEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL+YHASL+GQA PK KGK+SRSLAAK AL IRYDALGD QD +MGLENR KLEARLRNL
Sbjct  337  GLLYHASLVGQAPPKMKGKMSRSLAAKAALTIRYDALGDGQDDSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD++LG T
Sbjct  397  EGKELGRSAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAILGQT  446



>gb|KHG00213.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
 gb|KHG00214.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=562

 Score =   410 bits (1055),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/251 (82%), Positives = 227/251 (90%), Gaps = 5/251 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEE E ELKEAA+ISMGTE+SD+DL NIK+LC+QV++ SEYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEFETELKEAAVISMGTEISDLDLTNIKDLCDQVLNLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA--NEDE  44
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADSVL     TA  NE +
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSVLSQITNTAALNEQD  455

Query  43   --PELEKMDAE  17
              P+ +K++AE
Sbjct  456  TVPKKKKVEAE  466



>ref|XP_004139213.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 ref|XP_004156444.1| PREDICTED: probable nucleolar protein 5-2-like isoform 2 [Cucumis 
sativus]
 gb|KGN60839.1| hypothetical protein Csa_2G012710 [Cucumis sativus]
Length=544

 Score =   410 bits (1053),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEA+MISMGTEVS++DL+NIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEIELKEASMISMGTEVSELDLINIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLR+L
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LG +AGSAKGKP+IE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  397  EGKELGHVAGSAKGKPRIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  444



>gb|KJB45047.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
 gb|KJB45048.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=567

 Score =   410 bits (1054),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 223/239 (93%), Gaps = 2/239 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE E+KEAA+ISMGTE++D+DL+NIKELC+QV++ +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETEVKEAAVISMGTEINDLDLINIKELCDQVLNLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADS++G  T  TA E++
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSLIGQITNSTALEEQ  454



>ref|XP_008455669.1| PREDICTED: probable nucleolar protein 5-2 [Cucumis melo]
 gb|ADN33903.1| MAR-binding protein [Cucumis melo subsp. melo]
Length=554

 Score =   410 bits (1053),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE+ELKEA+MISMGTEVS++DL+NIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVESELKEASMISMGTEVSELDLINIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLE+RAKLEARLR+L
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRCDALGDGQDNTMGLESRAKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LG +AGSAKGKPKIE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  397  EGKELGHVAGSAKGKPKIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  444



>ref|XP_008799299.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
 ref|XP_008799300.1| PREDICTED: probable nucleolar protein 5-2 [Phoenix dactylifera]
Length=497

 Score =   407 bits (1047),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 205/250 (82%), Positives = 224/250 (90%), Gaps = 1/250 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVE ELK +A ISMGTEVSD+DL NIK+LC+QV+S SEYR QLYDYL+SRM
Sbjct  218  LDFSEILSEEVETELKASAEISMGTEVSDLDLANIKDLCDQVLSLSEYRAQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAP+ KGKISRSLAAKTALA+RYDALGDSQD+TMGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPRFKGKISRSLAAKTALAVRYDALGDSQDNTMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT-EPTANEDEPE  38
            GR+LGR AGS+KGKPKIEVYDKDRKKG GALIT AK YNP++D VLG T EP+  ++   
Sbjct  398  GRELGRSAGSSKGKPKIEVYDKDRKKGAGALITAAKTYNPSSDLVLGGTIEPSGEQERAP  457

Query  37   LEKMDAEAVK  8
             +K   E V+
Sbjct  458  SKKRKHEDVE  467



>ref|XP_007030687.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
 gb|EOY11189.1| NOP56-like pre RNA processing ribonucleoprotein isoform 2, partial 
[Theobroma cacao]
Length=536

 Score =   409 bits (1050),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 221/243 (91%), Gaps = 1/243 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVE ELKEAA+ISMGTEV+D+DL ++KELC+QV+S +EYR QLYDYLKSR
Sbjct  214  KLDFSEILLEEVETELKEAAVISMGTEVNDLDLTSLKELCDQVLSLAEYRAQLYDYLKSR  273

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  274  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  333

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  334  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRTL  393

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K YNPAADS+LG T P   +  P+
Sbjct  394  EGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVKTYNPAADSLLGQTTPDEQDTVPK  452

Query  37   LEK  29
             +K
Sbjct  453  KKK  455



>ref|XP_004139212.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
 ref|XP_004156443.1| PREDICTED: probable nucleolar protein 5-2-like isoform 1 [Cucumis 
sativus]
Length=566

 Score =   410 bits (1053),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/228 (89%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEA+MISMGTEVS++DL+NIKELC+QV+S SEYR QLYDYLKSR
Sbjct  239  KLDFSEILPEEVEIELKEASMISMGTEVSELDLINIKELCDQVLSLSEYRAQLYDYLKSR  298

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  299  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  358

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLR+L
Sbjct  359  GLIYHASLIGQAAPKLKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRSL  418

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LG +AGSAKGKP+IE YDKDRKK  G LIT AK YNPAADS+LG
Sbjct  419  EGKELGHVAGSAKGKPRIEAYDKDRKKSIGGLITAAKTYNPAADSLLG  466



>ref|XP_010674932.1| PREDICTED: probable nucleolar protein 5-2 [Beta vulgaris subsp. 
vulgaris]
Length=581

 Score =   410 bits (1054),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 201/228 (88%), Positives = 215/228 (94%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPE+VE  LKEA+MISMGTEVSD+DL NIK+LC+QV+S +E R QLYDYLKSR
Sbjct  217  KLDFSEILPEDVEIALKEASMISMGTEVSDLDLTNIKDLCDQVLSLAESRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+AAPKHKGKISRSLAAKTALAIRYDALGD+ D+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGKAAPKHKGKISRSLAAKTALAIRYDALGDNPDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EG++LGR AGSAKGKP+IEVYDKD KKG GALITP K YNPAADS LG
Sbjct  397  EGKELGRSAGSAKGKPQIEVYDKDHKKGVGALITPGKTYNPAADSFLG  444



>ref|XP_006287421.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
 gb|EOA20319.1| hypothetical protein CARUB_v10000627mg, partial [Capsella rubella]
Length=551

 Score =   409 bits (1051),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 198/237 (84%), Positives = 222/237 (94%), Gaps = 2/237 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EA+LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  237  KLDFSEILADEIEADLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  296

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  297  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  356

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLRNL
Sbjct  357  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRNL  416

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YNPAADS+L    PTA+ +
Sbjct  417  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNPAADSLL--QTPTADSE  471



>ref|XP_010421655.1| PREDICTED: probable nucleolar protein 5-1 isoform X1 [Camelina 
sativa]
Length=419

 Score =   404 bits (1039),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 196/227 (86%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEA+LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  107  KLDFSEILSDEVEADLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  166

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  167  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  226

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLRNL
Sbjct  227  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRNL  286

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            EGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  287  EGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  333



>ref|XP_009342020.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=552

 Score =   409 bits (1051),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 202/236 (86%), Positives = 216/236 (92%), Gaps = 0/236 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELK+AAMISMGTEVS++DLMNIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKDAAMISMGTEVSELDLMNIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+AAPK KGKISRSLA+K ALAIR DALGD QD++MG+EN  KLEARLRNL
Sbjct  337  GLIYHASLIGKAAPKLKGKISRSLASKAALAIRVDALGDGQDNSMGVENYQKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAADSVLG   P+  E
Sbjct  397  EGRELGHHAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADSVLGKMTPSKTE  452



>ref|XP_009364569.1| PREDICTED: probable nucleolar protein 5-2 [Pyrus x bretschneideri]
Length=550

 Score =   409 bits (1050),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 204/242 (84%), Positives = 220/242 (91%), Gaps = 2/242 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELK+AAMISMGTEVS++DLMNIKELC+QV+S SEYR QLYDYLK+R
Sbjct  217  KLDFSEILPEEVETELKDAAMISMGTEVSELDLMNIKELCDQVLSLSEYRAQLYDYLKNR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+AAPK KGKISRSLA+K ALAIR DALGDSQD++MG+EN  KLEARLRNL
Sbjct  337  GLIYHASLIGKAAPKLKGKISRSLASKAALAIRVDALGDSQDNSMGVENYQKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EGR+LG  AGSAKGKPKIEVYDKDRKKG   LIT AKAYNPAAD+VLG   P  N ++P 
Sbjct  397  EGRELGHSAGSAKGKPKIEVYDKDRKKGAAGLITAAKAYNPAADAVLGKMAP--NTEKPA  454

Query  37   LE  32
             E
Sbjct  455  AE  456



>ref|XP_002884489.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60748.1| hypothetical protein ARALYDRAFT_896572 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   408 bits (1048),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 195/230 (85%), Positives = 217/230 (94%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EA+LK+AA+ISMGTEVSD+DL++I+ELC+QV+S SEYR QLYDYLKSR
Sbjct  218  KLDFSEILADEIEADLKDAAVISMGTEVSDLDLLHIRELCDQVLSLSEYRAQLYDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK  LAIR DALGD QDSTMGLENRAKLEARLRNL
Sbjct  338  GLIYHASVVGQAAPKHKGKISRSLAAKAVLAIRVDALGDGQDSTMGLENRAKLEARLRNL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GSAKGKPKIEVY+KD+K G G LITPAK YN AADS+LG +
Sbjct  398  EGKDLGRLSGSAKGKPKIEVYNKDKKMGSGGLITPAKTYNTAADSLLGES  447



>gb|EYU23804.1| hypothetical protein MIMGU_mgv1a003941mg [Erythranthe guttata]
Length=553

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/230 (87%), Positives = 215/230 (93%), Gaps = 0/230 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVEAELKEA+ ISMGTEVSD+DL NIK+LCNQVIS +EYR QL+DYLKSRM
Sbjct  218  LDFSEILQEEVEAELKEASNISMGTEVSDMDLDNIKDLCNQVISLAEYRAQLFDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N+IAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NSIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPKHKGKISRSLAAK ALAIR DALG+ +D++MGLE+R KLEARLRNLE
Sbjct  338  LIYHASLIGQAAPKHKGKISRSLAAKAALAIRCDALGEGEDNSMGLESRLKLEARLRNLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            GR+LGR AGSAKGKPKIE YDKDRKKG G +ITPAK YNPAADS+LG TE
Sbjct  398  GRELGRSAGSAKGKPKIEFYDKDRKKGSGGMITPAKTYNPAADSILGLTE  447



>ref|XP_007030686.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
 gb|EOY11188.1| NOP56-like pre RNA processing ribonucleoprotein isoform 1 [Theobroma 
cacao]
Length=565

 Score =   408 bits (1048),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/243 (83%), Positives = 221/243 (91%), Gaps = 1/243 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVE ELKEAA+ISMGTEV+D+DL ++KELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILLEEVETELKEAAVISMGTEVNDLDLTSLKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            EG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K YNPAADS+LG T P   +  P+
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVKTYNPAADSLLGQTTPDEQDTVPK  455

Query  37   LEK  29
             +K
Sbjct  456  KKK  458



>gb|KHG01423.1| putative nucleolar 5-2 -like protein [Gossypium arboreum]
Length=567

 Score =   407 bits (1046),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/239 (84%), Positives = 222/239 (93%), Gaps = 2/239 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLD SEILPEEVE E+KEAA+ISMGTE++D+DL+NIKELC+QV++ +EYR QLYDYLKSR
Sbjct  217  KLDLSEILPEEVETEVKEAAVISMGTEINDLDLINIKELCDQVLNLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK YNPAADS++G  T  TA E++
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAKTYNPAADSLIGQITNSTALEEQ  454



>ref|XP_010421656.1| PREDICTED: probable nucleolar protein 5-1 isoform X2 [Camelina 
sativa]
Length=529

 Score =   405 bits (1042),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 196/227 (86%), Positives = 216/227 (95%), Gaps = 0/227 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEA+LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILSDEVEADLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            EGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  397  EGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  443



>ref|XP_010904781.1| PREDICTED: probable nucleolar protein 5-2 [Elaeis guineensis]
Length=588

 Score =   407 bits (1045),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 200/237 (84%), Positives = 218/237 (92%), Gaps = 0/237 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVE ELK +A ISMGTEVSD+DL NI++LC+QV++ SEYR QLYDYL+SRM
Sbjct  218  LDFSEILSEEVETELKVSAEISMGTEVSDLDLANIRDLCDQVLALSEYRAQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LI+HASLIGQAAP+ KGKISRSLAAKTALA+RYDALGDSQD++MGLENRAKLEARLR LE
Sbjct  338  LIFHASLIGQAAPRFKGKISRSLAAKTALAVRYDALGDSQDNSMGLENRAKLEARLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            GR+LGR AGS+KGKPKIEVYDKDRK+G GALITPAK YNPA+D VLG T   + E E
Sbjct  398  GRELGRSAGSSKGKPKIEVYDKDRKQGAGALITPAKTYNPASDLVLGGTTEPSGEQE  454



>ref|XP_009111930.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
Length=536

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 192/230 (83%), Positives = 217/230 (94%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEAA+ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEAAVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLT+LVGELVGARLI+HGGSLLNL+KQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTSLVGELVGARLISHGGSLLNLSKQPGSTIQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD +D++MG+ENR KLEARLR+L
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGEDNSMGVENRLKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  397  EGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLMGQT  446



>ref|XP_010494044.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=531

 Score =   404 bits (1038),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 215/227 (95%), Gaps = 0/227 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVE +LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILSDEVEGDLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLRNL
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            EGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L
Sbjct  397  EGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSLL  443



>emb|CDY00004.1| BnaC09g02970D [Brassica napus]
Length=536

 Score =   404 bits (1038),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 192/230 (83%), Positives = 217/230 (94%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEAA+ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEAAVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLT+LVGELVGARLI+HGGSLLNL+KQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTSLVGELVGARLISHGGSLLNLSKQPGSTIQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD +D++MG+ENR KLEARLR+L
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGEDNSMGVENRLKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  397  EGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLIGQT  446



>emb|CDY19706.1| BnaA09g03590D [Brassica napus]
Length=535

 Score =   403 bits (1036),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 192/230 (83%), Positives = 217/230 (94%), Gaps = 0/230 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEAA+ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEAAVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLT+LVGELVGARLI+HGGSLLNL+KQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTSLVGELVGARLISHGGSLLNLSKQPGSTIQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD +D++MG+ENR KLEARLR+L
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGEDNSMGVENRLKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG+DLGRL+GSAKGKPK+EVYDKD+K G G LITPAK YN AADS++G T
Sbjct  397  EGKDLGRLSGSAKGKPKVEVYDKDKKSGSGGLITPAKTYNTAADSLIGQT  446



>ref|XP_010455156.1| PREDICTED: probable nucleolar protein 5-1 [Camelina sativa]
Length=529

 Score =   403 bits (1035),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 195/227 (86%), Positives = 214/227 (94%), Gaps = 0/227 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEA+LKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILSDEVEADLKEASVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPKHKGKISRSLAAK ALAIR DALGD QD+TMG+ENR KLEARLR L
Sbjct  337  GLIYHASVVGQAAPKHKGKISRSLAAKAALAIRCDALGDGQDNTMGVENRLKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            EGRDLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS L
Sbjct  397  EGRDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNAAADSFL  443



>ref|NP_198064.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 sp|O04658.2|NOP5A_ARATH RecName: Full=Probable nucleolar protein 5-1; AltName: Full=MAR-binding 
NOP56/58 homolog 1; AltName: Full=NOP58-like protein 
F108; AltName: Full=Nucleolar protein 58-1 [Arabidopsis 
thaliana]
 gb|AAG40836.1|AF302490_1 NOP58-like protein F108 [Arabidopsis thaliana]
 gb|AAL66978.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AAM20318.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
 gb|AED93652.1| putative SAR DNA-binding protein [Arabidopsis thaliana]
Length=533

 Score =   403 bits (1035),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 196/237 (83%), Positives = 220/237 (93%), Gaps = 2/237 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EAELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEIEAELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HAS++GQAAPK+KGKISRSLAAK+ LAIR DALGDSQD+TMG+ENR KLEARLR L
Sbjct  337  GLIFHASVVGQAAPKNKGKISRSLAAKSVLAIRCDALGDSQDNTMGVENRLKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L    PT + +
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLL--QTPTVDSE  451



>ref|XP_004507477.1| PREDICTED: probable nucleolar protein 5-1-like [Cicer arietinum]
Length=553

 Score =   403 bits (1036),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 199/238 (84%), Positives = 215/238 (90%), Gaps = 0/238 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEA +ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEACVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            EG++LGR AGSAKGKPKIE YDKD KKG GALIT AK YN AADSV+     TA E++
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDLKKGAGALITQAKTYNTAADSVIDVKSKTAMEED  454



>ref|XP_002512277.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF49729.1| nucleolar protein nop56, putative [Ricinus communis]
Length=575

 Score =   403 bits (1035),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 200/251 (80%), Positives = 222/251 (88%), Gaps = 4/251 (2%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEEVE ELKEAA+ISMGTEVS++DL+NI+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEVETELKEAALISMGTEVSEVDLINIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASL+GQAAPK KGKISRSLAAK ALAIRYDALGD +D+++GLE+RAKLE RLR+L
Sbjct  337  GLIFHASLVGQAAPKTKGKISRSLAAKAALAIRYDALGDGEDNSLGLEHRAKLEERLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL----GHTEPTANE  50
            EGR+L R AGS KGKPKIE YDKDRKKG G LITPAKAYN +AD+VL      T  T  E
Sbjct  397  EGRELSRSAGSNKGKPKIEAYDKDRKKGAGGLITPAKAYNASADAVLEQTPNSTSGTGEE  456

Query  49   DEPELEKMDAE  17
              P+  K DAE
Sbjct  457  IVPKKRKTDAE  467



>emb|CDX80674.1| BnaC07g27700D [Brassica napus]
Length=536

 Score =   399 bits (1026),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/235 (83%), Positives = 215/235 (91%), Gaps = 0/235 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEA++ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEASVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQA PK KGKISRSLAAK ALAIR DALGD +D+TMG+E+R KLEARLR L
Sbjct  337  GLIYHASLVGQAPPKGKGKISRSLAAKAALAIRCDALGDGEDNTMGVESRLKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTAN  53
            EG+DLGRL+GSAKGKPKIEVYDKD+K G G LITPAK YN AADS+LG T    N
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKSGSGGLITPAKTYNTAADSLLGQTSTAEN  451



>ref|XP_003562489.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 200/238 (84%), Positives = 218/238 (92%), Gaps = 2/238 (1%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEILPEEVEAELKEAA+ISMGTEV+D+DL+NI+ELC+QV++ SEYR QLYDYLKSRM
Sbjct  218  LDFSEILPEEVEAELKEAAVISMGTEVNDLDLLNIRELCDQVLALSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTIQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL D  D++MGLE+R KLE RLR LE
Sbjct  338  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALADGDDNSMGLESRIKLETRLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG-HTEPTANEDE  44
            G++LGR AGSAKGKPKIE Y+KDR KG GALITPAK YNPA+D VLG  TE T  + E
Sbjct  398  GKELGRSAGSAKGKPKIEAYEKDR-KGAGALITPAKTYNPASDLVLGKSTEETPKKSE  454



>dbj|BAA31260.1| SAR DNA binding protein [Oryza sativa]
Length=485

 Score =   397 bits (1021),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -1

Query  760  QKLDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            + LDFSEIL + EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+
Sbjct  216  ESLDFSEILSDDEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLR  275

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            SRMNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATP
Sbjct  276  SRMNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATP  335

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR
Sbjct  336  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLR  395

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANED  47
             LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + 
Sbjct  396  VLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKP  455

Query  46   E  44
            E
Sbjct  456  E  456



>ref|XP_009151230.1| PREDICTED: probable nucleolar protein 5-1 [Brassica rapa]
 emb|CDX86179.1| BnaA06g28960D [Brassica napus]
Length=537

 Score =   398 bits (1023),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 193/235 (82%), Positives = 215/235 (91%), Gaps = 0/235 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EAELKEA++ISMGTEVSD+DLM+I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEIEAELKEASVISMGTEVSDLDLMHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQA PK KGKISRSLAAK ALAIR DALGD +D+TMG+E+R K+EARLR L
Sbjct  337  GLIYHASLVGQAPPKSKGKISRSLAAKAALAIRCDALGDGEDNTMGVESRLKVEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTAN  53
            EG+DLGRL+GSAKGKPKIEVYDKD+K G G LITPAK YN AADS+LG T    N
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKNGSGGLITPAKTYNTAADSLLGQTSTAEN  451



>gb|KJB26511.1| hypothetical protein B456_004G245100 [Gossypium raimondii]
Length=450

 Score =   395 bits (1015),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 195/217 (90%), Positives = 207/217 (95%), Gaps = 1/217 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNIKELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAAVISMGTEVNDLDLMNIKELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRAL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAK  107
            EG++LGR AGSAKGKPKIEVYDKDRKKG G LITPAK
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRKKGAG-LITPAK  432



>gb|ABF95925.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95926.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF95927.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAY89998.1| hypothetical protein OsI_11565 [Oryza sativa Indica Group]
 dbj|BAG94281.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   397 bits (1020),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -1

Query  760  QKLDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            + LDFSEIL + EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+
Sbjct  216  ESLDFSEILSDDEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLR  275

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            SRMNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATP
Sbjct  276  SRMNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATP  335

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR
Sbjct  336  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLR  395

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANED  47
             LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + 
Sbjct  396  VLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKP  455

Query  46   E  44
            E
Sbjct  456  E  456



>ref|NP_001050112.1| Os03g0350100 [Oryza sativa Japonica Group]
 dbj|BAF12026.1| Os03g0350100, partial [Oryza sativa Japonica Group]
Length=556

 Score =   397 bits (1019),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -1

Query  760  QKLDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            + LDFSEIL + EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+
Sbjct  216  ESLDFSEILSDDEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLR  275

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            SRMNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATP
Sbjct  276  SRMNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATP  335

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR
Sbjct  336  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLR  395

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANED  47
             LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + 
Sbjct  396  VLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKP  455

Query  46   E  44
            E
Sbjct  456  E  456



>ref|NP_001050113.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|ABF95928.1| Nucleolar protein NOP5, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12027.1| Os03g0350300 [Oryza sativa Japonica Group]
 gb|EAZ26910.1| hypothetical protein OsJ_10837 [Oryza sativa Japonica Group]
 dbj|BAG93321.1| unnamed protein product [Oryza sativa Japonica Group]
Length=568

 Score =   396 bits (1018),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -1

Query  760  QKLDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            + LDFSEIL + EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+
Sbjct  216  ESLDFSEILSDDEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLR  275

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            SRMNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATP
Sbjct  276  SRMNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATP  335

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR
Sbjct  336  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLR  395

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANED  47
             LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + 
Sbjct  396  VLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKP  455

Query  46   E  44
            E
Sbjct  456  E  456



>ref|XP_007131795.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
 gb|ESW03789.1| hypothetical protein PHAVU_011G042200g [Phaseolus vulgaris]
Length=556

 Score =   395 bits (1016),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 202/239 (85%), Positives = 218/239 (91%), Gaps = 0/239 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVEAE+KEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSRM
Sbjct  218  LDFSEILSEEVEAEVKEASVISMGTEIGELDLANIRELCDQVLSLSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTAMVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAA K KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNLE
Sbjct  338  LIYHASLIGQAAAKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPE  38
            G++LGR AGSAKGKPKIE YDKDRKKGPG LITPAK YNP+ADSV+G      +ED  E
Sbjct  398  GKELGRFAGSAKGKPKIEAYDKDRKKGPGGLITPAKTYNPSADSVIGQINSAMDEDVQE  456



>gb|EMS65034.1| hypothetical protein TRIUR3_04158 [Triticum urartu]
Length=560

 Score =   394 bits (1012),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 194/229 (85%), Positives = 211/229 (92%), Gaps = 1/229 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEILPEEVEAELKEAA+ISMGTEV+D+DL NI+ELC+QV++ SEYR QLYDYLKSRM
Sbjct  218  LDFSEILPEEVEAELKEAAVISMGTEVNDLDLSNIRELCDQVLALSEYRAQLYDYLKSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTALVGELVGARLI+HGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKYG
Sbjct  278  NTIAPNLTALVGELVGARLISHGGSLMNLAKQPGSTIQILGAEKALFRALKTKHATPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPKHKGKISRSLAAK+ALAIRYDAL D  D++MGLE+R KLE RLR LE
Sbjct  338  LIYHASLIGQAAPKHKGKISRSLAAKSALAIRYDALADGDDNSMGLESRIKLETRLRVLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            G++LGR AGS KGKPKIE Y+KDR KG GALITPAK YN AAD VLG T
Sbjct  398  GKELGRSAGSTKGKPKIEAYEKDR-KGGGALITPAKTYNSAADLVLGQT  445



>gb|AAB61073.1| similar to S. cerevisiae SIK1P (PID:g984964) [Arabidopsis thaliana]
Length=439

 Score =   389 bits (998),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 187/218 (86%), Positives = 208/218 (95%), Gaps = 0/218 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EAELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEIEAELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HAS++GQAAPK+KGKISRSLAAK+ LAIR DALGDSQD+TMG+ENR KLEARLR L
Sbjct  337  GLIFHASVVGQAAPKNKGKISRSLAAKSVLAIRCDALGDSQDNTMGVENRLKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKA  104
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK 
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKV  434



>gb|ACJ85748.1| unknown [Medicago truncatula]
 gb|AFK40384.1| unknown [Medicago truncatula]
 gb|AFK49114.1| unknown [Medicago truncatula]
Length=553

 Score =   392 bits (1008),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 206/244 (84%), Positives = 222/244 (91%), Gaps = 7/244 (3%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAE+KEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILSEEVEAEVKEASVISMGTEIGELDLSNIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTAN----E  50
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAKAYN AADSV+   EP +N    E
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKAYNTAADSVI---EPMSNSAMDE  453

Query  49   DEPE  38
            D PE
Sbjct  454  DTPE  457



>ref|XP_006650080.1| PREDICTED: probable nucleolar protein 5-2-like [Oryza brachyantha]
Length=565

 Score =   392 bits (1008),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 199/253 (79%), Positives = 224/253 (89%), Gaps = 2/253 (1%)
 Frame = -1

Query  754  LDFSEILPEE-VEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL ++ VE++LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+SR
Sbjct  218  LDFSEILSDDDVESQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLRSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD  D+++GLE+R KLE RLR L
Sbjct  338  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGGDNSIGLESRVKLETRLRVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDEP  41
            EG++LGR AGSAKGKPKIEVY+KDRKKG GALIT AK YNPAAD VLG  TE T  + E 
Sbjct  398  EGKELGRSAGSAKGKPKIEVYEKDRKKGAGALITAAKTYNPAADLVLGQSTEETPKKPEG  457

Query  40   ELEKMDAEAVKRP  2
              +K   EA   P
Sbjct  458  ASKKRKHEAETAP  470



>gb|EEC75255.1| hypothetical protein OsI_11566 [Oryza sativa Indica Group]
Length=657

 Score =   395 bits (1015),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 197/241 (82%), Positives = 221/241 (92%), Gaps = 2/241 (1%)
 Frame = -1

Query  760  QKLDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            + LDFSEIL + EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+
Sbjct  305  ESLDFSEILSDDEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLR  364

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            SRMNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATP
Sbjct  365  SRMNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATP  424

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR
Sbjct  425  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLR  484

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANED  47
             LEG++LGR AGS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + 
Sbjct  485  VLEGKELGRSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKP  544

Query  46   E  44
            E
Sbjct  545  E  545



>ref|XP_006838803.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
 gb|ERN01372.1| hypothetical protein AMTR_s00002p00260990 [Amborella trichopoda]
Length=591

 Score =   393 bits (1010),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/228 (84%), Positives = 210/228 (92%), Gaps = 0/228 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            +LDF EILPEEVEAELKEAA+ISMGTE+SD+D+ NI+ LC+QV+S SEYR QLYDYLKSR
Sbjct  217  ELDFLEILPEEVEAELKEAAVISMGTEISDLDMDNIRSLCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLT LVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTVLVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HASLIGQA PK KGKISRSLAAKTALAIRYDALG+SQD++MGLENRAK+EARLR+L
Sbjct  337  GLIFHASLIGQAPPKFKGKISRSLAAKTALAIRYDALGESQDASMGLENRAKIEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
            EGR+LGR AGS KGK K+EVY+KDRKK    L+T AK YNPAADS LG
Sbjct  397  EGRELGRAAGSTKGKMKVEVYNKDRKKSDAGLLTAAKTYNPAADSTLG  444



>ref|XP_002874406.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50665.1| hypothetical protein ARALYDRAFT_489610 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 191/237 (81%), Positives = 216/237 (91%), Gaps = 2/237 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QL+DYLKSR
Sbjct  217  KLDFSEILADEVEAELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLFDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNL+ALVGELVGARLI+HGGSLLNL+KQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLSALVGELVGARLISHGGSLLNLSKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++ QA PK+KGKISRSLAAK ALA+R DALG  QD+TMG+ENR KLEARLR L
Sbjct  337  GLIYHASVVCQATPKNKGKISRSLAAKVALAVRCDALGYGQDNTMGVENRLKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANED  47
            EG+DLGRL+GSAKGKPKIEVYDKD+KKG G LITPAK YN AADS+L    PT + +
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKKGSGGLITPAKTYNTAADSLL--QTPTVDSE  451



>ref|XP_003606983.1| SAR DNA-binding protein-1 [Medicago truncatula]
 gb|AES89180.1| NOP56-like pre RNA processing ribonucleoprotein [Medicago truncatula]
Length=553

 Score =   391 bits (1004),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 205/244 (84%), Positives = 221/244 (91%), Gaps = 7/244 (3%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAE+KEA++ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILSEEVEAEVKEASVISMGTEIGELDLSNIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTAN----E  50
            EG++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YN AADSV+   EP +N    E
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNTAADSVI---EPMSNSAMDE  453

Query  49   DEPE  38
            D PE
Sbjct  454  DTPE  457



>gb|KFK37913.1| hypothetical protein AALP_AA3G046300 [Arabis alpina]
Length=529

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/233 (82%), Positives = 214/233 (92%), Gaps = 1/233 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVE ELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVETELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTVAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHAS++GQAAPK KGK+SRSLAAK ALAIR+DALG+ QD+TMGLE+RAKLE RLRNL
Sbjct  337  GLIYHASVVGQAAPKDKGKMSRSLAAKCALAIRFDALGEGQDNTMGLEHRAKLEVRLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPT  59
            EG+ LGRL+GSAKGKP IEVY+KDRK G G L TPAK YN AAD++L  T PT
Sbjct  397  EGKSLGRLSGSAKGKPMIEVYEKDRKMGYGGLNTPAKTYNSAADALLEKT-PT  448



>emb|CDP04715.1| unnamed protein product [Coffea canephora]
Length=422

 Score =   385 bits (989),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/203 (92%), Positives = 198/203 (98%), Gaps = 0/203 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTE+SD+DLMNIK+LC+QV+SF+EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAALISMGTEISDLDLMNIKDLCSQVLSFAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGD+QD+TMGLENR KLEARLR+L
Sbjct  337  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDNQDNTMGLENRLKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDK  149
            EGR+L R AGSAKGKPKIEVYDK
Sbjct  397  EGRELNRAAGSAKGKPKIEVYDK  419



>gb|AAC16330.1| SAR DNA-binding protein-1 [Pisum sativum]
Length=560

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/241 (84%), Positives = 220/241 (91%), Gaps = 1/241 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAE+KEAA+ISMGTE+ ++DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILTEEVEAEVKEAAVISMGTEIGELDLSNIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLRNL
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEP  41
            EG++LGR AGSAKGKPKIE YDKD+KKG G LITPAK YN AADSV+     +A +ED P
Sbjct  397  EGKELGRFAGSAKGKPKIEAYDKDKKKGAGGLITPAKTYNTAADSVIHQKSNSAMDEDTP  456

Query  40   E  38
            E
Sbjct  457  E  457



>ref|XP_002456868.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
 gb|EES01988.1| hypothetical protein SORBIDRAFT_03g044260 [Sorghum bicolor]
Length=568

 Score =   389 bits (998),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 193/239 (81%), Positives = 217/239 (91%), Gaps = 2/239 (1%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EE+E +LKEAA+ISMGTEVSD+DL+NIKELC+QV++ SEYR QLY+YL+SR
Sbjct  218  LDFSEILSDEELETQLKEAAVISMGTEVSDLDLLNIKELCDQVLALSEYRAQLYEYLRSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKH+TPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHSTPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIRYDALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRYDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            EGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VLGH TE T  + E
Sbjct  398  EGRELGKSAGSTKGKPKIEVYEKDRKKGAGALTTPAKTYNPAADLVLGHSTEETPKKSE  456



>ref|XP_007030688.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
 gb|EOY11190.1| NOP56-like pre RNA processing ribonucleoprotein isoform 3 [Theobroma 
cacao]
Length=443

 Score =   384 bits (986),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/217 (87%), Positives = 204/217 (94%), Gaps = 1/217 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVE ELKEAA+ISMGTEV+D+DL ++KELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILLEEVETELKEAAVISMGTEVNDLDLTSLKELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAKLEARLR L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAK  107
            EG++LGR AGSAKGKPKIEVYDKDR+KG G LITP K
Sbjct  397  EGKELGRSAGSAKGKPKIEVYDKDRRKGAG-LITPVK  432



>gb|EEE59058.1| hypothetical protein OsJ_10836 [Oryza sativa Japonica Group]
Length=525

 Score =   386 bits (992),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 213/230 (93%), Gaps = 1/230 (0%)
 Frame = -1

Query  730  EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNTIAPNLT  551
            +EVEA+LKEAA+ISMGTEVS++DL+NI+ELC+QV++ SEYR QL+DYL+SRMNTIAPNLT
Sbjct  184  DEVEAQLKEAAVISMGTEVSELDLLNIRELCDQVLALSEYRAQLFDYLRSRMNTIAPNLT  243

Query  550  ALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIYHASLI  371
            ALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKYGLIYHASLI
Sbjct  244  ALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATPKYGLIYHASLI  303

Query  370  GQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGRDLGRLA  191
            GQAAPKHKGKISRSLAAKTALAIRYDALGD +D+++GLE+R KLE RLR LEG++LGR A
Sbjct  304  GQAAPKHKGKISRSLAAKTALAIRYDALGDGEDNSIGLESRVKLETRLRVLEGKELGRSA  363

Query  190  GSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            GS KGKPKIEVY+KDRKKG GALITPAK YNPAAD VLG  TE T  + E
Sbjct  364  GSTKGKPKIEVYEKDRKKGAGALITPAKTYNPAADLVLGQSTEETPKKPE  413



>gb|AFW88399.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=452

 Score =   383 bits (983),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 1/236 (0%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EE+E +LKEAA+ISMGTEVSD+DL NI+ELC+QV++ SEYR QLYDYL+SR
Sbjct  108  LDFSEILSDEELETQLKEAAVISMGTEVSDLDLSNIRELCDQVLALSEYRAQLYDYLRSR  167

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKH+TPKY
Sbjct  168  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHSTPKY  227

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIRYDALGD +D+++G E+R KLE RL+ L
Sbjct  228  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRYDALGDGEDNSIGTESRLKLETRLQVL  287

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VL    P  +E
Sbjct  288  EGRELGKSAGSTKGKPKIEVYEKDRKKGTGALTTPAKTYNPAADLVLTEETPKKSE  343



>gb|AAC16331.1| SAR DNA-binding protein-2 [Pisum sativum]
Length=550

 Score =   385 bits (990),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 203/244 (83%), Positives = 218/244 (89%), Gaps = 7/244 (3%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVEAE+KEA++ISMGTE+  +DL NI+ELC+QV+S SEYR QLYDYLKSR
Sbjct  217  KLDFSEILSEEVEAEVKEASVISMGTEIVTLDLENIRELCDQVLSLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTAMVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPK KGKISRSLAAKTALAIR DALGD QD+TMGLENRAKLEARLR L
Sbjct  337  GLIYHASLIGQAAPKFKGKISRSLAAKTALAIRCDALGDGQDNTMGLENRAKLEARLRGL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTAN----E  50
            EG++LG  AGSAKGKPKIE YDKD+KKG G LITPAK YN AADSV+   EP +N    E
Sbjct  397  EGKELGHFAGSAKGKPKIEAYDKDKKKGSGGLITPAKTYNTAADSVI---EPKSNSAMDE  453

Query  49   DEPE  38
            D PE
Sbjct  454  DTPE  457



>ref|XP_003557835.1| PREDICTED: probable nucleolar protein 5-2 [Brachypodium distachyon]
Length=560

 Score =   385 bits (990),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/230 (83%), Positives = 212/230 (92%), Gaps = 2/230 (1%)
 Frame = -1

Query  754  LDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL + EVEA+LKEAA+ISMGTEV+D+DL NI+ELC+QV+S SEYR QLYDYL+SR
Sbjct  218  LDFSEILTDDEVEAQLKEAAVISMGTEVNDLDLSNIRELCDQVLSLSEYRAQLYDYLRSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLA+K ALAIRYDALGD +D+++GLE+R KLE RLR L
Sbjct  338  GLIYHASLIGQAAPKHKGKISRSLASKAALAIRYDALGDGEDNSIGLESRLKLETRLRVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG++LGR AGS KGKPKIEVY+KDR KG GALITPAK YNP+AD VL  +
Sbjct  398  EGKELGRSAGSTKGKPKIEVYEKDR-KGAGALITPAKTYNPSADLVLAKS  446



>ref|XP_008660157.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008660158.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 gb|AFW88396.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88397.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
 gb|AFW88398.1| hypothetical protein ZEAMMB73_019419 [Zea mays]
Length=562

 Score =   384 bits (986),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 1/236 (0%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EE+E +LKEAA+ISMGTEVSD+DL NI+ELC+QV++ SEYR QLYDYL+SR
Sbjct  218  LDFSEILSDEELETQLKEAAVISMGTEVSDLDLSNIRELCDQVLALSEYRAQLYDYLRSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKH+TPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHSTPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIRYDALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRYDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EGR+LG+ AGS KGKPKIEVY+KDRKKG GAL TPAK YNPAAD VL    P  +E
Sbjct  398  EGRELGKSAGSTKGKPKIEVYEKDRKKGTGALTTPAKTYNPAADLVLTEETPKKSE  453



>ref|XP_011457678.1| PREDICTED: probable nucleolar protein 5-2 [Fragaria vesca subsp. 
vesca]
Length=548

 Score =   384 bits (985),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 189/245 (77%), Positives = 214/245 (87%), Gaps = 2/245 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVE ELKEAA+ISMGTE+SD+DL+NIKELC QV+S +EYR QL+DYLK+R
Sbjct  220  KLDFSEILSDEVETELKEAAVISMGTEISDLDLINIKELCEQVLSLAEYRAQLFDYLKTR  279

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  280  MNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATPKY  339

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDAL--GDSQDSTMGLENRAKLEARLR  224
            GLIYHASL+GQAAPK KGKISR+LA+K  L+IR DAL  GDS D+++G+E+R K+EAR+R
Sbjct  340  GLIYHASLVGQAAPKLKGKISRTLASKAVLSIRIDALREGDSLDNSVGVESRGKVEARIR  399

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDE  44
            +LEG+ L + AGS KGKP IE YDKDRKKG G LIT AKAYNPAADSVLG T P    DE
Sbjct  400  SLEGKALSQSAGSTKGKPLIEAYDKDRKKGAGGLITAAKAYNPAADSVLGQTTPAGKTDE  459

Query  43   PELEK  29
               EK
Sbjct  460  TTNEK  464



>ref|XP_008655653.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 ref|XP_008655660.1| PREDICTED: probable nucleolar protein 5-2 [Zea mays]
 tpg|DAA45362.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=564

 Score =   384 bits (985),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 189/236 (80%), Positives = 212/236 (90%), Gaps = 1/236 (0%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EE+E +LKEAA+ISMGTEVSD+DL NI+ELC+QV++ SEYR QLYDYLKSR
Sbjct  218  LDFSEILSDEELETQLKEAAVISMGTEVSDLDLSNIRELCDQVLALSEYRAQLYDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKH+TPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHSTPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIRYDALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRYDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EGR+LG+ AGS KGKPKIEVY+KDRK+G GAL TPAK YNPAAD VL    P  +E
Sbjct  398  EGRELGKSAGSTKGKPKIEVYEKDRKQGAGALTTPAKTYNPAADLVLTEETPKKSE  453



>ref|XP_002533223.1| nucleolar protein nop56, putative [Ricinus communis]
 gb|EEF29163.1| nucleolar protein nop56, putative [Ricinus communis]
Length=558

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 218/240 (91%), Gaps = 2/240 (1%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE ELKEAA+ISMGTEV+D+DLMNI++LC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETELKEAALISMGTEVNDVDLMNIRDLCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GL++HASL+GQA+ K KGKISRSLAAK ALAIR DALGD +D++MGLENR KLEARLRNL
Sbjct  337  GLLFHASLVGQASAKMKGKISRSLAAKAALAIRCDALGDGEDNSMGLENRLKLEARLRNL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEP--TANEDE  44
            EGR+LGR AGSAKGK KIE YDKDRKKG GAL+  AK YNP+ADS+LG T    T N++E
Sbjct  397  EGRELGRSAGSAKGKTKIEAYDKDRKKGAGALLAAAKTYNPSADSILGQTLSFNTVNDEE  456



>ref|XP_004984387.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=568

 Score =   382 bits (980),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 214/239 (90%), Gaps = 2/239 (1%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EEVEA++KEAA+ISMGTEVSD+DL+NI+ELC+QV++ SEYR QL+DYLKSR
Sbjct  218  LDFSEILSDEEVEAQIKEAAVISMGTEVSDLDLLNIRELCDQVLALSEYRAQLFDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIR DALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRCDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            E ++ G+ AGS KGKPKIEVY+KDRKKG GALITPAK YNPA D VLG  TE T  + E
Sbjct  398  ENKEFGKSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPATDVVLGQSTEETPKKSE  456



>ref|XP_004984388.1| PREDICTED: probable nucleolar protein 5-2-like [Setaria italica]
Length=567

 Score =   382 bits (980),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 189/239 (79%), Positives = 214/239 (90%), Gaps = 2/239 (1%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EEVEA++KEAA+ISMGTEVSD+DL+NI+ELC+QV++ SEYR QL+DYLKSR
Sbjct  218  LDFSEILSDEEVEAQIKEAAVISMGTEVSDLDLLNIRELCDQVLALSEYRAQLFDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLVNLAKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIR DALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRCDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH-TEPTANEDE  44
            E ++ G+ AGS KGKPKIEVY+KDRKKG GALITPAK YNPA D VLG  TE T  + E
Sbjct  398  ENKEFGKSAGSTKGKPKIEVYEKDRKKGAGALITPAKTYNPATDVVLGQSTEETPKKSE  456



>emb|CDY50583.1| BnaC02g39570D [Brassica napus]
Length=525

 Score =   377 bits (968),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/234 (79%), Positives = 213/234 (91%), Gaps = 0/234 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  207  KLDFSEILADEVEAELKEASVISMGTEVSDLDLIHIRELCDQVLSLAEYRAQLYDYLKSR  266

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKH TPKY
Sbjct  267  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHNTPKY  326

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HAS++GQA  K+K +I+RSLAAK AL+IR DALGD+ D++MG+ENR KLEARLR+L
Sbjct  327  GLIFHASVVGQAGGKNKPRIARSLAAKAALSIRCDALGDAGDNSMGVENRLKLEARLRSL  386

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA  56
            EG+DLGRLAGSAKGKPKIEVY+KD+K G G LI PA+ YN AADS+L  T  +A
Sbjct  387  EGKDLGRLAGSAKGKPKIEVYNKDKKMGSGGLIAPAETYNTAADSLLVQTTVSA  440



>emb|CDY52494.1| BnaAnng11410D [Brassica napus]
Length=531

 Score =   377 bits (968),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 182/231 (79%), Positives = 211/231 (91%), Gaps = 0/231 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVEAELKEA++ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEVEAELKEASVISMGTEVSDLDLIHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+H GSLLNL+KQPGSTVQILGAEKALFRALKTKH TPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHSGSLLNLSKQPGSTVQILGAEKALFRALKTKHNTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HAS++GQA  K+K +I+RSLAAK AL+IR+DALGD+ D++MG+ENR KLEARLR+L
Sbjct  337  GLIFHASVVGQAGGKNKPRIARSLAAKAALSIRFDALGDAGDNSMGVENRLKLEARLRSL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTE  65
            EG+DLGRLAGSAKGKPKIEVY+KD+K G G LI PAK YN AADS+L   E
Sbjct  397  EGKDLGRLAGSAKGKPKIEVYNKDKKMGSGGLIAPAKTYNTAADSLLVSAE  447



>gb|AAN72071.1| SAR DNA-binding protein - like [Arabidopsis thaliana]
Length=423

 Score =   373 bits (958),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +E+EAELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  217  KLDFSEILADEIEAELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLI+HGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNTIAPNLTALVGELVGARLISHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLI+HAS++GQAAPK+KGKISRSLAAK+ LAIR DALGDSQD+TMG+ENR KLEARLR L
Sbjct  337  GLIFHASVVGQAAPKNKGKISRSLAAKSVLAIRCDALGDSQDNTMGVENRLKLEARLRTL  396

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKK  137
            EG+DLGRL+GSAKGKPKIEVYDKD+KK
Sbjct  397  EGKDLGRLSGSAKGKPKIEVYDKDKKK  423



>emb|CAE45597.1| SAR DNA-binding protein-like protein [Lotus japonicus]
Length=537

 Score =   376 bits (965),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 197/239 (82%), Positives = 216/239 (90%), Gaps = 1/239 (0%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            DFSE+LPEEVE E+KEA++ISMGTE+ ++DLMNIKELC+QV+S SEYR QLYDYLKSRMN
Sbjct  205  DFSEVLPEEVEEEVKEASVISMGTEIGELDLMNIKELCDQVLSLSEYRAQLYDYLKSRMN  264

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
            +IAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKHATPKYGL
Sbjct  265  SIAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  324

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASLIGQAAPK KGKISRSLAAK ALAIR DALGD  D+TMGLENRAKLE RLRNLEG
Sbjct  325  IYHASLIGQAAPKLKGKISRSLAAKAALAIRCDALGDGVDNTMGLENRAKLELRLRNLEG  384

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTA-NEDEPE  38
            ++LGR AGSAKGKPKIE YDKDRKKG G LITPAK YNP+AD+V+     +A +ED  E
Sbjct  385  KELGRFAGSAKGKPKIEAYDKDRKKGAGGLITPAKTYNPSADAVISQKSDSAMDEDTHE  443



>dbj|BAN15014.1| SAR DNA binding protein [Bromus inermis]
Length=539

 Score =   369 bits (948),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 209/230 (91%), Gaps = 2/230 (1%)
 Frame = -1

Query  754  LDFSEILPE-EVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL + EVE +LKEAA+ISMGTEV+D+DL NI+ELC+QV++ SEYR QLYDYLKSR
Sbjct  218  LDFSEILTDGEVEEQLKEAAVISMGTEVNDLDLSNIRELCDQVLALSEYRAQLYDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTA+VGELVGARLI+HGGSL++LAKQPGST+QILGAEKALFRALKTKHATPKY
Sbjct  278  MNTIAPNLTAIVGELVGARLISHGGSLVSLAKQPGSTIQILGAEKALFRALKTKHATPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIGQAAPKHKGKISRSLA+K ALAIRYDALGD +++++GLE+R KLE  LR L
Sbjct  338  GLIYHASLIGQAAPKHKGKISRSLASKAALAIRYDALGDGENNSLGLESRLKLETMLRVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            EG++L + AGS KGKPKIEVY+KDRK G G LITPAKAYNP+AD VL  +
Sbjct  398  EGKELAKSAGSMKGKPKIEVYEKDRKNGAG-LITPAKAYNPSADLVLAQS  446



>tpg|DAA45361.1| TPA: hypothetical protein ZEAMMB73_906298 [Zea mays]
Length=450

 Score =   365 bits (937),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 179/218 (82%), Positives = 201/218 (92%), Gaps = 1/218 (0%)
 Frame = -1

Query  754  LDFSEILP-EEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            LDFSEIL  EE+E +LKEAA+ISMGTEVSD+DL NI+ELC+QV++ SEYR QLYDYLKSR
Sbjct  218  LDFSEILSDEELETQLKEAAVISMGTEVSDLDLSNIRELCDQVLALSEYRAQLYDYLKSR  277

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGST+QILGAEKALFRALKTKH+TPKY
Sbjct  278  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHSTPKY  337

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
            GLIYHASLIG+A+ KHKGKISRSLAAKTALAIRYDALGD +D+++G E+R KLE RL+ L
Sbjct  338  GLIYHASLIGKASQKHKGKISRSLAAKTALAIRYDALGDGEDNSIGTESRLKLETRLQVL  397

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKA  104
            EGR+LG+ AGS KGKPKIEVY+KDRK+G GAL TPAK 
Sbjct  398  EGRELGKSAGSTKGKPKIEVYEKDRKQGAGALTTPAKV  435



>ref|XP_001753892.1| predicted protein [Physcomitrella patens]
 gb|EDQ81214.1| predicted protein [Physcomitrella patens]
Length=578

 Score =   343 bits (879),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 170/233 (73%), Positives = 198/233 (85%), Gaps = 3/233 (1%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFS IL EEVE+E+KEAA+ISMGTEVSD D++NIK LC+QVI+ SEYRGQL+DYL+SRM
Sbjct  218  LDFSGILQEEVESEMKEAAVISMGTEVSDHDMLNIKSLCDQVIALSEYRGQLFDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TPKYG
Sbjct  278  NAIAPNLTVMVGELVGARLIAHAGSLINLAKHPASTVQILGAEKALFRALKTKHETPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISR LAAK+AL+IR DALG+  ++++G+E+RAK+EARLR LE
Sbjct  338  LIYHASLIGQAAPKFKGKISRVLAAKSALSIRMDALGEGSEASIGIESRAKVEARLRQLE  397

Query  214  GRDLGRLAGSA-KGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPT  59
            GR LG+   SA KGKP I+ Y+KDRK G   L++ AK YNP+AD  +   EPT
Sbjct  398  GRALGKTPVSASKGKPNIQAYEKDRKSGTPGLLSAAKVYNPSADVTM--DEPT  448



>ref|XP_001756465.1| predicted protein [Physcomitrella patens]
 gb|EDQ78861.1| predicted protein [Physcomitrella patens]
Length=558

 Score =   339 bits (869),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 195/228 (86%), Gaps = 2/228 (1%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFS IL EEVE+E+KEAA+ISMGTEVS+ D++NIK LC+QVI+ SEYRGQL+DYL+SRM
Sbjct  218  LDFSGILQEEVESEMKEAAVISMGTEVSEHDMLNIKSLCDQVIALSEYRGQLFDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TPKYG
Sbjct  278  NAIAPNLTVMVGELVGARLIAHAGSLVNLAKHPASTVQILGAEKALFRALKTKHETPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISR LAAK+AL+IR DALGD+ ++++G+E+RAK+EARLR LE
Sbjct  338  LIYHASLIGQAAPKFKGKISRVLAAKSALSIRMDALGDTTEASIGIESRAKVEARLRQLE  397

Query  214  GRDLGRLAGS--AKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            GR LG+   +  +KGKP I+VYDKDRK G   L++  K YN +AD  +
Sbjct  398  GRALGKSISTPGSKGKPNIQVYDKDRKSGTPGLLSAGKVYNTSADVTM  445



>ref|XP_002985284.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
 gb|EFJ13778.1| hypothetical protein SELMODRAFT_121625 [Selaginella moellendorffii]
Length=576

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 187/226 (83%), Gaps = 0/226 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EE+E +LKEA  ISMGT++++ D+  I+E C+QVIS +EYR QLYDYL+SRM
Sbjct  218  LDFSEILEEEIEVQLKEAVPISMGTDITEEDMDTIQEFCDQVISLAEYRTQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSL+NL+KQP STVQILGAEKALFRALKTK  TPKYG
Sbjct  278  KAIAPNLTVLVGELVGARLIAHAGSLINLSKQPSSTVQILGAEKALFRALKTKQNTPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQA  K KGKI+R LAAKTAL+IRYDALG+ QD+ +G+ENRAK+EARLR LE
Sbjct  338  LIYHASLVGQAPAKFKGKIARVLAAKTALSIRYDALGEGQDANIGIENRAKVEARLRQLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            GR LG+ +G+AKGK KIE YDKDRK     L+T AKAY   AD  L
Sbjct  398  GRALGKASGAAKGKAKIEAYDKDRKGATPGLLTAAKAYETQADITL  443



>ref|XP_002970093.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
 gb|EFJ29217.1| hypothetical protein SELMODRAFT_146841 [Selaginella moellendorffii]
Length=575

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 186/226 (82%), Gaps = 0/226 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL EEVE +LKEA  ISMGT++++ D+  I+E C+QVIS +EYR QLYDYL+SRM
Sbjct  218  LDFSEILEEEVEVQLKEAVPISMGTDITEEDMDTIQEFCDQVISLAEYRTQLYDYLRSRM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSL+NL+KQP STVQILGAEKALFRALKTK  TPKYG
Sbjct  278  KAIAPNLTVLVGELVGARLIAHAGSLINLSKQPASTVQILGAEKALFRALKTKQNTPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQA  K KGKI+R LAAKTAL+IRYDALG+ QD+ +G+ENRAK+EARLR LE
Sbjct  338  LIYHASLVGQAPAKFKGKIARVLAAKTALSIRYDALGEGQDANIGIENRAKVEARLRQLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            GR LG+ +G+AKGK KIE YDKDRK     L+T AK Y   AD  L
Sbjct  398  GRALGKASGAAKGKAKIEAYDKDRKGATPGLLTAAKTYETQADITL  443



>gb|KFK23538.1| hypothetical protein AALP_AAs63573U000200 [Arabis alpina]
Length=483

 Score =   323 bits (827),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 163/236 (69%), Positives = 185/236 (78%), Gaps = 34/236 (14%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL +EVE ELKEAA+ISMGTEVSD+DL++I+ELC+QV+S +EYR QLYDYLKSR
Sbjct  233  KLDFSEILADEVETELKEAAVISMGTEVSDLDLLHIRELCDQVLSLAEYRAQLYDYLKSR  292

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLI+HGGSLLNLAKQPGST+QILGAEKALFRALKTKHATPK 
Sbjct  293  MNTVAPNLTALVGELVGARLISHGGSLLNLAKQPGSTIQILGAEKALFRALKTKHATPK-  351

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNL  218
                                             YDALG+ QD+TMGLE+RAKLE RLRNL
Sbjct  352  ---------------------------------YDALGEGQDNTMGLEHRAKLEVRLRNL  378

Query  217  EGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
            EG+DLGRL+GSAKGKPK+EVY+KD+K G G L T AK YNPAADS+LG    T+ E
Sbjct  379  EGKDLGRLSGSAKGKPKVEVYNKDKKIGYGGLDTSAKTYNPAADSLLGQASTTSEE  434



>gb|KJB82563.1| hypothetical protein B456_013G202500 [Gossypium raimondii]
Length=416

 Score =   320 bits (820),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/173 (88%), Positives = 167/173 (97%), Gaps = 0/173 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSE+LPEEVE ELKEAA+ISMGTE+SD+DLMNIK+LC+QV++ SEYR QLYDYLKSR
Sbjct  217  KLDFSEVLPEEVETELKEAAVISMGTEISDLDLMNIKDLCDQVLNLSEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLINLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKL  239
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAK+
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKV  389



>gb|KJB45049.1| hypothetical protein B456_007G287100 [Gossypium raimondii]
Length=414

 Score =   319 bits (817),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVE E+KEAA+ISMGTE++D+DL+NIKELC+QV++ +EYR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVETEVKEAAVISMGTEINDLDLINIKELCDQVLNLAEYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNT+APNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  277  MNTVAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARL  227
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAK+  +L
Sbjct  337  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKVNYKL  393



>ref|XP_010097360.1| hypothetical protein L484_010238 [Morus notabilis]
 gb|EXB67670.1| hypothetical protein L484_010238 [Morus notabilis]
Length=514

 Score =   322 bits (824),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/172 (92%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEILPEEVEAELKEAAMISMGTEVSD+DL NIKELC+QV+  S YR QLYDYLKSR
Sbjct  217  KLDFSEILPEEVEAELKEAAMISMGTEVSDLDLTNIKELCDQVLHLSAYRAQLYDYLKSR  276

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MN+IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY
Sbjct  277  MNSIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  336

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAK  242
            GLIYHASLIGQAAPK KGKISRSLAAK ALAIRYDALGD+QD++MGLENRAK
Sbjct  337  GLIYHASLIGQAAPKLKGKISRSLAAKAALAIRYDALGDNQDNSMGLENRAK  388



>ref|XP_007030689.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
 gb|EOY11191.1| NOP56-like pre RNA processing ribonucleoprotein isoform 4, partial 
[Theobroma cacao]
Length=388

 Score =   315 bits (806),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 151/175 (86%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  757  KLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSR  578
            KLDFSEIL EEVE ELKEAA+ISMGTEV+D+DL ++KELC+QV+S +EYR QLYDYLKSR
Sbjct  214  KLDFSEILLEEVETELKEAAVISMGTEVNDLDLTSLKELCDQVLSLAEYRAQLYDYLKSR  273

Query  577  MNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKY  398
            MNTIAPNLTALVGELVGARLIAHGGSL+NLAKQPGSTVQILGAEKALFRALKTKH+TPKY
Sbjct  274  MNTIAPNLTALVGELVGARLIAHGGSLMNLAKQPGSTVQILGAEKALFRALKTKHSTPKY  333

Query  397  GLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEA  233
            GLIYHASL+GQAAPKHKGKISRSLAAK ALAIR DALGD QD++MGLENRAK+++
Sbjct  334  GLIYHASLVGQAAPKHKGKISRSLAAKAALAIRCDALGDDQDNSMGLENRAKVKS  388



>ref|XP_002946402.1| hypothetical protein VOLCADRAFT_102990 [Volvox carteri f. nagariensis]
 gb|EFJ52329.1| hypothetical protein VOLCADRAFT_102990 [Volvox carteri f. nagariensis]
Length=526

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 189/230 (82%), Gaps = 0/230 (0%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            +Q LDFS IL E+VE +LK AA +SMGT++S+ DL NIK+L NQVI+ SEYRGQL++YL+
Sbjct  216  VQGLDFSGILEEDVEGQLKAAAQVSMGTDISESDLDNIKDLANQVIALSEYRGQLFEYLR  275

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RM+ IAPNLT LVGELVGARLIAH GSL+NLAKQP STVQILGAEKALFRALKTKH TP
Sbjct  276  NRMSAIAPNLTVLVGELVGARLIAHAGSLINLAKQPASTVQILGAEKALFRALKTKHETP  335

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ+APK+KGKISR LAAK ALAIR DALGD+ D+T+G+E R K+EARLR
Sbjct  336  KYGLIYHASLIGQSAPKYKGKISRVLAAKCALAIRVDALGDTNDATVGVEARQKVEARLR  395

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLG  74
             LEG+ LG  AG++KGK +   YDK R+     + T  KAYNP +D + G
Sbjct  396  QLEGKLLGSEAGTSKGKEQPAKYDKSRQGATPTMATQPKAYNPDSDVING  445



>ref|XP_003077976.1| SAR DNA-binding protein-1-garden pea (ISS) [Ostreococcus tauri]
Length=341

 Score =   305 bits (782),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 180/220 (82%), Gaps = 0/220 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFS IL E+VE E+K+AA+ISMGTE+S+ DL NI +L +QVI+ SEYR QLYDYLK+RM
Sbjct  83   LDFSGILDEDVEQEVKDAAIISMGTEISEEDLSNIGQLADQVIALSEYRAQLYDYLKARM  142

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLT LVGELVGARLI+H GSL+NLAK P STVQILGAEKALFRALKTKH TPKYG
Sbjct  143  NAIAPNLTVLVGELVGARLISHAGSLMNLAKHPASTVQILGAEKALFRALKTKHETPKYG  202

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISR LAAK AL+IR DALG+S ++T+G++ R K+EARLR LE
Sbjct  203  LIYHASLIGQAAPKFKGKISRVLAAKCALSIRVDALGESSEATIGVDAREKVEARLRQLE  262

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNP  95
            G+ LG  +G  K    I+ +DKDR     AL+T  ++YNP
Sbjct  263  GKSLGEASGVKKLSGDIKKHDKDRNADAPALLTAPRSYNP  302



>ref|XP_001690352.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
 gb|EDP05611.1| nucleolar protein, component of C/D snoRNPs [Chlamydomonas reinhardtii]
Length=508

 Score =   311 bits (796),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFS IL EEVE  LK AA +SMGT++S+ DL NIK+L +QVI+ SEYRGQL++YLK+RM
Sbjct  219  LDFSAILEEEVEGALKAAAQVSMGTDISESDLDNIKDLAHQVIALSEYRGQLFEYLKNRM  278

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              +APNLT LVGELVGARLIAH GSL+NLAKQP STVQILGAEKALFRALKTKH TPKYG
Sbjct  279  AAVAPNLTILVGELVGARLIAHAGSLVNLAKQPASTVQILGAEKALFRALKTKHETPKYG  338

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQ+ PK+KGKISR LAAK ALAIR DALGD+ D+T+G+E R K+EARLR LE
Sbjct  339  LIYHASLIGQSQPKYKGKISRVLAAKCALAIRVDALGDTSDATVGIEARQKVEARLRQLE  398

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADS  83
            G+ LG  AG++KGK +   YDK R+    AL T  KAYN  AD+
Sbjct  399  GKLLGTEAGNSKGKEQPAKYDKARQGATPALATAPKAYNADADA  442



>ref|XP_001416562.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94855.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=474

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 180/220 (82%), Gaps = 0/220 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            +DFS IL E+VE E+K+AA+ISMGTE+S+ DL NI +L +QVIS SEYR QLYDYLK+RM
Sbjct  218  IDFSGILDEDVEQEVKDAAIISMGTEISEEDLSNIGQLADQVISLSEYRAQLYDYLKARM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLT LVGELVGARLI+H GSL+NLAK P STVQILGAEKALFRALKTKH TPKYG
Sbjct  278  NAIAPNLTVLVGELVGARLISHAGSLMNLAKHPASTVQILGAEKALFRALKTKHETPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISR LAAK AL+IR DALG+S ++T+G+E R K+EARLR LE
Sbjct  338  LIYHASLIGQAAPKFKGKISRVLAAKCALSIRVDALGESSEATIGVEAREKVEARLRQLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNP  95
            G+ LG  +G  K    I+ +DKDR     AL+T  ++YNP
Sbjct  398  GKTLGEASGVKKMSGDIKKHDKDRNADAPALLTAPRSYNP  437



>emb|CEF96991.1| NOSIC [Ostreococcus tauri]
Length=476

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 180/220 (82%), Gaps = 0/220 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFS IL E+VE E+K+AA+ISMGTE+S+ DL NI +L +QVI+ SEYR QLYDYLK+RM
Sbjct  218  LDFSGILDEDVEQEVKDAAIISMGTEISEEDLSNIGQLADQVIALSEYRAQLYDYLKARM  277

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLT LVGELVGARLI+H GSL+NLAK P STVQILGAEKALFRALKTKH TPKYG
Sbjct  278  NAIAPNLTVLVGELVGARLISHAGSLMNLAKHPASTVQILGAEKALFRALKTKHETPKYG  337

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASLIGQAAPK KGKISR LAAK AL+IR DALG+S ++T+G++ R K+EARLR LE
Sbjct  338  LIYHASLIGQAAPKFKGKISRVLAAKCALSIRVDALGESSEATIGVDAREKVEARLRQLE  397

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNP  95
            G+ LG  +G  K    I+ +DKDR     AL+T  ++YNP
Sbjct  398  GKSLGEASGVKKLSGDIKKHDKDRNADAPALLTAPRSYNP  437



>ref|XP_003056558.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
 gb|EEH59934.1| nucleolar RNA binding protein [Micromonas pusilla CCMP1545]
Length=469

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/240 (65%), Positives = 187/240 (78%), Gaps = 3/240 (1%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            DFS +L E+VE +LK AAMISMGTE+S+ DL NIK+L  QV+S  EYR QLYDYLKSRM 
Sbjct  219  DFSVVLDEDVEEDLKSAAMISMGTEISEDDLNNIKQLAEQVVSLCEYRTQLYDYLKSRMT  278

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT LVGELVGARLI+H GSL+NLAK P STVQILGAEKALFRALKTKH TPKYGL
Sbjct  279  AIAPNLTVLVGELVGARLISHAGSLINLAKHPASTVQILGAEKALFRALKTKHETPKYGL  338

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASLIGQ APK KGKISR LAAK AL+IR DALG+S ++T+G+++R+K+EARLR LEG
Sbjct  339  IYHASLIGQTAPKFKGKISRVLAAKCALSIRVDALGESSEATIGIDSRSKVEARLRQLEG  398

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE-DEPEL  35
              L   +G A+GK  +  ++K R     +L+T  KAYNP AD  + H E   ++ D+P L
Sbjct  399  SVLVTASGVARGKESLSKHNKYRSTDVPSLLTAPKAYNPEAD--VKHQEKAEHDSDKPSL  456



>gb|KDO24106.1| hypothetical protein SPRG_10894 [Saprolegnia parasitica CBS 223.65]
Length=492

 Score =   299 bits (766),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 181/241 (75%), Gaps = 9/241 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL  +VEA ++E   +SMGT++S+ D++NI  LC QVIS +EYRGQL+DYLK
Sbjct  219  VKSLDFSDILSSDVEASMREVCEVSMGTDISEEDVINIGSLCEQVISLTEYRGQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGD+ ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDATEATIGFDNRAKVEARMR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPA-KAYNPAADSVLGHTEPTANED  47
             LE    G  +G  K K   + Y K+         TPA K YN A D  +       ++D
Sbjct  399  QLENGFTGIASGKGKAKTDAKKYVKE--------ATPATKVYNDADDMKVQKKRKAEDDD  450

Query  46   E  44
            E
Sbjct  451  E  451



>ref|XP_008872332.1| hypothetical protein H310_08394 [Aphanomyces invadans]
 gb|ETV98904.1| hypothetical protein H310_08394 [Aphanomyces invadans]
Length=494

 Score =   299 bits (765),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL  +VEA ++E   +SMGT++SD D++NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKNLDFSDILSADVEASMREVCEVSMGTDISDEDVLNIASLCTQVISLTEYRTQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKT+LA+R DALGD+ ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTSLAVRVDALGDATEATIGFDNRAKVEARMR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G ++G  K K +++ Y K+    P   +   K+YN A D
Sbjct  399  QLENGFTGVVSGKGKAKNEVKKYVKE----P---VAAVKSYNDADD  437



>gb|EPS70798.1| hypothetical protein M569_03961, partial [Genlisea aurea]
Length=392

 Score =   295 bits (756),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/172 (85%), Positives = 161/172 (94%), Gaps = 1/172 (1%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSE+L EE+EAELKEAA ISMGTEV + DL NI+ LC+QV+S +EYR QL+DYLK+RM
Sbjct  221  LDFSEMLSEEIEAELKEAAKISMGTEVGENDLENIRGLCDQVLSLAEYRAQLHDYLKARM  280

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            NTIAPNLTA+VGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG
Sbjct  281  NTIAPNLTAIVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  340

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDS-QDSTMGLENRAK  242
            LIYHASL+GQAAPKHKGK+SRSLAAK ALAIRYDALGDS +D++MGLE RAK
Sbjct  341  LIYHASLVGQAAPKHKGKMSRSLAAKAALAIRYDALGDSTEDNSMGLEYRAK  392



>ref|XP_002874404.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50663.1| hypothetical protein ARALYDRAFT_326985 [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/185 (77%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
            LDFSEIL +EVEAELKE A+ISMGTEV+D+DL++I++LC+Q++S +EYR QL DYLKSRM
Sbjct  194  LDFSEILADEVEAELKEVAVISMGTEVTDLDLIHIRQLCDQILSLAEYRAQLNDYLKSRM  253

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
            N IAPNLTALVGELVGARLI+H GSLLNLAK PGST+QILGAEKAL+RA +  HATPK+G
Sbjct  254  NKIAPNLTALVGELVGARLISHCGSLLNLAKLPGSTIQILGAEKALYRARRMNHATPKHG  313

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHA ++ QAAP+HKGKISRSLAAK ALAIR DA GD QD+TMG+E R KLEARLRNLE
Sbjct  314  LIYHAPVVSQAAPEHKGKISRSLAAKAALAIRCDAFGDGQDNTMGVETRLKLEARLRNLE  373

Query  214  GRDLG  200
            G DLG
Sbjct  374  GGDLG  378



>ref|XP_008618047.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
 gb|EQC28399.1| hypothetical protein SDRG_13728 [Saprolegnia diclina VS20]
Length=492

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/241 (62%), Positives = 181/241 (75%), Gaps = 9/241 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL  +VEA ++E   +SMGT++S+ D++NI  LC QVIS +EYRGQL+DYLK
Sbjct  219  VKSLDFSDILSSDVEASMREVCEVSMGTDISEEDVINIGSLCEQVISLTEYRGQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGD+ ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDATEATIGFDNRAKVEARMR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPA-KAYNPAADSVLGHTEPTANED  47
             LE    G  +G  K K   + Y K+         TPA + YN A D  +       ++D
Sbjct  399  QLENGFTGIASGKGKAKNDPKKYVKE--------ATPATQVYNDANDMKVAKKRKAEDDD  450

Query  46   E  44
            E
Sbjct  451  E  451



>ref|XP_008423022.1| PREDICTED: nucleolar protein 58 [Poecilia reticulata]
Length=532

 Score =   298 bits (762),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 182/247 (74%), Gaps = 9/247 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D SEILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DMSEILPEEIEAEVKLAAEISMGTEVSEQDIGNIRHLCDQVIEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAKTALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKTALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELE  32
            R + R++G+ K   K + Y            +  K Y+P+ DS +  T      +E E E
Sbjct  402  RGIRRISGTGKAMAKADKYQHK---------SEVKIYDPSGDSTIPSTSKKRKFEEVEGE  452

Query  31   KMDAEAV  11
            K + + V
Sbjct  453  KSEQDPV  459



>ref|XP_009836884.1| hypothetical protein H257_11594 [Aphanomyces astaci]
 gb|ETV73458.1| hypothetical protein H257_11594 [Aphanomyces astaci]
Length=510

 Score =   297 bits (760),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 178/226 (79%), Gaps = 7/226 (3%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL  +VEA ++E   +SMGT++S+ D++NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKNLDFSDILSSDVEASMREVCEVSMGTDISEEDVLNIGSLCTQVISLTEYRTQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKT+LA+R DALGD+ ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTSLAVRVDALGDATEATIGFDNRAKVEARMR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G ++G  K K +++ Y K+    P   +   K+YN A D
Sbjct  399  QLENGFTGVVSGKGKAKNEVKKYVKE----P---VAAVKSYNDAED  437



>ref|XP_007565432.1| PREDICTED: nucleolar protein 58 isoform X1 [Poecilia formosa]
Length=543

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 182/247 (74%), Gaps = 9/247 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D SEILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QVI  SEYR QLYDYLK+RM 
Sbjct  231  DLSEILPEEIEAEVKLAAEISMGTEVSEQDIGNIRHLCDQVIEISEYRAQLYDYLKNRMM  290

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  291  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  350

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAKTALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  351  IYHASLVGQTTAKNKGKISRMLAAKTALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  410

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELE  32
            R + R++G+ K   K + Y            +  K Y+P+ DS +  T      +E E E
Sbjct  411  RGIRRISGTGKAMAKADKYQHK---------SEVKIYDPSGDSTIPSTSKKRKFEEVEGE  461

Query  31   KMDAEAV  11
            K + + V
Sbjct  462  KSEQDPV  468



>ref|XP_004874566.1| PREDICTED: nucleolar protein 58-like [Heterocephalus glaber]
Length=385

 Score =   293 bits (749),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/258 (60%), Positives = 184/258 (71%), Gaps = 23/258 (9%)
 Frame = -1

Query  763  LQKLD---------FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEY  611
            LQK+D          SE LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEY
Sbjct  46   LQKVDDRENYASATLSEFLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEY  105

Query  610  RGQLYDYLKSRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFR  431
            R QLY YL++RM  IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFR
Sbjct  106  RTQLYKYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFR  165

Query  430  ALKTKHATPKYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLEN  251
            ALK++  TPKYGLIYHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+EN
Sbjct  166  ALKSRQDTPKYGLIYHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSVMGVEN  225

Query  250  RAKLEARLRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGH  71
            RAKLEARLR+LE R + +++G+ K   K E Y+           +  K Y+P+ DS L  
Sbjct  226  RAKLEARLRSLEDRGIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL--  274

Query  70   TEPTANEDEPELEKMDAE  17
              PT ++   ++E +D E
Sbjct  275  --PTCSKKR-KIEHVDKE  289



>ref|XP_007565433.1| PREDICTED: nucleolar protein 58 isoform X2 [Poecilia formosa]
Length=534

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 155/247 (63%), Positives = 182/247 (74%), Gaps = 9/247 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D SEILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DLSEILPEEIEAEVKLAAEISMGTEVSEQDIGNIRHLCDQVIEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAKTALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKTALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELE  32
            R + R++G+ K   K + Y            +  K Y+P+ DS +  T      +E E E
Sbjct  402  RGIRRISGTGKAMAKADKYQHK---------SEVKIYDPSGDSTIPSTSKKRKFEEVEGE  452

Query  31   KMDAEAV  11
            K + + V
Sbjct  453  KSEQDPV  459



>ref|XP_007908792.1| PREDICTED: nucleolar protein 58 [Callorhinchus milii]
Length=543

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 177/225 (79%), Gaps = 9/225 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEEVEA +K AA ISMGTEVS+ D++NI  LC+QV+  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEVEAAVKVAAEISMGTEVSEEDIVNILHLCDQVVEISEYRTQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTIMVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ  PK+KGK+SR LAAKTALAIRYDALGD  +  +G+ENRAKLE RLR+LE 
Sbjct  342  IYHASLLGQTTPKNKGKMSRMLAAKTALAIRYDALGDDTNGELGVENRAKLEIRLRHLEE  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            R L R++G+ K   K   +DK + K      +  K Y+PAADS L
Sbjct  402  RGLRRISGTGKALAK---FDKYQNK------SEVKVYDPAADSTL  437



>ref|XP_004899183.1| PREDICTED: nucleolar protein 58-like [Heterocephalus glaber]
Length=404

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 185/261 (71%), Gaps = 23/261 (9%)
 Frame = -1

Query  772  VQMLQKLD---------FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISF  620
             + LQK+D          SE LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  
Sbjct  62   CKRLQKVDDRENYASATLSEFLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEI  121

Query  619  SEYRGQLYDYLKSRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKA  440
            SEYR QLY YL++RM  IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKA
Sbjct  122  SEYRTQLYKYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKA  181

Query  439  LFRALKTKHATPKYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMG  260
            LFRALK++  TPKYGLIYHAS++GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG
Sbjct  182  LFRALKSRQDTPKYGLIYHASVVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSVMG  241

Query  259  LENRAKLEARLRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSV  80
            +ENRAKLEARLR+LE R + +++G+ K   K E Y+           +  K Y+P+ DS 
Sbjct  242  VENRAKLEARLRSLEDRGIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDST  292

Query  79   LGHTEPTANEDEPELEKMDAE  17
            L    PT ++   ++E +D E
Sbjct  293  L----PTCSKKR-KIEHVDKE  308



>ref|XP_004601337.1| PREDICTED: nucleolar protein 58 [Sorex araneus]
Length=534

 Score =   295 bits (756),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 185/246 (75%), Gaps = 14/246 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ++PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++ + ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSK-KRKIEQ  447

Query  28   MDAEAV  11
            +D E V
Sbjct  448  VDTEEV  453



>ref|XP_006636806.1| PREDICTED: nucleolar protein 58-like [Lepisosteus oculatus]
Length=527

 Score =   295 bits (755),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 172/225 (76%), Gaps = 9/225 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEEVE E+K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEVEGEVKTAAEISMGTEVSEEDIANISHLCDQVIEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTIMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRRDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ  PK+KGKISR LAAK ALAIRYDALGD  ++ MG ENRAKLEARLR+LE 
Sbjct  342  IYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGDDTNAEMGTENRAKLEARLRHLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            R + +++G+ K   + E Y            +  K Y+P+ DS L
Sbjct  402  RGIRKISGTGKALARAEKYQHK---------SEVKFYDPSGDSTL  437



>emb|CAH91951.1| hypothetical protein [Pongo abelii]
Length=472

 Score =   293 bits (751),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++ + ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSK-KRKIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>gb|EFB14929.1| hypothetical protein PANDA_007776 [Ailuropoda melanoleuca]
Length=455

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  210  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  269

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  270  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  329

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  330  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  389

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  390  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  435

Query  28   MDAE  17
            +D E
Sbjct  436  VDKE  439



>ref|XP_005808115.1| PREDICTED: nucleolar protein 58-like [Xiphophorus maculatus]
Length=535

 Score =   295 bits (755),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 152/243 (63%), Positives = 178/243 (73%), Gaps = 9/243 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D SE LPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DLSEFLPEEIEAEVKLAAEISMGTEVSEQDIGNIRHLCDQVIEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAKTALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKTALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELE  32
            R + R++G+ K   K + Y            +  K Y+P+ DS +  T      +E E  
Sbjct  402  RGIRRISGTGKAMAKADKYQHK---------SEVKIYDPSGDSTIPSTSKKRKFEEVETS  452

Query  31   KMD  23
            + D
Sbjct  453  EQD  455



>ref|XP_005574021.1| PREDICTED: nucleolar protein 58 isoform X2 [Macaca fascicularis]
Length=471

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_004674881.1| PREDICTED: nucleolar protein 58 [Condylura cristata]
Length=505

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  198  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  257

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  258  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  317

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  318  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  377

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   +LE+
Sbjct  378  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSVDSTL----PTCSKKR-KLEQ  423

Query  28   MDAE  17
            +D E
Sbjct  424  VDKE  427



>ref|XP_007654286.1| PREDICTED: nucleolar protein 58, partial [Ornithorhynchus anatinus]
Length=483

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 172/231 (74%), Gaps = 9/231 (4%)
 Frame = -1

Query  769  QMLQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDY  590
            Q     D SEILPEE+E ++K AA +SMGTEVS+ D+ NI  LCNQVI  SEYR QLYDY
Sbjct  175  QNFASCDLSEILPEEIEGQVKAAAEVSMGTEVSEEDISNILHLCNQVIEISEYRNQLYDY  234

Query  589  LKSRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHA  410
            L +RM  IAPNLT +VGELVGARL+AH GSLLNLAK P STVQILGAEKALFRALKT+  
Sbjct  235  LTNRMMAIAPNLTVMVGELVGARLVAHAGSLLNLAKHPASTVQILGAEKALFRALKTRRD  294

Query  409  TPKYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEAR  230
            TPKYGLIYHASL+GQ+ PK+KGKISR LAAKT LAIRYDALG+   + MG+ENRAKLE R
Sbjct  295  TPKYGLIYHASLVGQSTPKNKGKISRMLAAKTVLAIRYDALGEDSSAEMGVENRAKLEVR  354

Query  229  LRNLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            LR+LE R L R++G+ K   K + Y            +  K Y+P+ DS L
Sbjct  355  LRHLEERGLRRISGTGKALAKADKYLNR---------SEVKTYDPSGDSTL  396



>ref|XP_009442289.1| PREDICTED: nucleolar protein 58 isoform X3 [Pan troglodytes]
Length=466

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_008972452.1| PREDICTED: nucleolar protein 58 isoform X2 [Pan paniscus]
Length=466

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_004626797.1| PREDICTED: nucleolar protein 58 [Octodon degus]
Length=490

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  177  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  236

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  237  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  296

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  297  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  356

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   +LE+
Sbjct  357  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KLEQ  402

Query  28   MDAE  17
            ++ E
Sbjct  403  VEKE  406



>ref|XP_005574022.1| PREDICTED: nucleolar protein 58 isoform X3 [Macaca fascicularis]
Length=467

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_007090044.1| PREDICTED: nucleolar protein 58 isoform X2 [Panthera tigris altaica]
Length=478

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRSLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_004426861.1| PREDICTED: nucleolar protein 58 [Ceratotherium simum simum]
Length=537

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E YD           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYDHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>emb|CAB55989.2| hypothetical protein [Homo sapiens]
Length=442

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/233 (64%), Positives = 174/233 (75%), Gaps = 13/233 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMVA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANE  50
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSK  441



>gb|ACA96503.1| MAR-binding protein [Dunaliella salina]
Length=541

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 177/223 (79%), Gaps = 1/223 (0%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            DFS I+ E+ E  LK+AA++SMGTE+S  DLM I+EL +QVI    YRGQL+DYLKSRMN
Sbjct  220  DFSGIIEEDTEQHLKDAAIVSMGTEISQEDLMRIRELADQVIDLYAYRGQLFDYLKSRMN  279

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT LVGELVGARLI+H GSL+NLAKQP STVQILGAEKALFRALKTKH TPKYGL
Sbjct  280  AIAPNLTVLVGELVGARLISHAGSLINLAKQPASTVQILGAEKALFRALKTKHETPKYGL  339

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASLIGQ++ K+KGK+SR LAAK ALA R DALG+ +D+ +G++ R+K+EARLR LEG
Sbjct  340  IYHASLIGQSSSKYKGKVSRVLAAKCALATRVDALGEGEDAQIGIDARSKVEARLRQLEG  399

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGA-LITPAKAYNPAAD  86
            + L    G AKGK +   YDK +++ P A L T  KAYN  AD
Sbjct  400  KTLITDGGKAKGKEQPAPYDKTKQQSPAAGLSTVPKAYNADAD  442



>ref|XP_008515600.1| PREDICTED: nucleolar protein 58 isoform X1 [Equus przewalskii]
Length=471

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>emb|CAJ82550.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=482

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 172/226 (76%), Gaps = 9/226 (4%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
             D SEILPEEVE E+K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM
Sbjct  221  FDLSEILPEEVETEVKAAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRM  280

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYG
Sbjct  281  MAIAPNLTVLVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYG  340

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ +G+E RAKLE+RLR+LE
Sbjct  341  LIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAELGVETRAKLESRLRHLE  400

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + L R++G+ K   + E Y            +  + Y+P+ DS L
Sbjct  401  EKGLKRISGTGKALARAEKYQHK---------SEVRTYDPSGDSTL  437



>ref|XP_005640605.1| PREDICTED: nucleolar protein 58 isoform X3 [Canis lupus familiaris]
Length=477

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_007964076.1| PREDICTED: nucleolar protein 58 isoform X2 [Chlorocebus sabaeus]
Length=467

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDRE  388



>ref|XP_006921427.1| PREDICTED: nucleolar protein 58 isoform X2 [Pteropus alecto]
 ref|XP_011367438.1| PREDICTED: nucleolar protein 58 isoform X2 [Pteropus vampyrus]
 ref|XP_011367440.1| PREDICTED: nucleolar protein 58 isoform X2 [Pteropus vampyrus]
 ref|XP_011367441.1| PREDICTED: nucleolar protein 58 isoform X2 [Pteropus vampyrus]
Length=465

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_007190604.1| PREDICTED: nucleolar protein 58 isoform X3 [Balaenoptera acutorostrata 
scammoni]
Length=494

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  179  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  238

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  239  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  298

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  299  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  358

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  359  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  404

Query  28   MDAE  17
            +D E
Sbjct  405  VDKE  408



>ref|XP_006935541.1| PREDICTED: nucleolar protein 58 isoform X2 [Felis catus]
Length=478

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_007117842.1| PREDICTED: nucleolar protein 58 isoform X2 [Physeter catodon]
 ref|XP_007117843.1| PREDICTED: nucleolar protein 58 isoform X3 [Physeter catodon]
Length=474

 Score =   292 bits (747),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_011223163.1| PREDICTED: nucleolar protein 58 isoform X2 [Ailuropoda melanoleuca]
Length=475

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_009442288.1| PREDICTED: nucleolar protein 58 isoform X2 [Pan troglodytes]
Length=494

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  187  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  246

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  247  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  306

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  307  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  366

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  367  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  412

Query  28   MDAE  17
            +D E
Sbjct  413  VDKE  416



>ref|XP_007190605.1| PREDICTED: nucleolar protein 58 isoform X4 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007190606.1| PREDICTED: nucleolar protein 58 isoform X5 [Balaenoptera acutorostrata 
scammoni]
Length=474

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_008685595.1| PREDICTED: nucleolar protein 58 isoform X2 [Ursus maritimus]
Length=477

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>gb|AAH09306.1| NOP58 protein, partial [Homo sapiens]
Length=522

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|NP_057018.1| nucleolar protein 58 [Homo sapiens]
 sp|Q9Y2X3.1|NOP58_HUMAN RecName: Full=Nucleolar protein 58; AltName: Full=Nucleolar protein 
5 [Homo sapiens]
 gb|AAD27610.1|AF123534_1 nucleolar protein NOP5/NOP58 [Homo sapiens]
 gb|AAF91394.1|AF263608_1 nucleolar protein 5 [Homo sapiens]
 gb|AAH32592.1| NOP58 ribonucleoprotein homolog (yeast) [Homo sapiens]
 gb|AAY24145.1| unknown [Homo sapiens]
 gb|EAW70308.1| nucleolar protein NOP5/NOP58 [Homo sapiens]
 gb|ABM81794.1| nucleolar protein NOP5/NOP58 [synthetic construct]
 gb|ABW03291.1| nucleolar protein NOP5/NOP58 [synthetic construct]
 dbj|BAI46615.1| NOP58 ribonucleoprotein homolog [synthetic construct]
 gb|AIC51532.1| NOP58, partial [synthetic construct]
Length=529

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_007190603.1| PREDICTED: nucleolar protein 58 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=502

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  187  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  246

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  247  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  306

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  307  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  366

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  367  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  412

Query  28   MDAE  17
            +D E
Sbjct  413  VDKE  416



>ref|XP_010970137.1| PREDICTED: nucleolar protein 58 isoform X2 [Camelus bactrianus]
 ref|XP_010990038.1| PREDICTED: nucleolar protein 58 isoform X2 [Camelus dromedarius]
Length=471

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>gb|ETL31667.1| hypothetical protein L916_15560 [Phytophthora parasitica]
 gb|ETL84897.1| hypothetical protein L917_15383 [Phytophthora parasitica]
Length=496

 Score =   292 bits (747),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 9/226 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL E+VEA ++E   +SMGT++S+ D+ NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKTLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGDS ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDSTEATIGFDNRAKVEARVR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G    + K K + + Y K            +K+YN  AD
Sbjct  399  QLENGFSGVPNSNGKTKNESKKYVKTE---------TSKSYNADAD  435



>gb|AAI30064.1| LOC398558 protein [Xenopus laevis]
 gb|AAI60690.1| LOC398558 protein [Xenopus laevis]
Length=488

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 172/226 (76%), Gaps = 9/226 (4%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
             D SEILPEEVE E+K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM
Sbjct  221  FDLSEILPEEVETEVKGAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRM  280

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYG
Sbjct  281  MAIAPNLTVLVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYG  340

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ +G+E RAKLE+RLR+LE
Sbjct  341  LIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAELGVETRAKLESRLRHLE  400

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + L R++G+ K   + E Y            +  + Y+P+ DS L
Sbjct  401  EKGLKRISGTGKALARAEKYQHK---------SEVRTYDPSGDSTL  437



>gb|AAH44082.1| LOC398558 protein, partial [Xenopus laevis]
Length=489

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 172/226 (76%), Gaps = 9/226 (4%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
             D SEILPEEVE E+K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM
Sbjct  221  FDLSEILPEEVETEVKGAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRM  280

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYG
Sbjct  281  MAIAPNLTVLVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYG  340

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ +G+E RAKLE+RLR+LE
Sbjct  341  LIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAELGVETRAKLESRLRHLE  400

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + L R++G+ K   + E Y            +  + Y+P+ DS L
Sbjct  401  EKGLKRISGTGKALARAEKYQHK---------SEVRTYDPSGDSTL  437



>gb|ETI38018.1| hypothetical protein F443_16119 [Phytophthora parasitica P1569]
 gb|ETK78232.1| hypothetical protein L915_15665 [Phytophthora parasitica]
 gb|ETM38080.1| hypothetical protein L914_15515 [Phytophthora parasitica]
 gb|ETO66787.1| hypothetical protein F444_16104 [Phytophthora parasitica P1976]
 gb|ETP07908.1| hypothetical protein F441_15948 [Phytophthora parasitica CJ01A1]
 gb|ETP35975.1| hypothetical protein F442_15972 [Phytophthora parasitica P10297]
Length=496

 Score =   292 bits (747),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 9/226 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL E+VEA ++E   +SMGT++S+ D+ NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKTLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGDS ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDSTEATIGFDNRAKVEARVR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G    + K K + + Y K            +K+YN  AD
Sbjct  399  QLENGFSGVPNSNGKTKNESKKYVKTE---------TSKSYNADAD  435



>ref|XP_003925690.1| PREDICTED: nucleolar protein 58 [Saimiri boliviensis boliviensis]
Length=469

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 180/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSEFLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_008515601.1| PREDICTED: nucleolar protein 58 isoform X2 [Equus przewalskii]
Length=526

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  214  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  273

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  274  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  333

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  334  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  393

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  394  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  439

Query  28   MDAE  17
            +D E
Sbjct  440  VDKE  443



>ref|XP_010614436.1| PREDICTED: nucleolar protein 58 isoform X2 [Fukomys damarensis]
Length=470

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 176/241 (73%), Gaps = 15/241 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT------EPTANED  47
             + +++G+ K   K E Y+           +  K Y+P+ DS L         E T  ED
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTLPTCSKKRKLEQTNKED  389

Query  46   E  44
            E
Sbjct  390  E  390



>ref|XP_002903084.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
 gb|EEY55508.1| nucleolar protein NOP5 [Phytophthora infestans T30-4]
Length=519

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 9/226 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL E+VEA ++E   +SMGT++S+ D+ NI  LC QVIS +EYR QL+DYLK
Sbjct  242  VKSLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYLK  301

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  302  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  361

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGDS ++T+G +NRAK+EAR+R
Sbjct  362  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDSTEATIGFDNRAKVEARVR  421

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G    + K K + + Y K            +K+YN  AD
Sbjct  422  QLENGFSGVPNSNGKTKNESKKYVKTE---------TSKSYNADAD  458



>dbj|BAG51244.1| unnamed protein product [Homo sapiens]
Length=466

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 180/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T  VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVTVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_003820813.1| PREDICTED: nucleolar protein 58 isoform X1 [Pan paniscus]
Length=529

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_516036.2| PREDICTED: nucleolar protein 58 isoform X1 [Pan troglodytes]
Length=529

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|NP_001248115.1| nucleolar protein 58 [Macaca mulatta]
 ref|NP_001274590.1| nucleolar protein 58 [Macaca fascicularis]
 ref|XP_010385196.1| PREDICTED: nucleolar protein 58 [Rhinopithecus roxellana]
 sp|Q4R779.1|NOP58_MACFA RecName: Full=Nucleolar protein 58; AltName: Full=Nucleolar protein 
5 [Macaca fascicularis]
 dbj|BAE01043.1| unnamed protein product [Macaca fascicularis]
 gb|EHH21593.1| hypothetical protein EGK_04698 [Macaca mulatta]
 gb|EHH55087.1| hypothetical protein EGM_04221 [Macaca fascicularis]
Length=530

 Score =   293 bits (749),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_003966575.1| PREDICTED: nucleolar protein 58-like [Takifugu rubripes]
Length=525

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 177/243 (73%), Gaps = 14/243 (6%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D SEILPEE+EAE+K AA ISMGTEVS+ D+ NI  LC+QVI  S+YR QLYDYLK+RM 
Sbjct  222  DLSEILPEEIEAEVKLAAEISMGTEVSEQDINNIMHLCDQVIEISDYRTQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTLMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKAALAIRYDALGEDTNAEMGAENRAKLEARLRQLEE  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPT-----ANED  47
            R + R++G+ K   K + Y            +  K Y+P+ DS +  T          ED
Sbjct  402  RGIRRISGTGKAMAKADKYQHK---------SEVKIYDPSGDSTIPSTSKKRKFEEVAED  452

Query  46   EPE  38
            EPE
Sbjct  453  EPE  455



>ref|XP_005338975.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar protein 58 [Ictidomys 
tridecemlineatus]
Length=539

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSEFLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ++PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005640604.1| PREDICTED: nucleolar protein 58 isoform X2 [Canis lupus familiaris]
Length=537

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_007964075.1| PREDICTED: nucleolar protein 58 isoform X1 [Chlorocebus sabaeus]
Length=530

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDRE  451



>gb|EHB15488.1| Nucleolar protein 58, partial [Heterocephalus glaber]
Length=492

 Score =   291 bits (746),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  179  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  238

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  239  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  298

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  299  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  358

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E 
Sbjct  359  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEH  404

Query  28   MDAE  17
            +D E
Sbjct  405  VDKE  408



>ref|NP_989298.1| NOP58 ribonucleoprotein [Xenopus (Silurana) tropicalis]
 gb|AAH64169.1| nucleolar protein 5 [Xenopus (Silurana) tropicalis]
Length=533

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 172/226 (76%), Gaps = 9/226 (4%)
 Frame = -1

Query  754  LDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRM  575
             D SEILPEEVE E+K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM
Sbjct  221  FDLSEILPEEVETEVKAAAEISMGTEVSEEDINNILHLCDQVIEISEYRSQLYDYLKNRM  280

Query  574  NTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYG  395
              IAPNLT LVGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYG
Sbjct  281  MAIAPNLTVLVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYG  340

Query  394  LIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLE  215
            LIYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ +G+E RAKLE+RLR+LE
Sbjct  341  LIYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAELGVETRAKLESRLRHLE  400

Query  214  GRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + L R++G+ K   + E Y            +  + Y+P+ DS L
Sbjct  401  EKGLKRISGTGKALARAEKYQHK---------SEVRTYDPSGDSTL  437



>ref|XP_004393512.1| PREDICTED: nucleolar protein 58 isoform 2 [Odobenus rosmarus 
divergens]
Length=529

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005202671.1| PREDICTED: nucleolar protein 58 isoform X3 [Bos taurus]
 ref|XP_006080611.1| PREDICTED: nucleolar protein 58 isoform X4 [Bubalus bubalis]
 ref|XP_010800473.1| PREDICTED: nucleolar protein 58 isoform X3 [Bos taurus]
 ref|XP_010859290.1| PREDICTED: nucleolar protein 58 isoform X3 [Bison bison bison]
Length=476

 Score =   291 bits (744),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_007117841.1| PREDICTED: nucleolar protein 58 isoform X1 [Physeter catodon]
Length=537

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006921426.1| PREDICTED: nucleolar protein 58 isoform X1 [Pteropus alecto]
 ref|XP_011367437.1| PREDICTED: nucleolar protein 58 isoform X1 [Pteropus vampyrus]
 gb|ELK04848.1| Nucleolar protein 58 [Pteropus alecto]
Length=528

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005397115.1| PREDICTED: nucleolar protein 58 [Chinchilla lanigera]
Length=534

 Score =   293 bits (749),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSEFLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_004262889.1| PREDICTED: nucleolar protein 58 isoform 2 [Orcinus orca]
 ref|XP_004321651.1| PREDICTED: nucleolar protein 58-like isoform 2 [Tursiops truncatus]
Length=529

 Score =   292 bits (748),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKTALAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTALAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_007090043.1| PREDICTED: nucleolar protein 58 isoform X1 [Panthera tigris altaica]
Length=541

 Score =   293 bits (749),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_007190602.1| PREDICTED: nucleolar protein 58 isoform X1 [Balaenoptera acutorostrata 
scammoni]
Length=537

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005601801.1| PREDICTED: nucleolar protein 58 [Equus caballus]
Length=542

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  230  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  289

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  290  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  349

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  350  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  409

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  410  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  455

Query  28   MDAE  17
            +D E
Sbjct  456  VDKE  459



>ref|XP_006935540.1| PREDICTED: nucleolar protein 58 isoform X1 [Felis catus]
Length=541

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005640603.1| PREDICTED: nucleolar protein 58 isoform X1 [Canis lupus familiaris]
Length=540

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_004393511.1| PREDICTED: nucleolar protein 58 isoform 1 [Odobenus rosmarus 
divergens]
Length=539

 Score =   292 bits (748),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005202670.1| PREDICTED: nucleolar protein 58 isoform X2 [Bos taurus]
 ref|XP_010859289.1| PREDICTED: nucleolar protein 58 isoform X2 [Bison bison bison]
Length=504

 Score =   291 bits (746),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  187  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  246

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  247  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  306

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  307  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  366

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  367  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  412

Query  28   MDAE  17
            +D E
Sbjct  413  VDKE  416



>ref|XP_004262888.1| PREDICTED: nucleolar protein 58 isoform 1 [Orcinus orca]
 ref|XP_004321650.1| PREDICTED: nucleolar protein 58-like isoform 1 [Tursiops truncatus]
Length=537

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/244 (62%), Positives = 182/244 (75%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKTALAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTALAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_010600740.1| PREDICTED: nucleolar protein 58 isoform X2 [Loxodonta africana]
Length=470

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 181/242 (75%), Gaps = 14/242 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MD  23
            +D
Sbjct  385  VD  386



>ref|XP_005676440.1| PREDICTED: nucleolar protein 58 isoform X3 [Capra hircus]
Length=476

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEE  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_006080610.1| PREDICTED: nucleolar protein 58 isoform X3 [Bubalus bubalis]
Length=504

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  187  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  246

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  247  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  306

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  307  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  366

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  367  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  412

Query  28   MDAE  17
            +D E
Sbjct  413  VDKE  416



>ref|XP_006153112.1| PREDICTED: nucleolar protein 58-like isoform X3 [Tupaia chinensis]
Length=469

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEVSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++++
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIDQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDKE  388



>ref|XP_011223162.1| PREDICTED: nucleolar protein 58 isoform X1 [Ailuropoda melanoleuca]
Length=538

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005995462.1| PREDICTED: nucleolar protein 58 isoform X1 [Latimeria chalumnae]
Length=531

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 172/225 (76%), Gaps = 9/225 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEEVEA++K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEVEADVKAAAEISMGTEVSEEDISNILHLCDQVIEISEYRTQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLE RLR LE 
Sbjct  342  IYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAEMGTENRAKLEVRLRQLEE  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            R + +++G+ K   K++ Y            +  K Y+P+ DS L
Sbjct  402  RGIRKISGTGKALAKLDKYQHK---------SEVKTYDPSGDSTL  437



>ref|XP_005995463.1| PREDICTED: nucleolar protein 58 isoform X2 [Latimeria chalumnae]
Length=530

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 172/225 (76%), Gaps = 9/225 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEEVEA++K AA ISMGTEVS+ D+ NI  LC+QVI  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEVEADVKAAAEISMGTEVSEEDISNILHLCDQVIEISEYRTQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLIAH GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLIAHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ  PK+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLE RLR LE 
Sbjct  342  IYHASLVGQTTPKNKGKISRMLAAKAALAIRYDALGEDTNAEMGTENRAKLEVRLRQLEE  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
            R + +++G+ K   K++ Y            +  K Y+P+ DS L
Sbjct  402  RGIRKISGTGKALAKLDKYQHK---------SEVKTYDPSGDSTL  437



>ref|XP_008911207.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
 gb|ETN03434.1| hypothetical protein PPTG_15671 [Phytophthora parasitica INRA-310]
Length=496

 Score =   291 bits (745),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 173/226 (77%), Gaps = 9/226 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL E+VEA ++E   +SMGT++S+ D+ NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKTLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGDS ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDSTEATIGFDNRAKVEARVR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G    + K K + + Y K            +K+YN  AD
Sbjct  399  QLENGFSGVPNSNGKIKNESKKYVKTE---------TSKSYNADAD  435



>ref|XP_008685594.1| PREDICTED: nucleolar protein 58 isoform X1 [Ursus maritimus]
Length=540

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006205257.1| PREDICTED: nucleolar protein 58 isoform X2 [Vicugna pacos]
Length=530

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_004904636.1| PREDICTED: nucleolar protein 58 [Heterocephalus glaber]
 ref|XP_004851261.1| PREDICTED: nucleolar protein 58-like [Heterocephalus glaber]
Length=535

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E 
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEH  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006205258.1| PREDICTED: nucleolar protein 58 isoform X3 [Vicugna pacos]
Length=529

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006189993.1| PREDICTED: nucleolar protein 58 isoform X3 [Camelus ferus]
Length=529

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006189992.1| PREDICTED: nucleolar protein 58 isoform X2 [Camelus ferus]
Length=530

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006189991.1| PREDICTED: nucleolar protein 58 isoform X1 [Camelus ferus]
 ref|XP_010970136.1| PREDICTED: nucleolar protein 58 isoform X1 [Camelus bactrianus]
 ref|XP_010990037.1| PREDICTED: nucleolar protein 58 isoform X1 [Camelus dromedarius]
Length=534

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006205256.1| PREDICTED: nucleolar protein 58 isoform X1 [Vicugna pacos]
Length=534

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_006153111.1| PREDICTED: nucleolar protein 58-like isoform X2 [Tupaia chinensis]
Length=497

 Score =   291 bits (744),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  187  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  246

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  247  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  306

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  307  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEVSSSAMGVENRAKLEARLRTLEDR  366

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++++
Sbjct  367  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIDQ  412

Query  28   MDAE  17
            +D E
Sbjct  413  VDKE  416



>ref|XP_004570503.1| PREDICTED: nucleolar protein 58-like isoform X1 [Maylandia zebra]
Length=536

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 174/228 (76%), Gaps = 9/228 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QV+  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEIEAEVKLAAEISMGTEVSEEDIGNIRHLCDQVVEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKAALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            + + R++G+ K   K+E Y            +  + Y+P+ DS +  T
Sbjct  402  KGIRRISGTGKAMAKVEKYQHK---------SEVRIYDPSGDSTIPST  440



>ref|XP_004570504.1| PREDICTED: nucleolar protein 58-like isoform X2 [Maylandia zebra]
 ref|XP_005744333.1| PREDICTED: nucleolar protein 58-like [Pundamilia nyererei]
Length=535

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 174/228 (76%), Gaps = 9/228 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QV+  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEIEAEVKLAAEISMGTEVSEEDIGNIRHLCDQVVEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKAALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            + + R++G+ K   K+E Y            +  + Y+P+ DS +  T
Sbjct  402  KGIRRISGTGKAMAKVEKYQHK---------SEVRIYDPSGDSTIPST  440



>ref|XP_010614435.1| PREDICTED: nucleolar protein 58 isoform X1 [Fukomys damarensis]
 gb|KFO18359.1| Nucleolar protein 58 [Fukomys damarensis]
Length=533

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/241 (63%), Positives = 176/241 (73%), Gaps = 15/241 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT------EPTANED  47
             + +++G+ K   K E Y+           +  K Y+P+ DS L         E T  ED
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTLPTCSKKRKLEQTNKED  452

Query  46   E  44
            E
Sbjct  453  E  453



>ref|XP_005858299.1| PREDICTED: nucleolar protein 58 isoform X3 [Myotis brandtii]
Length=473

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR +E R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRAIEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  384

Query  28   MDAE  17
            +D E
Sbjct  385  VDQE  388



>ref|XP_004764236.1| PREDICTED: nucleolar protein 58 isoform X3 [Mustela putorius 
furo]
 ref|XP_004794427.1| PREDICTED: nucleolar protein 58 isoform X3 [Mustela putorius 
furo]
Length=476

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 170/224 (76%), Gaps = 9/224 (4%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + +++G+ K   K E Y+           +  K Y+P+ DS L
Sbjct  339  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL  373



>ref|XP_008833673.1| PREDICTED: nucleolar protein 58 isoform X2 [Nannospalax galili]
Length=473

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 170/224 (76%), Gaps = 9/224 (4%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  159  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  218

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  219  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  278

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  279  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  338

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVL  77
             + +++G+ K   K E Y+           +  K Y+P+ DS L
Sbjct  339  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL  373



>ref|XP_009530825.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
 gb|EGZ13396.1| hypothetical protein PHYSODRAFT_246404 [Phytophthora sojae]
Length=489

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 173/226 (77%), Gaps = 9/226 (4%)
 Frame = -1

Query  763  LQKLDFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLK  584
            ++ LDFS+IL E+VEA ++E   +SMGT++S+ D+ NI  LC QVIS +EYR QL+DYLK
Sbjct  219  VKSLDFSDILSEDVEASMREVCEVSMGTDISEEDVTNISALCEQVISLTEYRAQLFDYLK  278

Query  583  SRMNTIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATP  404
            +RMN IAPNLT +VGELVGARLIAH GSL+NLAK P STVQILGAEKALFRALKTKH TP
Sbjct  279  NRMNAIAPNLTVMVGELVGARLIAHAGSLMNLAKHPASTVQILGAEKALFRALKTKHDTP  338

Query  403  KYGLIYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLR  224
            KYGLIYHASLIGQ APKHKGKISR LAAKTALA+R DALGD+ ++T+G +NRAK+EAR+R
Sbjct  339  KYGLIYHASLIGQTAPKHKGKISRVLAAKTALAVRVDALGDATEATIGFDNRAKVEARVR  398

Query  223  NLEGRDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAAD  86
             LE    G    + K K + + Y K            +K+YN  AD
Sbjct  399  QLENGFSGIPNSNGKTKNEAKKYVKTE---------TSKSYNADAD  435



>gb|ELR50156.1| Nucleolar protein 58, partial [Bos mutus]
Length=526

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  209  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  268

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  269  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  328

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  329  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  388

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  389  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  434

Query  28   MDAE  17
            +D E
Sbjct  435  VDKE  438



>ref|XP_005943429.1| PREDICTED: nucleolar protein 58-like isoform X2 [Haplochromis 
burtoni]
Length=535

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 174/228 (76%), Gaps = 9/228 (4%)
 Frame = -1

Query  751  DFSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMN  572
            D S+ILPEE+EAE+K AA ISMGTEVS+ D+ NI+ LC+QV+  SEYR QLYDYLK+RM 
Sbjct  222  DLSDILPEEIEAEVKLAAEISMGTEVSEEDIGNIRHLCDQVVEISEYRAQLYDYLKNRMM  281

Query  571  TIAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGL  392
             IAPNLT +VGELVGARLI+H GSLLNLAK P STVQILGAEKALFRALKT+  TPKYGL
Sbjct  282  AIAPNLTVMVGELVGARLISHAGSLLNLAKHPASTVQILGAEKALFRALKTRKDTPKYGL  341

Query  391  IYHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEG  212
            IYHASL+GQ   K+KGKISR LAAK ALAIRYDALG+  ++ MG ENRAKLEARLR LE 
Sbjct  342  IYHASLVGQTTAKNKGKISRMLAAKAALAIRYDALGEDTNAEMGAENRAKLEARLRQLED  401

Query  211  RDLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHT  68
            + + R++G+ K   K+E Y            +  + Y+P+ DS +  T
Sbjct  402  KGIRRISGTGKAMAKVEKYQHK---------SEVRIYDPSGDSTIPST  440



>gb|ELW62707.1| Nucleolar protein 58, partial [Tupaia chinensis]
Length=520

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  210  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  269

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  270  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  329

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  330  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEVSSSAMGVENRAKLEARLRTLEDR  389

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++++
Sbjct  390  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIDQ  435

Query  28   MDAE  17
            +D E
Sbjct  436  VDKE  439



>ref|XP_003406179.1| PREDICTED: nucleolar protein 58 isoform X1 [Loxodonta africana]
Length=533

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 181/242 (75%), Gaps = 14/242 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR+LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRSLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MD  23
            +D
Sbjct  448  VD  449



>ref|NP_001179886.1| nucleolar protein 58 [Bos taurus]
 ref|XP_006080609.1| PREDICTED: nucleolar protein 58 isoform X2 [Bubalus bubalis]
 tpg|DAA32529.1| TPA: NOP58 ribonucleoprotein homolog isoform 1 [Bos taurus]
Length=529

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_005904317.1| PREDICTED: nucleolar protein 58 [Bos mutus]
Length=529

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEQ  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_004004885.1| PREDICTED: nucleolar protein 58 [Ovis aries]
 ref|XP_005980259.1| PREDICTED: nucleolar protein 58 isoform X3 [Pantholops hodgsonii]
Length=529

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 181/244 (74%), Gaps = 14/244 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKAEKYEHK---------SEVKTYDPSGDSTL----PTYSKKR-KIEE  447

Query  28   MDAE  17
            +D E
Sbjct  448  VDKE  451



>ref|XP_003254003.1| PREDICTED: nucleolar protein 58 [Nomascus leucogenys]
Length=530

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/242 (62%), Positives = 180/242 (74%), Gaps = 14/242 (6%)
 Frame = -1

Query  748  FSEILPEEVEAELKEAAMISMGTEVSDIDLMNIKELCNQVISFSEYRGQLYDYLKSRMNT  569
             SE+LPEEVEAE+K AA ISMGTEVS+ D+ NI  LC QVI  SEYR QLY+YL++RM  
Sbjct  222  LSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA  281

Query  568  IAPNLTALVGELVGARLIAHGGSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLI  389
            IAPN+T +VGELVGARLIAH GSLLNLAK   STVQILGAEKALFRALK++  TPKYGLI
Sbjct  282  IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLI  341

Query  388  YHASLIGQAAPKHKGKISRSLAAKTALAIRYDALGDSQDSTMGLENRAKLEARLRNLEGR  209
            YHASL+GQ +PKHKGKISR LAAKT LAIRYDA G+   S MG+ENRAKLEARLR LE R
Sbjct  342  YHASLVGQTSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGVENRAKLEARLRTLEDR  401

Query  208  DLGRLAGSAKGKPKIEVYDKDRKKGPGALITPAKAYNPAADSVLGHTEPTANEDEPELEK  29
             + +++G+ K   K E Y+           +  K Y+P+ DS L    PT ++   ++E+
Sbjct  402  GIRKISGTGKALAKTEKYEHK---------SEVKTYDPSGDSTL----PTCSKKR-KIEQ  447

Query  28   MD  23
            +D
Sbjct  448  VD  449



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310