BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031E04

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008361395.1|  PREDICTED: CDPK-related protein kinase-like        229   6e-72   
emb|CBI29399.3|  unnamed protein product                                233   3e-71   Vitis vinifera
ref|XP_009628482.1|  PREDICTED: CDPK-related protein kinase-like        225   2e-70   Nicotiana tomentosiformis
ref|XP_002522315.1|  calcium-dependent protein kinase, putative         234   7e-70   
ref|XP_003520170.1|  PREDICTED: CDPK-related kinase 5-like              234   5e-69   Glycine max [soybeans]
ref|XP_003528501.1|  PREDICTED: CDPK-related kinase 5-like              234   7e-69   Glycine max [soybeans]
ref|XP_007156536.1|  hypothetical protein PHAVU_003G294300g             234   7e-69   Phaseolus vulgaris [French bean]
ref|XP_004233433.1|  PREDICTED: CDPK-related kinase 5-like              234   9e-69   Solanum lycopersicum
ref|XP_006360222.1|  PREDICTED: CDPK-related protein kinase-like        234   1e-68   Solanum tuberosum [potatoes]
ref|XP_004232048.1|  PREDICTED: CDPK-related kinase 5                   234   1e-68   Solanum lycopersicum
emb|CAN74933.1|  hypothetical protein VITISV_044433                     234   1e-68   Vitis vinifera
ref|XP_002262855.3|  PREDICTED: CDPK-related kinase 5                   233   2e-68   Vitis vinifera
ref|XP_009611550.1|  PREDICTED: CDPK-related kinase 5                   233   2e-68   Nicotiana tomentosiformis
ref|XP_004505191.1|  PREDICTED: CDPK-related kinase 5-like isofor...    233   2e-68   Cicer arietinum [garbanzo]
ref|XP_009758726.1|  PREDICTED: CDPK-related kinase 5-like isofor...    233   3e-68   Nicotiana sylvestris
ref|XP_006338215.1|  PREDICTED: CDPK-related kinase 5-like              233   3e-68   Solanum tuberosum [potatoes]
gb|AAL30820.1|AF435452_1  calcium/calmodulin-dependent protein ki...    233   3e-68   Nicotiana tabacum [American tobacco]
ref|XP_004505190.1|  PREDICTED: CDPK-related kinase 5-like isofor...    233   4e-68   Cicer arietinum [garbanzo]
ref|XP_002281956.2|  PREDICTED: CDPK-related kinase 5                   231   8e-68   Vitis vinifera
emb|CAN82235.1|  hypothetical protein VITISV_007568                     231   9e-68   Vitis vinifera
gb|EYU39406.1|  hypothetical protein MIMGU_mgv1a0043831mg               218   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_006346445.1|  PREDICTED: CDPK-related kinase 5-like              230   3e-67   Solanum tuberosum [potatoes]
emb|CDP02477.1|  unnamed protein product                                230   3e-67   Coffea canephora [robusta coffee]
ref|XP_003608023.1|  Calcium/calmodulin-dependent protein kinase ...    229   4e-67   Medicago truncatula
ref|XP_006425849.1|  hypothetical protein CICLE_v10025192mg             230   4e-67   Citrus clementina [clementine]
ref|XP_008338287.1|  PREDICTED: CDPK-related kinase 5                   229   4e-67   Malus domestica [apple tree]
gb|KDO79300.1|  hypothetical protein CISIN_1g007253mg                   230   4e-67   Citrus sinensis [apfelsine]
ref|XP_007204593.1|  hypothetical protein PRUPE_ppa003111mg             229   5e-67   Prunus persica
ref|XP_008241522.1|  PREDICTED: CDPK-related kinase 5                   229   7e-67   Prunus mume [ume]
ref|XP_007047191.1|  CDPK-related kinase                                229   9e-67   Theobroma cacao [chocolate]
gb|KDP31899.1|  hypothetical protein JCGZ_12360                         229   1e-66   Jatropha curcas
ref|XP_010268715.1|  PREDICTED: CDPK-related kinase 5                   229   1e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009801386.1|  PREDICTED: CDPK-related kinase 5-like              228   1e-66   Nicotiana sylvestris
ref|XP_008236646.1|  PREDICTED: CDPK-related kinase 5-like              228   1e-66   Prunus mume [ume]
ref|XP_007199766.1|  hypothetical protein PRUPE_ppa003176mg             228   1e-66   Prunus persica
ref|XP_004230803.1|  PREDICTED: CDPK-related kinase 5                   228   2e-66   Solanum lycopersicum
ref|XP_010107975.1|  CDPK-related protein kinase                        228   2e-66   Morus notabilis
ref|XP_011099193.1|  PREDICTED: CDPK-related protein kinase isofo...    223   2e-66   Sesamum indicum [beniseed]
ref|XP_004288057.1|  PREDICTED: CDPK-related kinase 5                   228   3e-66   Fragaria vesca subsp. vesca
ref|XP_011039202.1|  PREDICTED: CDPK-related kinase 5-like              228   3e-66   Populus euphratica
ref|XP_002310736.1|  hypothetical protein POPTR_0007s11320g             227   4e-66   
ref|XP_010268657.1|  PREDICTED: CDPK-related kinase 5-like isofor...    227   4e-66   Nelumbo nucifera [Indian lotus]
ref|XP_004290295.1|  PREDICTED: CDPK-related kinase 5-like              227   5e-66   Fragaria vesca subsp. vesca
gb|EYU44373.1|  hypothetical protein MIMGU_mgv1a003006mg                226   1e-65   Erythranthe guttata [common monkey flower]
gb|KJB43647.1|  hypothetical protein B456_007G210700                    225   2e-65   Gossypium raimondii
gb|KHG22049.1|  CDPK-related protein kinase                             225   2e-65   Gossypium arboreum [tree cotton]
gb|AAZ83348.1|  CDPK-related protein kinase                             225   3e-65   Gossypium hirsutum [American cotton]
gb|KJB43646.1|  hypothetical protein B456_007G210700                    224   5e-65   Gossypium raimondii
gb|KHF98882.1|  CDPK-related protein kinase                             224   6e-65   Gossypium arboreum [tree cotton]
ref|XP_011099192.1|  PREDICTED: CDPK-related kinase 5 isoform X1        224   8e-65   Sesamum indicum [beniseed]
gb|KCW63820.1|  hypothetical protein EUGRSUZ_G014962                    219   9e-65   Eucalyptus grandis [rose gum]
ref|XP_009366775.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_008392297.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Malus domestica [apple tree]
ref|XP_009347422.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_009366804.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_009358061.1|  PREDICTED: CDPK-related kinase 5-like              223   1e-64   Pyrus x bretschneideri [bai li]
ref|XP_002306462.1|  CROOKED family protein                             222   3e-64   Populus trichocarpa [western balsam poplar]
sp|P53681.1|CRK_DAUCA  RecName: Full=CDPK-related protein kinase;...    222   3e-64   Daucus carota [carrots]
ref|XP_004169045.1|  PREDICTED: CDPK-related protein kinase-like        207   5e-64   
ref|XP_004159890.1|  PREDICTED: CDPK-related protein kinase-like        217   6e-64   
gb|EPS64045.1|  hypothetical protein M569_10738                         207   6e-64   Genlisea aurea
gb|EPS68913.1|  hypothetical protein M569_05857                         213   7e-64   Genlisea aurea
ref|XP_006579812.1|  PREDICTED: CDPK-related kinase 5-like isofor...    216   2e-63   Glycine max [soybeans]
dbj|BAF00328.1|  calcium/calmodulin-dependent protein kinase CaMK1      214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010066051.1|  PREDICTED: CDPK-related kinase 5                   220   2e-63   Eucalyptus grandis [rose gum]
ref|XP_007042370.1|  CDPK-related kinase                                219   3e-63   
ref|XP_011085503.1|  PREDICTED: CDPK-related protein kinase-like        220   3e-63   Sesamum indicum [beniseed]
ref|XP_010926368.1|  PREDICTED: CDPK-related protein kinase-like        213   3e-63   
gb|AET04065.2|  calmodulin-domain kinase CDPK protein                   219   3e-63   Medicago truncatula
ref|XP_010103697.1|  CDPK-related protein kinase                        219   5e-63   Morus notabilis
ref|XP_010268648.1|  PREDICTED: CDPK-related kinase 5-like isofor...    219   6e-63   Nelumbo nucifera [Indian lotus]
ref|XP_008795162.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    219   6e-63   Phoenix dactylifera
ref|XP_010503722.1|  PREDICTED: CDPK-related kinase 5-like              219   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010916660.1|  PREDICTED: CDPK-related kinase 5                   219   7e-63   Elaeis guineensis
gb|AFC88293.1|  calcium-dependent protein kinase 6                      218   9e-63   Hevea brasiliensis [jebe]
ref|XP_002521854.1|  calcium-dependent protein kinase, putative         218   9e-63   Ricinus communis
ref|XP_003629589.1|  Calcium/calmodulin-dependent protein kinase ...    218   9e-63   
ref|XP_009409499.1|  PREDICTED: CDPK-related kinase 5-like              218   1e-62   
emb|CDO97150.1|  unnamed protein product                                218   1e-62   Coffea canephora [robusta coffee]
ref|NP_001169792.1|  uncharacterized protein LOC100383682               207   1e-62   
gb|KJB32432.1|  hypothetical protein B456_005G240400                    213   2e-62   Gossypium raimondii
emb|CDY69753.1|  BnaCnng65160D                                          216   2e-62   Brassica napus [oilseed rape]
ref|XP_004136991.1|  PREDICTED: CDPK-related protein kinase-like        217   2e-62   Cucumis sativus [cucumbers]
gb|KHN47935.1|  CDPK-related protein kinase                             217   2e-62   Glycine soja [wild soybean]
ref|XP_003525704.1|  PREDICTED: CDPK-related kinase 5-like isofor...    217   2e-62   Glycine max [soybeans]
ref|XP_010515424.1|  PREDICTED: CDPK-related kinase 5                   217   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006290766.1|  hypothetical protein CARUB_v10016874mg             217   3e-62   Capsella rubella
ref|XP_010426596.1|  PREDICTED: CDPK-related kinase 5-like              217   3e-62   Camelina sativa [gold-of-pleasure]
gb|KJB79287.1|  hypothetical protein B456_013G042100                    212   3e-62   Gossypium raimondii
gb|KDP38227.1|  hypothetical protein JCGZ_04870                         216   4e-62   Jatropha curcas
ref|XP_009101966.1|  PREDICTED: CDPK-related kinase 5-like isofor...    216   4e-62   Brassica rapa
gb|KJB79285.1|  hypothetical protein B456_013G042100                    212   4e-62   Gossypium raimondii
emb|CDY65016.1|  BnaCnng45690D                                          216   4e-62   Brassica napus [oilseed rape]
emb|CDY52824.1|  BnaAnng11710D                                          216   5e-62   Brassica napus [oilseed rape]
ref|XP_009115721.1|  PREDICTED: CDPK-related kinase 5                   216   5e-62   Brassica rapa
gb|KJB48534.1|  hypothetical protein B456_008G074300                    216   5e-62   Gossypium raimondii
gb|KFK34304.1|  hypothetical protein AALP_AA5G127600                    216   6e-62   Arabis alpina [alpine rockcress]
ref|XP_009101959.1|  PREDICTED: CDPK-related kinase 5-like isofor...    216   6e-62   Brassica rapa
gb|KHN36210.1|  CDPK-related protein kinase                             214   6e-62   Glycine soja [wild soybean]
ref|XP_006404024.1|  hypothetical protein EUTSA_v10010211mg             216   7e-62   Eutrema salsugineum [saltwater cress]
ref|XP_006290767.1|  hypothetical protein CARUB_v10016874mg             216   8e-62   
ref|XP_011007668.1|  PREDICTED: CDPK-related kinase 5-like              216   9e-62   Populus euphratica
ref|XP_002876036.1|  hypothetical protein ARALYDRAFT_485401             216   9e-62   
ref|NP_190622.1|  CDPK-related kinase                                   215   1e-61   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65651.1|  BnaCnng48080D                                          215   1e-61   Brassica napus [oilseed rape]
gb|KJB48530.1|  hypothetical protein B456_008G074300                    215   1e-61   Gossypium raimondii
ref|NP_001190048.1|  CDPK-related kinase                                215   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004509161.1|  PREDICTED: CDPK-related protein kinase-like        214   2e-61   Cicer arietinum [garbanzo]
ref|XP_010680435.1|  PREDICTED: CDPK-related kinase 5                   214   2e-61   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB32430.1|  hypothetical protein B456_005G240400                    214   2e-61   Gossypium raimondii
gb|KHG25548.1|  CDPK-related protein kinase                             214   3e-61   Gossypium arboreum [tree cotton]
ref|XP_003516596.1|  PREDICTED: CDPK-related kinase 5-like              214   4e-61   Glycine max [soybeans]
gb|KJB79283.1|  hypothetical protein B456_013G042100                    213   4e-61   Gossypium raimondii
gb|KHG30483.1|  CDPK-related protein kinase                             213   6e-61   Gossypium arboreum [tree cotton]
ref|XP_010558347.1|  PREDICTED: CDPK-related kinase 5-like              213   8e-61   Tarenaya hassleriana [spider flower]
gb|AAL30814.1|AF435446_1  calcium/calmodulin-dependent protein ki...    213   9e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550381.1|  PREDICTED: CDPK-related kinase 5 isoform X2        213   9e-61   Tarenaya hassleriana [spider flower]
ref|XP_006657969.1|  PREDICTED: CDPK-related protein kinase-like        208   2e-60   
ref|XP_010550380.1|  PREDICTED: CDPK-related kinase 5 isoform X1        213   2e-60   Tarenaya hassleriana [spider flower]
ref|XP_011005000.1|  PREDICTED: CDPK-related kinase 5-like              206   7e-60   Populus euphratica
gb|EPS69494.1|  hypothetical protein M569_05270                         211   8e-60   Genlisea aurea
ref|XP_008457867.1|  PREDICTED: CDPK-related kinase 5-like              211   8e-60   Cucumis melo [Oriental melon]
ref|XP_006384440.1|  hypothetical protein POPTR_0004s15110g             210   9e-60   Populus trichocarpa [western balsam poplar]
ref|XP_004148051.1|  PREDICTED: CDPK-related protein kinase-like        211   9e-60   Cucumis sativus [cucumbers]
gb|KDO49130.1|  hypothetical protein CISIN_1g007776mg                   209   1e-59   Citrus sinensis [apfelsine]
ref|XP_004511959.1|  PREDICTED: CDPK-related kinase 5-like              209   1e-59   Cicer arietinum [garbanzo]
ref|XP_006480135.1|  PREDICTED: CDPK-related kinase 5-like              209   3e-59   Citrus sinensis [apfelsine]
ref|XP_011001201.1|  PREDICTED: CDPK-related kinase 5-like              209   3e-59   Populus euphratica
gb|KDO49131.1|  hypothetical protein CISIN_1g007776mg                   208   4e-59   Citrus sinensis [apfelsine]
gb|EEC82459.1|  hypothetical protein OsI_26896                          205   4e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_008676192.1|  PREDICTED: CDPK-related protein kinase-like        195   6e-59   
tpg|DAA63630.1|  TPA: putative protein kinase superfamily protein       203   1e-58   
ref|XP_006423061.1|  hypothetical protein CICLE_v10028073mg             206   2e-58   Citrus clementina [clementine]
dbj|BAK06421.1|  predicted protein                                      206   3e-58   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008668447.1|  PREDICTED: uncharacterized protein LOC100383...    206   3e-58   
ref|XP_003611786.1|  CDPK-related protein kinase                        205   8e-58   Medicago truncatula
ref|NP_001060297.1|  Os07g0619800                                       202   8e-58   
ref|XP_006829951.1|  hypothetical protein AMTR_s00073p00197610          205   8e-58   Amborella trichopoda
ref|XP_003562669.1|  PREDICTED: CDPK-related kinase 5-like              205   8e-58   Brachypodium distachyon [annual false brome]
ref|XP_004958339.1|  PREDICTED: CDPK-related kinase 5-like              204   1e-57   Setaria italica
ref|XP_009389551.1|  PREDICTED: CDPK-related kinase 5-like              204   1e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006836275.1|  hypothetical protein AMTR_s00101p00154790          203   2e-57   Amborella trichopoda
gb|EMS58490.1|  CDPK-related protein kinase                             205   2e-57   Triticum urartu
ref|XP_010028268.1|  PREDICTED: CDPK-related kinase 5                   203   4e-57   Eucalyptus grandis [rose gum]
ref|XP_002463191.1|  hypothetical protein SORBIDRAFT_02g039460          203   4e-57   Sorghum bicolor [broomcorn]
gb|AAV64211.1|  putative CDPK-related protein kinase                    203   5e-57   Zea mays [maize]
gb|ACG29695.1|  hypothetical protein                                    203   5e-57   Zea mays [maize]
tpg|DAA63631.1|  TPA: LOW QUALITY PROTEIN: putative protein kinas...    203   5e-57   
ref|XP_007156824.1|  hypothetical protein PHAVU_002G020800g             202   7e-57   Phaseolus vulgaris [French bean]
dbj|BAC79915.1|  putative CDPK-related protein kinase                   201   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146922.1|  LOC100280531                                       201   2e-56   Zea mays [maize]
ref|XP_007155948.1|  hypothetical protein PHAVU_003G2460001g            186   8e-56   Phaseolus vulgaris [French bean]
ref|XP_010523218.1|  PREDICTED: CDPK-related kinase 8 isoform X2        196   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_010523217.1|  PREDICTED: CDPK-related kinase 8 isoform X1        196   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_008359596.1|  PREDICTED: CDPK-related kinase 1-like              184   4e-54   
ref|NP_181647.1|  CDPK-related kinase 1                                 194   6e-54   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001167827.1|  uncharacterized LOC100381527                       190   1e-53   Zea mays [maize]
ref|XP_002313096.2|  hypothetical protein POPTR_0009s10880g             193   1e-53   
ref|XP_006430540.1|  hypothetical protein CICLE_v10011368mg             189   2e-53   
ref|XP_002879911.1|  hypothetical protein ARALYDRAFT_483182             192   3e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_004249131.1|  PREDICTED: CDPK-related kinase 1                   192   3e-53   Solanum lycopersicum
ref|XP_004142011.1|  PREDICTED: CDPK-related protein kinase-like        192   4e-53   Cucumis sativus [cucumbers]
ref|XP_006393243.1|  hypothetical protein EUTSA_v10011327mg             192   5e-53   Eutrema salsugineum [saltwater cress]
ref|XP_007202163.1|  hypothetical protein PRUPE_ppa006385mg             188   6e-53   
gb|ACU18167.1|  unknown                                                 183   7e-53   Glycine max [soybeans]
gb|KDO53615.1|  hypothetical protein CISIN_1g0074582mg                  188   8e-53   Citrus sinensis [apfelsine]
emb|CDY35427.1|  BnaA03g19330D                                          191   1e-52   Brassica napus [oilseed rape]
ref|XP_009618516.1|  PREDICTED: CDPK-related kinase 7-like              191   1e-52   Nicotiana tomentosiformis
ref|XP_009133469.1|  PREDICTED: CDPK-related kinase 1                   191   1e-52   Brassica rapa
ref|XP_006411380.1|  hypothetical protein EUTSA_v10016437mg             191   1e-52   Eutrema salsugineum [saltwater cress]
emb|CDY22505.1|  BnaC03g23150D                                          191   1e-52   Brassica napus [oilseed rape]
ref|XP_010517602.1|  PREDICTED: CDPK-related kinase 1 isoform X3        186   1e-52   
ref|XP_006362272.1|  PREDICTED: CDPK-related kinase 1-like              190   2e-52   Solanum tuberosum [potatoes]
emb|CDX76010.1|  BnaA04g02740D                                          190   2e-52   
ref|XP_009761409.1|  PREDICTED: CDPK-related kinase 1-like              190   2e-52   Nicotiana sylvestris
gb|EEE59106.1|  hypothetical protein OsJ_10964                          187   2e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDY47375.1|  BnaC04g24880D                                          190   2e-52   Brassica napus [oilseed rape]
ref|XP_006482068.1|  PREDICTED: CDPK-related kinase 7-like              190   2e-52   Citrus sinensis [apfelsine]
ref|XP_011079071.1|  PREDICTED: CDPK-related kinase 1-like              190   2e-52   Sesamum indicum [beniseed]
ref|XP_009142724.1|  PREDICTED: CDPK-related kinase 1-like              190   2e-52   Brassica rapa
ref|XP_008668263.1|  PREDICTED: uncharacterized LOC100381527 isof...    190   2e-52   Zea mays [maize]
ref|XP_008440253.1|  PREDICTED: CDPK-related kinase 5 isoform X2        190   3e-52   Cucumis melo [Oriental melon]
ref|XP_006430539.1|  hypothetical protein CICLE_v10011368mg             189   3e-52   Citrus clementina [clementine]
ref|XP_006293901.1|  hypothetical protein CARUB_v10022894mg             189   3e-52   Capsella rubella
gb|KFK36961.1|  hypothetical protein AALP_AA4G195100                    189   3e-52   Arabis alpina [alpine rockcress]
ref|NP_175381.1|  CDPK-related kinase 8                                 190   3e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79956.1|  BnaA05g02000D                                          189   3e-52   
emb|CDP06189.1|  unnamed protein product                                189   4e-52   Coffea canephora [robusta coffee]
emb|CDY23873.1|  BnaC04g01640D                                          189   4e-52   Brassica napus [oilseed rape]
ref|XP_007028316.1|  CDPK-related kinase 1                              189   5e-52   
ref|XP_006658886.1|  PREDICTED: calcium/calmodulin-dependent seri...    187   5e-52   Oryza brachyantha
ref|XP_011000411.1|  PREDICTED: CDPK-related kinase 7-like              189   5e-52   Populus euphratica
ref|XP_002891522.1|  hypothetical protein ARALYDRAFT_474093             189   6e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_004958484.1|  PREDICTED: calcium/calmodulin-dependent seri...    189   6e-52   Setaria italica
ref|XP_008240668.1|  PREDICTED: CDPK-related kinase 7                   189   7e-52   Prunus mume [ume]
ref|NP_001169442.1|  uncharacterized LOC100383313                       189   7e-52   Zea mays [maize]
ref|XP_003562581.1|  PREDICTED: calcium/calmodulin-dependent seri...    189   7e-52   Brachypodium distachyon [annual false brome]
dbj|BAK00699.1|  predicted protein                                      189   8e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEE59103.1|  hypothetical protein OsJ_10960                          188   1e-51   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC16472.1|  putative calcium/calmodulin-dependent protein ki...    188   1e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EEC82532.1|  hypothetical protein OsI_27055                          188   1e-51   Oryza sativa Indica Group [Indian rice]
gb|KHN42064.1|  CDPK-related protein kinase                             189   1e-51   Glycine soja [wild soybean]
ref|XP_010673049.1|  PREDICTED: CDPK-related kinase 7-like              188   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU20808.1|  hypothetical protein MIMGU_mgv1a003516mg                188   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_010542604.1|  PREDICTED: CDPK-related kinase 1                   187   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_002463267.1|  hypothetical protein SORBIDRAFT_02g040850          187   2e-51   Sorghum bicolor [broomcorn]
gb|KDP27484.1|  hypothetical protein JCGZ_20019                         187   2e-51   Jatropha curcas
ref|XP_009420969.1|  PREDICTED: calcium/calmodulin-dependent seri...    187   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT10573.1|  Calcium/calmodulin-dependent serine/threonine-pro...    187   2e-51   
ref|XP_010525467.1|  PREDICTED: CDPK-related kinase 1-like              187   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_002522159.1|  calcium-dependent protein kinase, putative         186   3e-51   
ref|XP_009371242.1|  PREDICTED: CDPK-related kinase 7-like              187   3e-51   Pyrus x bretschneideri [bai li]
ref|NP_191235.1|  CDPK-related kinase 7                                 187   3e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008798377.1|  PREDICTED: calcium/calmodulin-dependent seri...    187   3e-51   Phoenix dactylifera
ref|XP_008777902.1|  PREDICTED: calcium/calmodulin-dependent seri...    187   3e-51   Phoenix dactylifera
gb|EEC75325.1|  hypothetical protein OsI_11701                          187   3e-51   Oryza sativa Indica Group [Indian rice]
ref|NP_001050179.1|  Os03g0366200                                       187   4e-51   
ref|XP_010517599.1|  PREDICTED: CDPK-related kinase 1 isoform X1        186   4e-51   
sp|Q10KY3.1|CAMK1_ORYSJ  RecName: Full=Calcium/calmodulin-depende...    187   4e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139075.1|  PREDICTED: CDPK-related kinase 7-like              186   4e-51   Brassica rapa
ref|XP_003554117.2|  PREDICTED: CDPK-related kinase 1                   184   5e-51   
ref|XP_006402951.1|  hypothetical protein EUTSA_v10005861mg             186   5e-51   Eutrema salsugineum [saltwater cress]
ref|XP_010508754.1|  PREDICTED: CDPK-related kinase 1-like              186   6e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003624963.1|  Calcium-dependent protein kinase-like protein      186   7e-51   Medicago truncatula
ref|XP_002878106.1|  hypothetical protein ARALYDRAFT_486115             186   9e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_002862200.1|  hypothetical protein ARALYDRAFT_921091             182   1e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010907987.1|  PREDICTED: calcium/calmodulin-dependent seri...    185   1e-50   Elaeis guineensis
ref|XP_004493390.1|  PREDICTED: CDPK-related kinase 7-like              186   1e-50   Cicer arietinum [garbanzo]
ref|XP_006299075.1|  hypothetical protein CARUB_v10015215mg             186   1e-50   Capsella rubella
ref|XP_010909915.1|  PREDICTED: CDPK-related kinase 7-like isofor...    185   1e-50   Elaeis guineensis
ref|XP_008440252.1|  PREDICTED: CDPK-related kinase 5 isoform X1        186   1e-50   Cucumis melo [Oriental melon]
ref|XP_009393900.1|  PREDICTED: calcium/calmodulin-dependent seri...    185   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010909914.1|  PREDICTED: CDPK-related kinase 7-like isofor...    185   2e-50   Elaeis guineensis
ref|XP_010466044.1|  PREDICTED: CDPK-related kinase 2-like              185   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010427515.1|  PREDICTED: CDPK-related kinase 7-like isofor...    185   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006290768.1|  hypothetical protein CARUB_v10016875mg             184   2e-50   
ref|XP_010507434.1|  PREDICTED: CDPK-related kinase 2                   185   2e-50   Camelina sativa [gold-of-pleasure]
gb|KFK35999.1|  hypothetical protein AALP_AA4G064700                    185   2e-50   Arabis alpina [alpine rockcress]
ref|XP_002322616.1|  CDPK-related kinase 1 family protein               184   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_010516279.1|  PREDICTED: CDPK-related kinase 7                   184   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010427514.1|  PREDICTED: CDPK-related kinase 7-like isofor...    184   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010504583.1|  PREDICTED: CDPK-related kinase 7-like              184   3e-50   Camelina sativa [gold-of-pleasure]
gb|AAK54157.1|AF368282_1  CaMK1                                         184   4e-50   Oryza sativa [red rice]
ref|XP_011075448.1|  PREDICTED: CDPK-related kinase 1                   184   4e-50   Sesamum indicum [beniseed]
gb|KJB35809.1|  hypothetical protein B456_006G129900                    183   5e-50   Gossypium raimondii
ref|XP_007163947.1|  hypothetical protein PHAVU_L003400g                183   6e-50   Phaseolus vulgaris [French bean]
ref|XP_008464947.1|  PREDICTED: CDPK-related kinase 1-like isofor...    181   8e-50   
ref|XP_009405856.1|  PREDICTED: calcium/calmodulin-dependent seri...    182   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002883163.1|  hypothetical protein ARALYDRAFT_898284             182   1e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_009112142.1|  PREDICTED: CDPK-related kinase 2                   182   2e-49   Brassica rapa
emb|CDY18568.1|  BnaA01g26270D                                          182   2e-49   Brassica napus [oilseed rape]
ref|XP_003535908.1|  PREDICTED: CDPK-related kinase 1-like              182   2e-49   Glycine max [soybeans]
ref|XP_007145486.1|  hypothetical protein PHAVU_007G243100g             182   2e-49   Phaseolus vulgaris [French bean]
ref|XP_010479393.1|  PREDICTED: CDPK-related kinase 8-like              182   2e-49   Camelina sativa [gold-of-pleasure]
emb|CDX95464.1|  BnaC01g33560D                                          182   2e-49   
ref|XP_010922072.1|  PREDICTED: calcium/calmodulin-dependent seri...    181   2e-49   Elaeis guineensis
ref|XP_010487837.1|  PREDICTED: CDPK-related kinase 2                   182   3e-49   
emb|CDX92303.1|  BnaA05g21040D                                          181   3e-49   
emb|CDX99267.1|  BnaC05g33820D                                          181   3e-49   
ref|XP_008464946.1|  PREDICTED: CDPK-related kinase 1-like isofor...    181   3e-49   Cucumis melo [Oriental melon]
gb|KHG24093.1|  Calcium/calmodulin-dependent serine/threonine-pro...    181   3e-49   Gossypium arboreum [tree cotton]
ref|XP_006651413.1|  PREDICTED: calcium/calmodulin-dependent seri...    180   4e-49   
ref|XP_009145826.1|  PREDICTED: CDPK-related kinase 2-like              182   4e-49   Brassica rapa
ref|XP_008464945.1|  PREDICTED: CDPK-related kinase 7-like isofor...    181   4e-49   Cucumis melo [Oriental melon]
ref|XP_009107288.1|  PREDICTED: CDPK-related kinase 8 isoform X1        181   5e-49   Brassica rapa
gb|KFK34914.1|  hypothetical protein AALP_AA5G210000                    181   5e-49   Arabis alpina [alpine rockcress]
ref|XP_009107289.1|  PREDICTED: CDPK-related kinase 8 isoform X2        181   5e-49   Brassica rapa
ref|NP_188541.1|  CDPK-related kinase 2                                 181   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAD38059.1|AF153352_1  CDPK-related kinase 2                         181   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406536.1|  hypothetical protein EUTSA_v10020326mg             181   7e-49   Eutrema salsugineum [saltwater cress]
ref|XP_010500502.1|  PREDICTED: CDPK-related kinase 8-like              181   8e-49   Camelina sativa [gold-of-pleasure]
ref|XP_003518984.1|  PREDICTED: CDPK-related kinase 7-like isofor...    180   8e-49   Glycine max [soybeans]
ref|XP_003557839.1|  PREDICTED: calcium/calmodulin-dependent seri...    180   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_006303933.1|  hypothetical protein CARUB_v10008616mg             180   1e-48   Capsella rubella
ref|XP_010228587.1|  PREDICTED: calcium/calmodulin-dependent seri...    180   1e-48   
ref|XP_010461799.1|  PREDICTED: CDPK-related kinase 8                   180   1e-48   Camelina sativa [gold-of-pleasure]
gb|KFK39251.1|  hypothetical protein AALP_AA3G220000                    179   2e-48   Arabis alpina [alpine rockcress]
ref|XP_009404698.1|  PREDICTED: calcium/calmodulin-dependent seri...    179   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008377637.1|  PREDICTED: CDPK-related kinase 7-like isofor...    179   2e-48   
ref|XP_008377644.1|  PREDICTED: CDPK-related kinase 7-like isofor...    179   2e-48   
emb|CDY16510.1|  BnaA08g02570D                                          179   3e-48   
emb|CDX77233.1|  BnaC08g02780D                                          179   3e-48   
ref|NP_001146101.1|  uncharacterized LOC100279633                       178   6e-48   
ref|XP_008658484.1|  PREDICTED: uncharacterized LOC100279633 isof...    178   6e-48   
ref|XP_010271816.1|  PREDICTED: CDPK-related kinase 7-like              177   6e-48   
ref|XP_004141122.1|  PREDICTED: calcium/calmodulin-dependent seri...    177   2e-47   
ref|XP_009135614.1|  PREDICTED: CDPK-related kinase 2-like isofor...    176   2e-47   
ref|XP_002282577.1|  PREDICTED: CDPK-related kinase 1                   175   5e-47   
emb|CBI32784.3|  unnamed protein product                                175   5e-47   
ref|XP_004984283.1|  PREDICTED: calcium/calmodulin-dependent seri...    174   9e-47   
ref|XP_002467812.1|  hypothetical protein SORBIDRAFT_01g034520          174   1e-46   
ref|XP_010246175.1|  PREDICTED: CDPK-related kinase 1-like              174   2e-46   
emb|CDX82311.1|  BnaA03g35100D                                          172   6e-46   
emb|CDY22990.1|  BnaC03g40790D                                          172   6e-46   
ref|XP_006290769.1|  hypothetical protein CARUB_v10016875mg             171   2e-45   
ref|XP_001768867.1|  predicted protein                                  168   2e-45   
ref|XP_008667154.1|  PREDICTED: uncharacterized LOC100272934 isof...    170   5e-45   
ref|NP_001140858.1|  uncharacterized LOC100272934                       170   5e-45   
ref|XP_002960835.1|  CPK related protein kinase 5                       169   9e-45   
ref|XP_002983837.1|  CPK-related protein kinase 3                       169   9e-45   
ref|XP_008455724.1|  PREDICTED: CDPK-related kinase 1 isoform X2        164   3e-44   
ref|XP_011088749.1|  PREDICTED: CDPK-related protein kinase-like        166   7e-44   
gb|EPS59727.1|  hypothetical protein M569_15078                         165   3e-43   
ref|XP_008455723.1|  PREDICTED: CDPK-related kinase 1 isoform X1        164   4e-43   
ref|XP_010907988.1|  PREDICTED: calcium/calmodulin-dependent seri...    163   1e-42   
ref|XP_001751663.1|  predicted protein                                  163   1e-42   
gb|EYU37708.1|  hypothetical protein MIMGU_mgv1a005157mg                162   2e-42   
gb|EMS61574.1|  Calcium/calmodulin-dependent serine/threonine-pro...    165   2e-42   
gb|KCW47909.1|  hypothetical protein EUGRSUZ_K01647                     159   9e-42   
ref|XP_001763397.1|  predicted protein                                  160   1e-41   
ref|XP_001751664.1|  predicted protein                                  158   5e-41   
ref|XP_010036359.1|  PREDICTED: CDPK-related kinase 1-like              158   9e-41   
ref|XP_004144329.1|  PREDICTED: CDPK-related protein kinase-like        157   2e-40   
ref|XP_002266654.1|  PREDICTED: CDPK-related kinase 3 isoform X1        155   1e-39   
gb|ABK25039.1|  unknown                                                 154   2e-39   
dbj|BAD94474.1|  calcium dependent protein kinase CP4                   144   2e-39   
ref|XP_001773184.1|  crk2 CDPK-related kinase                           154   3e-39   
ref|XP_006846568.1|  hypothetical protein AMTR_s00018p00240170          153   4e-39   
ref|XP_010251747.1|  PREDICTED: CDPK-related kinase 3-like              152   1e-38   
ref|XP_002973513.1|  CDK related protein kinase 5                       152   1e-38   
ref|XP_002975545.1|  CDPK-related protein kinase 3                      152   1e-38   
ref|XP_008364833.1|  PREDICTED: CDPK-related kinase 3-like              149   1e-38   
ref|XP_008233079.1|  PREDICTED: CDPK-related kinase 3 isoform X2        149   2e-38   
ref|XP_008376189.1|  PREDICTED: CDPK-related kinase 3                   150   6e-38   
ref|XP_008233078.1|  PREDICTED: CDPK-related kinase 3 isoform X1        150   7e-38   
ref|XP_009366623.1|  PREDICTED: CDPK-related kinase 3-like              149   1e-37   
ref|XP_007218866.1|  hypothetical protein PRUPE_ppa003103mg             149   1e-37   
ref|XP_011084555.1|  PREDICTED: CDPK-related kinase 6-like              149   2e-37   
ref|XP_004166903.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    148   3e-37   
gb|ADN34224.1|  calcium-dependent protein kinase                        144   3e-37   
ref|XP_004140506.1|  PREDICTED: CDPK-related protein kinase-like        148   3e-37   
ref|XP_010523557.1|  PREDICTED: CDPK-related kinase 4                   148   3e-37   
ref|XP_006657343.1|  PREDICTED: CDPK-related kinase 3-like              147   3e-37   
ref|XP_004494853.1|  PREDICTED: CDPK-related kinase 3-like              147   3e-37   
gb|EPS62160.1|  hypothetical protein M569_12634                         138   4e-37   
dbj|BAD54109.1|  putative calcium/calmodulin-dependent protein ki...    147   5e-37   
gb|KHN06347.1|  CDPK-related protein kinase                             145   7e-37   
ref|XP_009389129.1|  PREDICTED: CDPK-related kinase 3-like              146   1e-36   
gb|AFK35666.1|  unknown                                                 144   1e-36   
dbj|BAJ96597.1|  predicted protein                                      146   1e-36   
ref|XP_010691967.1|  PREDICTED: CDPK-related kinase 3 isoform X2        145   2e-36   
gb|ACF81864.1|  unknown                                                 143   2e-36   
ref|XP_003528772.1|  PREDICTED: CDPK-related kinase 3-like              145   2e-36   
ref|XP_003563563.1|  PREDICTED: CDPK-related kinase 3-like              145   2e-36   
ref|XP_007135298.1|  hypothetical protein PHAVU_010G117600g             145   2e-36   
ref|XP_004966436.1|  PREDICTED: CDPK-related kinase 3-like              145   2e-36   
ref|XP_003626588.1|  Calcium dependent protein kinase-like protein      145   2e-36   
ref|XP_010691907.1|  PREDICTED: CDPK-related kinase 3 isoform X1        145   2e-36   
ref|XP_009150150.1|  PREDICTED: CDPK-related kinase 6                   145   2e-36   
ref|XP_002874198.1|  hypothetical protein ARALYDRAFT_910482             145   3e-36   
gb|AAM91611.1|  calcium dependent protein kinase-like protein           144   3e-36   
ref|XP_010454753.1|  PREDICTED: LOW QUALITY PROTEIN: CDPK-related...    145   3e-36   
ref|XP_008459759.1|  PREDICTED: CDPK-related kinase 3 isoform X2        143   4e-36   
emb|CDY00200.1|  BnaA06g21010D                                          145   4e-36   
ref|XP_011468906.1|  PREDICTED: CDPK-related kinase 3 isoform X2        142   4e-36   
gb|EYU19682.1|  hypothetical protein MIMGU_mgv1a003314mg                144   5e-36   
emb|CDY05930.1|  BnaC08g21070D                                          144   5e-36   
ref|XP_009375450.1|  PREDICTED: CDPK-related kinase 3 isoform X2        142   5e-36   
dbj|BAA12691.1|  CDPK-related protein kinase                            144   5e-36   
emb|CDX86978.1|  BnaC03g52480D                                          145   5e-36   
dbj|BAA22410.1|  calcium-dependent protein kinase-related kinase        143   5e-36   
ref|XP_010421271.1|  PREDICTED: CDPK-related kinase 4                   144   5e-36   
ref|XP_008459758.1|  PREDICTED: CDPK-related kinase 3 isoform X1        144   5e-36   
emb|CDY08129.1|  BnaA06g15970D                                          144   6e-36   
ref|XP_010515290.1|  PREDICTED: CDPK-related kinase 6-like isofor...    142   7e-36   
ref|NP_001105740.1|  calcium dependent protein kinase1                  144   7e-36   
gb|AFW69483.1|  putative protein kinase superfamily protein             144   7e-36   
ref|XP_010503590.1|  PREDICTED: CDPK-related kinase 6 isoform X3        142   8e-36   
ref|XP_010100681.1|  CDPK-related protein kinase                        144   8e-36   
gb|ACG29980.1|  CDPK-related protein kinase                             144   8e-36   
ref|XP_006444766.1|  hypothetical protein CICLE_v10019386mg             144   8e-36   
ref|XP_008354047.1|  PREDICTED: CDPK-related kinase 3-like              142   9e-36   
ref|XP_002437591.1|  hypothetical protein SORBIDRAFT_10g030040          143   9e-36   
gb|AAD28759.1|AF130252_1  calcium dependent protein kinase CP4          143   9e-36   
ref|XP_010493602.1|  PREDICTED: CDPK-related kinase 4-like              143   1e-35   
ref|NP_197831.3|  CDPK-related kinase 4 (AtCRK4)                        143   1e-35   
ref|XP_008669940.1|  PREDICTED: calcium/calmodulin-dependent seri...    135   1e-35   
gb|KFK27721.1|  hypothetical protein AALP_AA8G420900                    143   1e-35   
ref|XP_004308284.1|  PREDICTED: CDPK-related kinase 3 isoform X1        143   2e-35   
ref|XP_009588677.1|  PREDICTED: CDPK-related kinase 3                   143   2e-35   
ref|XP_009796477.1|  PREDICTED: CDPK-related kinase 3                   143   2e-35   
ref|XP_009375449.1|  PREDICTED: CDPK-related kinase 3 isoform X1        143   2e-35   
ref|XP_010426446.1|  PREDICTED: CDPK-related kinase 6-like              143   2e-35   
gb|KHG10876.1|  CDPK-related protein kinase                             143   2e-35   
emb|CDX87128.1|  BnaC09g04430D                                          142   2e-35   
gb|KJB23990.1|  hypothetical protein B456_004G123900                    142   2e-35   
ref|XP_006290782.1|  hypothetical protein CARUB_v10016886mg             142   2e-35   
ref|XP_010515289.1|  PREDICTED: CDPK-related kinase 6-like isofor...    142   3e-35   
ref|XP_010933746.1|  PREDICTED: CDPK-related kinase 3-like isofor...    142   3e-35   
ref|XP_009149741.1|  PREDICTED: CDPK-related kinase 6                   142   3e-35   
emb|CDY19836.1|  BnaA09g04890D                                          142   4e-35   
ref|XP_010503589.1|  PREDICTED: CDPK-related kinase 6 isoform X2        142   4e-35   
gb|KDP21986.1|  hypothetical protein JCGZ_03151                         142   4e-35   
ref|XP_009111629.1|  PREDICTED: CDPK-related kinase 4                   142   4e-35   
ref|XP_002515635.1|  calcium-dependent protein kinase, putative         142   4e-35   
ref|XP_010933744.1|  PREDICTED: CDPK-related kinase 3-like isofor...    142   4e-35   
ref|XP_010515287.1|  PREDICTED: CDPK-related kinase 6-like isofor...    142   5e-35   
ref|XP_010503588.1|  PREDICTED: CDPK-related kinase 6 isoform X1        142   6e-35   
emb|CDX88104.1|  BnaA06g26950D                                          141   7e-35   
ref|XP_002529963.1|  calcium-dependent protein kinase, putative         141   8e-35   
ref|XP_010267444.1|  PREDICTED: CDPK-related kinase 3 isoform X2        140   8e-35   
ref|XP_010267443.1|  PREDICTED: CDPK-related kinase 3 isoform X1        140   9e-35   
gb|AFW82166.1|  hypothetical protein ZEAMMB73_583819                    131   9e-35   
gb|KFK27643.1|  hypothetical protein AALP_AA8G409900                    140   9e-35   
emb|CDX80445.1|  BnaC07g29990D                                          140   1e-34   
ref|XP_006394699.1|  hypothetical protein EUTSA_v10003876mg             140   1e-34   
ref|XP_002302662.1|  calcium-dependent protein kinase                   140   1e-34   
ref|XP_011023119.1|  PREDICTED: CDPK-related kinase 3 isoform X4        138   1e-34   
ref|XP_006286478.1|  hypothetical protein CARUB_v10000513mg             140   2e-34   
gb|ACF84338.1|  unknown                                                 140   2e-34   
gb|AAG01179.1|AF289237_1  calcium/calmodulin dependent protein ki...    140   2e-34   
ref|XP_006404152.1|  hypothetical protein EUTSA_v10010221mg             140   2e-34   
ref|NP_001105305.1|  LOC542225                                          140   2e-34   
ref|XP_008796870.1|  PREDICTED: CDPK-related kinase 3-like              140   2e-34   
ref|XP_004309103.1|  PREDICTED: CDPK-related kinase 4-like              139   2e-34   
ref|XP_011023117.1|  PREDICTED: CDPK-related kinase 3 isoform X2        139   2e-34   
ref|NP_001234146.1|  serine/threonine protein kinase pk23               139   3e-34   
ref|XP_010906430.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   3e-34   
ref|XP_011023118.1|  PREDICTED: CDPK-related kinase 3 isoform X3        138   3e-34   
ref|XP_007218875.1|  hypothetical protein PRUPE_ppa003281mg             139   3e-34   
ref|XP_011023116.1|  PREDICTED: CDPK-related kinase 3 isoform X1        139   3e-34   
gb|KDP28435.1|  hypothetical protein JCGZ_14206                         139   3e-34   
ref|XP_002877670.1|  hypothetical protein ARALYDRAFT_485296             139   3e-34   
ref|XP_002308892.2|  CDPK-related kinase 1 family protein               139   4e-34   
emb|CDP08633.1|  unnamed protein product                                139   4e-34   
ref|NP_190506.1|  CDPK-related kinase 6                                 139   4e-34   
ref|XP_002464385.1|  hypothetical protein SORBIDRAFT_01g017320          138   4e-34   
ref|XP_011027260.1|  PREDICTED: CDPK-related kinase 1-like isofor...    137   4e-34   
ref|XP_009150973.1|  PREDICTED: CDPK-related kinase 4-like              139   5e-34   
ref|XP_004230019.1|  PREDICTED: CDPK-related kinase 3                   139   5e-34   
gb|KHG10111.1|  CDPK-related protein kinase                             138   6e-34   
ref|XP_008234671.1|  PREDICTED: CDPK-related kinase 4-like              138   6e-34   
ref|XP_011027259.1|  PREDICTED: CDPK-related kinase 7-like isofor...    138   6e-34   
ref|XP_010906427.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   6e-34   
ref|XP_006347491.1|  PREDICTED: CDPK-related kinase 4-like              138   7e-34   
ref|XP_010906426.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   7e-34   
ref|XP_010906425.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   7e-34   
gb|KJB48531.1|  hypothetical protein B456_008G074300                    138   7e-34   
ref|XP_010906424.1|  PREDICTED: CDPK-related kinase 3-like isofor...    138   8e-34   
ref|XP_007136495.1|  hypothetical protein PHAVU_009G050100g             138   8e-34   
gb|AAC24961.1|  CDPK-related protein kinase                             137   1e-33   
ref|NP_001154582.1|  CDPK-related kinase 3                              135   2e-33   
ref|XP_008776464.1|  PREDICTED: CDPK-related kinase 3-like isofor...    137   2e-33   
ref|XP_007051459.1|  CDPK-related kinase 3 isoform 1                    137   2e-33   
ref|XP_002317812.1|  calcium-dependent protein kinase                   136   2e-33   
ref|XP_011038973.1|  PREDICTED: CDPK-related kinase 3-like              137   2e-33   
ref|XP_010523832.1|  PREDICTED: CDPK-related kinase 3 isoform X2        135   2e-33   
ref|XP_010112837.1|  Calcium/calmodulin-dependent serine/threonin...    137   3e-33   
gb|AAL58909.1|AF462819_1  At2g46700/T3A4.8                              136   3e-33   
ref|XP_006661945.1|  PREDICTED: CDPK-related kinase 3-like              135   3e-33   
ref|NP_182193.1|  CDPK-related kinase 3                                 136   4e-33   
gb|AAL30817.1|AF435449_1  calcium/calmodulin-dependent protein ki...    136   4e-33   
ref|XP_002320890.1|  calcium-dependent protein kinase                   136   4e-33   
gb|KJB09598.1|  hypothetical protein B456_001G152000                    136   4e-33   
gb|KJB09604.1|  hypothetical protein B456_001G152000                    135   4e-33   
gb|KHG14961.1|  CDPK-related protein kinase                             136   5e-33   
ref|XP_010662917.1|  PREDICTED: CDPK-related kinase 3 isoform X2        134   5e-33   
ref|XP_008791676.1|  PREDICTED: CDPK-related kinase 3-like isofor...    134   5e-33   
ref|XP_003602328.1|  Calcium dependent protein kinase-like protein      135   6e-33   
gb|EEE66354.1|  hypothetical protein OsJ_22648                          136   7e-33   
ref|XP_010523831.1|  PREDICTED: CDPK-related kinase 3 isoform X1        135   7e-33   
ref|XP_004982632.1|  PREDICTED: CDPK-related kinase 3-like              136   7e-33   
ref|XP_011094288.1|  PREDICTED: CDPK-related kinase 3                   135   7e-33   
ref|XP_002273024.1|  PREDICTED: CDPK-related kinase 3 isoform X1        135   8e-33   
ref|XP_009624842.1|  PREDICTED: CDPK-related kinase 4-like isofor...    134   8e-33   
emb|CAN64098.1|  hypothetical protein VITISV_014897                     135   9e-33   
gb|AAK84452.1|AC087192_13  putative kinase                              135   1e-32   
emb|CBI23068.3|  unnamed protein product                                134   1e-32   
ref|XP_010054975.1|  PREDICTED: CDPK-related kinase 3                   135   1e-32   
ref|XP_008791674.1|  PREDICTED: CDPK-related kinase 3-like isofor...    134   1e-32   
ref|XP_009418319.1|  PREDICTED: CDPK-related kinase 3-like              135   1e-32   
ref|XP_008791673.1|  PREDICTED: CDPK-related kinase 3-like isofor...    134   2e-32   
ref|XP_010661483.1|  PREDICTED: CDPK-related kinase 3 isoform X2        134   2e-32   
ref|XP_007039175.1|  Calcium-dependent protein kinase (CDPK) fami...    134   2e-32   
ref|XP_004502721.1|  PREDICTED: CDPK-related kinase 4-like              134   2e-32   
ref|XP_009624841.1|  PREDICTED: CDPK-related kinase 4-like isofor...    134   2e-32   
gb|AAL30818.1|AF435450_1  calcium/calmodulin-dependent protein ki...    134   3e-32   
gb|KJB41588.1|  hypothetical protein B456_007G111600                    134   4e-32   
ref|XP_009768687.1|  PREDICTED: CDPK-related kinase 4-like isofor...    132   4e-32   
ref|XP_006339759.1|  PREDICTED: CDPK-related kinase 3-like isofor...    133   4e-32   
ref|XP_008776463.1|  PREDICTED: CDPK-related kinase 3-like isofor...    133   4e-32   
gb|KHN19539.1|  CDPK-related protein kinase                             132   5e-32   
ref|XP_008376799.1|  PREDICTED: CDPK-related kinase 4-like              133   5e-32   
ref|XP_009142438.1|  PREDICTED: CDPK-related kinase 3                   133   6e-32   
gb|KHN35705.1|  CDPK-related protein kinase                             127   7e-32   
ref|XP_002882085.1|  hypothetical protein ARALYDRAFT_483834             132   7e-32   
ref|XP_010518347.1|  PREDICTED: CDPK-related kinase 3                   132   8e-32   
ref|XP_010507983.1|  PREDICTED: CDPK-related kinase 3-like              132   8e-32   
emb|CDY27530.1|  BnaC04g51710D                                          132   8e-32   
ref|XP_009768686.1|  PREDICTED: CDPK-related kinase 4-like isofor...    132   9e-32   
emb|CDY48019.1|  BnaA04g26710D                                          132   1e-31   
ref|XP_009361299.1|  PREDICTED: CDPK-related kinase 4-like              132   1e-31   
ref|XP_003522533.1|  PREDICTED: CDPK-related kinase 4-like              132   1e-31   
ref|XP_008664763.1|  PREDICTED: CDPK-related kinase 3-like              132   1e-31   
ref|XP_003526744.1|  PREDICTED: CDPK-related kinase 6-like              132   1e-31   
ref|XP_006293857.1|  hypothetical protein CARUB_v10022864mg             132   2e-31   
ref|XP_008644706.1|  PREDICTED: CDPK-related kinase 3-like              131   2e-31   
ref|XP_010506686.1|  PREDICTED: CDPK-related kinase 3-like              131   2e-31   
emb|CDP05005.1|  unnamed protein product                                131   3e-31   
ref|XP_006397861.1|  hypothetical protein EUTSA_v10001366mg             131   3e-31   



>ref|XP_008361395.1| PREDICTED: CDPK-related protein kinase-like [Malus domestica]
Length=175

 Score =   229 bits (585),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQHARCAYEIFE
Sbjct  56   KNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQHARCAYEIFE  115

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR   K Q
Sbjct  116  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRAVPKAQ  175



>emb|CBI29399.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQHARCAYE+FE
Sbjct  202  KNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQHARCAYELFE  261

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  AK Q
Sbjct  262  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRALAKAQ  321



>ref|XP_009628482.1| PREDICTED: CDPK-related protein kinase-like [Nicotiana tomentosiformis]
Length=158

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY TDAMKESRI DFLASLNALQYR+MDFEEFCAAA SVHQLEAL+RWEQHARCAYE+FE
Sbjct  39   KYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAASSVHQLEALERWEQHARCAYEVFE  98

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG S+R  AK Q
Sbjct  99   KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSTRGLAKAQ  158



>ref|XP_002522315.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF39999.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=467

 Score =   234 bits (596),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  348  KNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  407

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  408  KDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTLAKTQ  467



>ref|XP_003520170.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+F+
Sbjct  479  KYATDAMKESRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFD  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKVQ
Sbjct  539  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKVQ  598



>ref|XP_003528501.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=598

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+F+
Sbjct  479  KYATDAMKESRILDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFD  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKVQ
Sbjct  539  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKVQ  598



>ref|XP_007156536.1| hypothetical protein PHAVU_003G294300g [Phaseolus vulgaris]
 gb|ESW28530.1| hypothetical protein PHAVU_003G294300g [Phaseolus vulgaris]
Length=599

 Score =   234 bits (597),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKESRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+F+
Sbjct  480  KYATDAMKESRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFD  539

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKVQ
Sbjct  540  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKVQ  599



>ref|XP_004233433.1| PREDICTED: CDPK-related kinase 5-like [Solanum lycopersicum]
Length=591

 Score =   234 bits (596),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKE+RIHDF+ASLNALQYRRMDFEEFCAAALSV+QLEALD+WEQHARCAYEIFE
Sbjct  472  KYATDAMKEARIHDFVASLNALQYRRMDFEEFCAAALSVYQLEALDQWEQHARCAYEIFE  531

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVL DWIRHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  532  KDGNRAIVIEELASELGLGPSVPVHAVLLDWIRHTDGKLSFLGFAKLLHGVSSRSITKVQ  591



>ref|XP_006360222.1| PREDICTED: CDPK-related protein kinase-like [Solanum tuberosum]
Length=590

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKE+RIHDF+ASLNALQYRRMDFEEFCAAALSV+QLEALD+WEQHARCAYEIFE
Sbjct  471  KYATDAMKEARIHDFIASLNALQYRRMDFEEFCAAALSVYQLEALDQWEQHARCAYEIFE  530

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVL DWIRHTDGKLSFLGFAKLLHGVSSR+  K+Q
Sbjct  531  KDGNRAIVIEELASELGLGPSVPVHAVLLDWIRHTDGKLSFLGFAKLLHGVSSRSITKIQ  590



>ref|XP_004232048.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=607

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKE+RIHDFLASLNALQYRRMDFEEFCAAALSVHQLEA DRWEQHARCAYEIFE
Sbjct  488  KHATDAMKEARIHDFLASLNALQYRRMDFEEFCAAALSVHQLEAFDRWEQHARCAYEIFE  547

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGVSSR+ AKVQ
Sbjct  548  KEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGVSSRSIAKVQ  607



>emb|CAN74933.1| hypothetical protein VITISV_044433 [Vitis vinifera]
Length=606

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQHARCAYE+FE
Sbjct  487  KNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQHARCAYELFE  546

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  AK Q
Sbjct  547  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRALAKAQ  606



>ref|XP_002262855.3| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
Length=602

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+HD LASLNALQYRRMDFEEFCAA LSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KNATDAMKESRVHDLLASLNALQYRRMDFEEFCAATLSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  AK Q
Sbjct  543  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRALAKAQ  602



>ref|XP_009611550.1| PREDICTED: CDPK-related kinase 5 [Nicotiana tomentosiformis]
Length=602

 Score =   233 bits (595),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE
Sbjct  483  KHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  543  KEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGVSSRSITKVQ  602



>ref|XP_004505191.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Cicer arietinum]
Length=597

 Score =   233 bits (594),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  477  KYATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  536

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  537  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFAKLLHGVSSRSLTKVQ  596



>ref|XP_009758726.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009758727.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nicotiana sylvestris]
Length=602

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE
Sbjct  483  KHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  543  KEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGVSSRSITKVQ  602



>ref|XP_006338215.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=610

 Score =   233 bits (594),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKE+RIHDFLASLNALQYRRMDFEEFCAAALSVHQLEA DRWEQHARCAYEIFE
Sbjct  491  KHATDAMKEARIHDFLASLNALQYRRMDFEEFCAAALSVHQLEAFDRWEQHARCAYEIFE  550

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  551  KEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGVSSRSITKVQ  610



>gb|AAL30820.1|AF435452_1 calcium/calmodulin-dependent protein kinase CaMK3 [Nicotiana 
tabacum]
Length=602

 Score =   233 bits (593),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKE+R+HDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE
Sbjct  483  KHATDAMKEARMHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAI+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  543  KEGNRAIMIEELASELGLSPSVPVHAVLHDWLRHTDGKLSFLGFAKLLHGVSSRSITKVQ  602



>ref|XP_004505190.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Cicer arietinum]
Length=629

 Score =   233 bits (594),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  509  KYATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  568

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGFAKLLHGVSSR+  KVQ
Sbjct  569  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFAKLLHGVSSRSLTKVQ  628



>ref|XP_002281956.2| PREDICTED: CDPK-related kinase 5 [Vitis vinifera]
 emb|CBI32452.3| unnamed protein product [Vitis vinifera]
Length=584

 Score =   231 bits (589),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+F+
Sbjct  465  KNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFD  524

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK Q
Sbjct  525  KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRALAKAQ  584



>emb|CAN82235.1| hypothetical protein VITISV_007568 [Vitis vinifera]
Length=584

 Score =   231 bits (589),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+F+
Sbjct  465  KNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFD  524

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK Q
Sbjct  525  KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRALAKAQ  584



>gb|EYU39406.1| hypothetical protein MIMGU_mgv1a0043831mg, partial [Erythranthe 
guttata]
Length=159

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY+TDAM ESRI DF+ASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQHARCAYE+F+
Sbjct  40   KYATDAMNESRIFDFIASLNALQYRRMDFEEFCAAASSVYQLEALDRWEQHARCAYELFD  99

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+SSR  AK
Sbjct  100  KEGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGISSRALAK  157



>ref|XP_006346445.1| PREDICTED: CDPK-related kinase 5-like [Solanum tuberosum]
Length=588

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY TDAMKESRI DFLASLNALQYR+MDFEEFCAAALSVHQLEAL+RWEQHARCAYEIF+
Sbjct  469  KYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAALSVHQLEALERWEQHARCAYEIFD  528

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLLHG S+R  AKVQ
Sbjct  529  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLHGPSTRGLAKVQ  588



>emb|CDP02477.1| unnamed protein product [Coffea canephora]
Length=602

 Score =   230 bits (586),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AMKESRIHDFL SLNALQYRRMDFEEFCAA LSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KNATEAMKESRIHDFLGSLNALQYRRMDFEEFCAAVLSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+  KVQ
Sbjct  543  KDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLPKVQ  602



>ref|XP_003608023.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
 gb|AES90220.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=592

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKESRI DFL+SL++LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  472  KHATDAMKESRITDFLSSLSSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  531

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+H VLHDWIRHTDGKLSFLGF KLLHGVSSR+  KVQ
Sbjct  532  KDGNRAIVIEELASELGLGPSIPVHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLPKVQ  591



>ref|XP_006425849.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
 ref|XP_006466639.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
 gb|ESR39089.1| hypothetical protein CICLE_v10025192mg [Citrus clementina]
Length=611

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  492  KNATDAMKDSRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  551

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK Q
Sbjct  552  KDGNRAIVIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRALAKAQ  611



>ref|XP_008338287.1| PREDICTED: CDPK-related kinase 5 [Malus domestica]
Length=602

 Score =   229 bits (585),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQHARCAYEIFE
Sbjct  483  KNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQHARCAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR   K Q
Sbjct  543  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRAVPKAQ  602



>gb|KDO79300.1| hypothetical protein CISIN_1g007253mg [Citrus sinensis]
Length=611

 Score =   230 bits (586),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI DFL+SLN+LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  492  KNATDAMKDSRIPDFLSSLNSLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  551

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK Q
Sbjct  552  KDGNRAIVIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRALAKAQ  611



>ref|XP_007204593.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
 gb|EMJ05792.1| hypothetical protein PRUPE_ppa003111mg [Prunus persica]
Length=602

 Score =   229 bits (585),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFC A+LSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KNATDAMKEARIADFLASLNALQYRRMDFEEFCTASLSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT  K Q
Sbjct  543  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTVPKAQ  602



>ref|XP_008241522.1| PREDICTED: CDPK-related kinase 5 [Prunus mume]
Length=602

 Score =   229 bits (584),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFC A+LSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KNATDAMKEARIADFLASLNALQYRRMDFEEFCTASLSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT  K Q
Sbjct  543  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTVPKAQ  602



>ref|XP_007047191.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX91348.1| CDPK-related kinase [Theobroma cacao]
Length=630

 Score =   229 bits (585),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI +FLASLNALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  511  KNATDAMKESRIPEFLASLNALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  570

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEEL SELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK
Sbjct  571  KDGNRAIVIEELPSELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTLAK  628



>gb|KDP31899.1| hypothetical protein JCGZ_12360 [Jatropha curcas]
Length=630

 Score =   229 bits (584),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQHARCAYE+FE
Sbjct  511  KNATDAMKESRIPDFLASLNALQYRRMDFEEFCAAATSVYQLEALDRWEQHARCAYELFE  570

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT  K Q
Sbjct  571  KDGNRAIMIEELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTIVKAQ  630



>ref|XP_010268715.1| PREDICTED: CDPK-related kinase 5 [Nelumbo nucifera]
Length=609

 Score =   229 bits (583),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR HDFL SL ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  490  KNATDAMKESRAHDFLGSLLALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  549

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  550  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTFAKTQ  609



>ref|XP_009801386.1| PREDICTED: CDPK-related kinase 5-like [Nicotiana sylvestris]
Length=590

 Score =   228 bits (581),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY TDAMKESRI DFLASLNALQYR+MDFEEFCAAA SVHQLEAL+RWEQHARCAYEIFE
Sbjct  471  KYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAASSVHQLEALERWEQHARCAYEIFE  530

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG S+R  AK Q
Sbjct  531  KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSTRGLAKAQ  590



>ref|XP_008236646.1| PREDICTED: CDPK-related kinase 5-like [Prunus mume]
Length=596

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  478  KNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSRT  K
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRTFVK  595



>ref|XP_007199766.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
 gb|EMJ00965.1| hypothetical protein PRUPE_ppa003176mg [Prunus persica]
Length=596

 Score =   228 bits (582),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  478  KNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSRT  K
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRTFVK  595



>ref|XP_004230803.1| PREDICTED: CDPK-related kinase 5 [Solanum lycopersicum]
Length=588

 Score =   228 bits (580),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY TDAMKESRI DFLASLNALQYR+MDFEEFCAAALSVHQLEAL+RWEQHARCAYEIF+
Sbjct  469  KYGTDAMKESRIPDFLASLNALQYRKMDFEEFCAAALSVHQLEALERWEQHARCAYEIFD  528

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLLHG S+R  AK Q
Sbjct  529  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLHGPSTRGLAKAQ  588



>ref|XP_010107975.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXC17375.1| CDPK-related protein kinase [Morus notabilis]
Length=597

 Score =   228 bits (581),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/120 (89%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DF+ASL+ALQYRRMDFEEFCAAAL VHQLEALDRWEQHARCAYE+FE
Sbjct  478  KSATDAMKESRIPDFIASLSALQYRRMDFEEFCAAALGVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSRT  K Q
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRTFVKAQ  597



>ref|XP_011099193.1| PREDICTED: CDPK-related protein kinase isoform X2 [Sesamum indicum]
Length=419

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAM ESR++DFLASLNALQYRRMDFEEFCAAALSV+QLEAL+RWEQHARCAYE+FE
Sbjct  300  KNATDAMNESRVYDFLASLNALQYRRMDFEEFCAAALSVYQLEALERWEQHARCAYELFE  359

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            KDGNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKV
Sbjct  360  KDGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKV  418



>ref|XP_004288057.1| PREDICTED: CDPK-related kinase 5 [Fragaria vesca subsp. vesca]
Length=614

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFC A LSVHQLEALDRWEQHARCAYE+F+
Sbjct  495  KNATDAMKEARIADFLASLNALQYRRMDFEEFCTATLSVHQLEALDRWEQHARCAYELFD  554

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK Q
Sbjct  555  KEGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRVVAKAQ  614



>ref|XP_011039202.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=606

 Score =   228 bits (580),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMKESRI DFLASLNALQYRR+DFEE  AAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  487  KNSTDAMKESRIPDFLASLNALQYRRLDFEECSAAALSVHQLEALDRWEQHARCAYELFE  546

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK Q
Sbjct  547  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGASSRTLAKPQ  606



>ref|XP_002310736.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
 gb|EEE91186.1| hypothetical protein POPTR_0007s11320g [Populus trichocarpa]
Length=606

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMKESRI DFLASLNALQYRRM+FEEF AAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  487  KNSTDAMKESRIPDFLASLNALQYRRMNFEEFSAAALSVHQLEALDRWEQHARCAYELFE  546

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K GNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK Q
Sbjct  547  KAGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGASSRTLAKPQ  606



>ref|XP_010268657.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Nelumbo nucifera]
Length=601

 Score =   227 bits (579),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRIHDFL SL ALQYRRMDFEEFCAAALSV+QLEALD+WEQHARCAYE+FE
Sbjct  482  KNATDAMKESRIHDFLGSLLALQYRRMDFEEFCAAALSVYQLEALDQWEQHARCAYELFE  541

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  542  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTLAKAQ  601



>ref|XP_004290295.1| PREDICTED: CDPK-related kinase 5-like [Fragaria vesca subsp. 
vesca]
Length=600

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D +ASLNALQYRRMDFEEFCAAALSVHQLEALD+WEQHARCAYE+FE
Sbjct  482  KNATDAMKESRIPDLIASLNALQYRRMDFEEFCAAALSVHQLEALDQWEQHARCAYELFE  541

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSRT  K
Sbjct  542  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRTFVK  599



>gb|EYU44373.1| hypothetical protein MIMGU_mgv1a003006mg [Erythranthe guttata]
Length=616

 Score =   226 bits (576),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAM ESRI+DFLASLNALQYRRMDFEEFC A LSV+QLEALDRWEQHARCAYE+FE
Sbjct  497  KNATDAMNESRIYDFLASLNALQYRRMDFEEFCGATLSVYQLEALDRWEQHARCAYELFE  556

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            KDGNR I+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKV
Sbjct  557  KDGNRTIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKV  615



>gb|KJB43647.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=591

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  472  RNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  531

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  532  KDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGVSSRTFAKAQ  591



>gb|KHG22049.1| CDPK-related protein kinase [Gossypium arboreum]
Length=617

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQHARCAYEIFE
Sbjct  498  KNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQHARCAYEIFE  557

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  558  KEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTIAKAQ  617



>gb|AAZ83348.1| CDPK-related protein kinase [Gossypium hirsutum]
Length=617

 Score =   225 bits (574),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 113/120 (94%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQHARCAYEIFE
Sbjct  498  KNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQHARCAYEIFE  557

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  558  KEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTIAKAQ  617



>gb|KJB43646.1| hypothetical protein B456_007G210700 [Gossypium raimondii]
Length=626

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  507  RNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  566

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  567  KDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGVSSRTFAKAQ  626



>gb|KHF98882.1| CDPK-related protein kinase [Gossypium arboreum]
Length=626

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMKESRI +FLASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  507  RNATDAMKESRIPEFLASLSALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  566

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK Q
Sbjct  567  KDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGVSSRTFAKAQ  626



>ref|XP_011099192.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Sesamum indicum]
Length=611

 Score =   224 bits (570),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAM ESR++DFLASLNALQYRRMDFEEFCAAALSV+QLEAL+RWEQHARCAYE+FE
Sbjct  492  KNATDAMNESRVYDFLASLNALQYRRMDFEEFCAAALSVYQLEALERWEQHARCAYELFE  551

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            KDGNR I+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+ AKV
Sbjct  552  KDGNRTIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAKV  610



>gb|KCW63820.1| hypothetical protein EUGRSUZ_G014962, partial [Eucalyptus grandis]
Length=416

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASL+ALQYRRMDFEEFCAAALSVHQLEALD WEQHAR AYE FE
Sbjct  297  KNATDAMKESRIPDFLASLSALQYRRMDFEEFCAAALSVHQLEALDNWEQHARSAYEHFE  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+SSRTA K Q
Sbjct  357  KDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGMSSRTAIKTQ  416



>ref|XP_009366775.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   223 bits (569),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFCAAALSVHQLEA+DRWEQHAR AYEIFE
Sbjct  483  KNATDAMKEARIADFLASLNALQYRRMDFEEFCAAALSVHQLEAVDRWEQHARWAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVS+R   K Q
Sbjct  543  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSNRAVPKAQ  602



>ref|XP_008392297.1| PREDICTED: CDPK-related kinase 5-like [Malus domestica]
Length=596

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  478  KNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSR   K
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRAFVK  595



>ref|XP_009347422.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=596

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  478  KNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSR   K
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRAFVK  595



>ref|XP_009366804.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=602

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/120 (88%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKE+RI DFLASLNALQYRRMDFEEFC AALSVHQLEA+DRWEQHAR AYEIFE
Sbjct  483  KNATDAMKEARIADFLASLNALQYRRMDFEEFCTAALSVHQLEAVDRWEQHARSAYEIFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR   K Q
Sbjct  543  KDGNRAIMIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRAVPKAQ  602



>ref|XP_009358061.1| PREDICTED: CDPK-related kinase 5-like [Pyrus x bretschneideri]
Length=596

 Score =   223 bits (568),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D ++SLNALQYRRMDF+EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  478  KNATDAMKESRIPDLISSLNALQYRRMDFDEFCAAALSVHQLEALDRWEQHARCAYELFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPS+PLH VLHDWIRHTDGKLSFLGF KLLHGVSSR   K
Sbjct  538  KDGNRAIVIEELASELGLGPSIPLHVVLHDWIRHTDGKLSFLGFVKLLHGVSSRAFVK  595



>ref|XP_002306462.1| CROOKED family protein [Populus trichocarpa]
 gb|EEE93458.1| CROOKED family protein [Populus trichocarpa]
Length=607

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  TDAMK+S I DF+ASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ ARCAYE+FE
Sbjct  488  KNGTDAMKDSHIPDFIASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQRARCAYELFE  547

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  548  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFVKLLRGASSRILAKAQ  607



>sp|P53681.1|CRK_DAUCA RecName: Full=CDPK-related protein kinase; AltName: Full=PK421 
[Daucus carota]
 emb|CAA58750.1| CDPK-related protein kinase [Daucus carota]
Length=602

 Score =   222 bits (565),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + STDAMK+SR+ D L SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAY++FE
Sbjct  483  RNSTDAMKDSRVLDLLVSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYDLFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLG+ KLLHGVS+R  AK Q
Sbjct  543  KDGNRAIMIEELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGYVKLLHGVSTRAIAKAQ  602



>ref|XP_004169045.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
Length=121

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQHAR AY++FE
Sbjct  2    KNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQHARYAYDLFE  61

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK
Sbjct  62   KDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSSRTLAK  119



>ref|XP_004159890.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
Length=416

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAM ESR  DFLA+LN LQYR MDF+EFCAAALS+HQLEALDRWEQHARCAYEIFE
Sbjct  297  KHATDAMNESRTLDFLANLNTLQYRGMDFDEFCAAALSIHQLEALDRWEQHARCAYEIFE  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNRAIVIEELASELGLGP++PLH VL DWIRHTDGKLSFLGF KLLHGVSSR+ AKV
Sbjct  357  KNGNRAIVIEELASELGLGPAIPLHVVLQDWIRHTDGKLSFLGFVKLLHGVSSRSLAKV  415



>gb|EPS64045.1| hypothetical protein M569_10738, partial [Genlisea aurea]
Length=124

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+AM ESRI +FL SLN LQYRRMDFEEFCAAA SVHQLEALDRWEQHARC YE FE
Sbjct  7    KNGTEAMNESRIFEFLTSLNTLQYRRMDFEEFCAAASSVHQLEALDRWEQHARCGYEFFE  66

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGLGPSVP+HAV+HDW+RHTDGKLSF GF KLLHGVSS++ AK
Sbjct  67   KEGNRTIMIEELASELGLGPSVPVHAVVHDWVRHTDGKLSFHGFVKLLHGVSSKSTAK  124



>gb|EPS68913.1| hypothetical protein M569_05857, partial [Genlisea aurea]
Length=293

 Score =   213 bits (542),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAM ESRI DFL S++ LQYRRMDFEEFCAAALSV+QLE+LDRWEQHARCAYEIFE
Sbjct  179  KNATDAMNESRIFDFLNSMSGLQYRRMDFEEFCAAALSVYQLESLDRWEQHARCAYEIFE  238

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR IVIEELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+
Sbjct  239  KEGNRTIVIEELASELGLGPSLPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRS  293



>ref|XP_006579812.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Glycine max]
Length=415

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQHARCAYE+FE
Sbjct  297  KNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQHARCAYELFE  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK
Sbjct  357  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAK  413



>dbj|BAF00328.1| calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
Length=345

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  227  KMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  286

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  287  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  341



>ref|XP_010066051.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
Length=600

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/120 (88%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASL+ALQYRRMDFEEFCAAALSVHQLEALD WEQHAR AYE FE
Sbjct  481  KNATDAMKESRIPDFLASLSALQYRRMDFEEFCAAALSVHQLEALDNWEQHARSAYEHFE  540

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVI+ELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG+SSRTA K Q
Sbjct  541  KDGNRAIVIDELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFIKLLHGMSSRTAIKTQ  600



>ref|XP_007042370.1| CDPK-related kinase [Theobroma cacao]
 gb|EOX98201.1| CDPK-related kinase [Theobroma cacao]
Length=583

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES I DFL SLN LQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  464  KNATDAMKESHIPDFLFSLNTLQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  523

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  524  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRALAKAQ  583



>ref|XP_011085503.1| PREDICTED: CDPK-related protein kinase-like [Sesamum indicum]
Length=613

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAM ESRI+DFLASLNALQYRRMDFEEFCAAA SV+QLEALDRWEQHARCAYE+F+
Sbjct  494  KNATDAMNESRIYDFLASLNALQYRRMDFEEFCAAASSVYQLEALDRWEQHARCAYELFD  553

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PS+P+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+ AK
Sbjct  554  KDGNRTIMIEELASELGLSPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRSLAK  611



>ref|XP_010926368.1| PREDICTED: CDPK-related protein kinase-like [Elaeis guineensis]
Length=356

 Score =   213 bits (543),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES I D   SL+ALQYRRMDF+EFCAA LSVHQLE LD WEQHARCAYE+FE
Sbjct  237  KNATDAMKESCIQDLFVSLSALQYRRMDFDEFCAATLSVHQLEGLDGWEQHARCAYELFE  296

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT AK +
Sbjct  297  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTLAKAR  356



>gb|AET04065.2| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=581

 Score =   219 bits (558),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D +ASLNALQYRRMDF+EFC AALSVHQLEALDRWEQHARCAYEIFE
Sbjct  463  KNATDAMKESRIPDLVASLNALQYRRMDFDEFCTAALSVHQLEALDRWEQHARCAYEIFE  522

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+  K Q
Sbjct  523  KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLVKPQ  581



>ref|XP_010103697.1| CDPK-related protein kinase [Morus notabilis]
 gb|EXB96709.1| CDPK-related protein kinase [Morus notabilis]
Length=603

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES + D LAS NALQYRRMDFEEFCAA LSVHQLEALDRWEQHARCAYE+FE
Sbjct  484  KNATDAMKESHVLDILASFNALQYRRMDFEEFCAATLSVHQLEALDRWEQHARCAYELFE  543

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNRAIVIEELASELG+GPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVS RT AK
Sbjct  544  KEGNRAIVIEELASELGVGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSIRTLAK  601



>ref|XP_010268648.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Nelumbo nucifera]
Length=611

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 113/130 (87%), Gaps = 10/130 (8%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRIHDFL SL ALQYRRMDFEEFCAAALSV+QLEALD+WEQHARCAYE+FE
Sbjct  482  KNATDAMKESRIHDFLGSLLALQYRRMDFEEFCAAALSVYQLEALDQWEQHARCAYELFE  541

Query  559  KDGNRAIVIEELAS----------ELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHG  410
            KDGNRAIVIEELAS          ELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG
Sbjct  542  KDGNRAIVIEELASKISIAIQVHLELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG  601

Query  409  VSSRTAAKVQ  380
            VSSRT AK Q
Sbjct  602  VSSRTLAKAQ  611



>ref|XP_008795162.1| PREDICTED: LOW QUALITY PROTEIN: CDPK-related kinase 5-like [Phoenix 
dactylifera]
Length=609

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+ D L SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQHARCAYE+FE
Sbjct  490  KKATDAMKESRVQDLLVSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQHARCAYELFE  549

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK +
Sbjct  550  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRPLAKAR  609



>ref|XP_010503722.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=606

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  488  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  547

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            KDGNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  548  KDGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  602



>ref|XP_010916660.1| PREDICTED: CDPK-related kinase 5 [Elaeis guineensis]
Length=609

 Score =   219 bits (557),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+ D L SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQHARCAYE+FE
Sbjct  490  KNATDAMKESRVQDLLVSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQHARCAYELFE  549

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR  AK +
Sbjct  550  KDGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRPLAKAR  609



>gb|AFC88293.1| calcium-dependent protein kinase 6 [Hevea brasiliensis]
Length=594

 Score =   218 bits (555),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+S I DFL+SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQ AR AYEIF+
Sbjct  475  KNATDAMKDSHIPDFLSSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQRARSAYEIFD  534

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDG+LSF GF KLLHG+SSRT AKVQ
Sbjct  535  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGQLSFHGFVKLLHGMSSRTVAKVQ  594



>ref|XP_002521854.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40490.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=598

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI D+L SLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHAR AY++FE
Sbjct  479  KNATDAMKDSRIPDYLTSLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARTAYDLFE  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            ++GNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG+SSRT AK Q
Sbjct  539  REGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGISSRTIAKAQ  598



>ref|XP_003629589.1| Calcium/calmodulin-dependent protein kinase CaMK3 [Medicago truncatula]
Length=607

 Score =   218 bits (556),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D +ASLNALQYRRMDF+EFC AALSVHQLEALDRWEQHARCAYEIFE
Sbjct  489  KNATDAMKESRIPDLVASLNALQYRRMDFDEFCTAALSVHQLEALDRWEQHARCAYEIFE  548

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAI+IEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+  K Q
Sbjct  549  KDGNRAIMIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLVKPQ  607



>ref|XP_009409499.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+ +FL SL+ALQYRRMDF+EFCAA LSVHQLE LDRWEQHARCAYE+FE
Sbjct  485  KNATDAMKESRVQEFLLSLSALQYRRMDFDEFCAATLSVHQLEGLDRWEQHARCAYELFE  544

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR+
Sbjct  545  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRS  599



>emb|CDO97150.1| unnamed protein product [Coffea canephora]
Length=597

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAM++SR+ DFLASLNALQYR+MDFEEFCAAA SVHQLEALDRWEQHAR AYEIFE
Sbjct  478  KNSTDAMEDSRVPDFLASLNALQYRKMDFEEFCAAASSVHQLEALDRWEQHARGAYEIFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNRAIVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG S+RT +KV
Sbjct  538  KEGNRAIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSTRTHSKV  596



>ref|NP_001169792.1| uncharacterized protein LOC100383682 [Zea mays]
 gb|ACN34927.1| unknown [Zea mays]
Length=219

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  102  ATDAMKESRVQDILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYEYFEKE  161

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  162  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  219



>gb|KJB32432.1| hypothetical protein B456_005G240400 [Gossypium raimondii]
Length=416

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQHARCAYE+FE
Sbjct  297  KNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQHARCAYELFE  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF K+L G SSR  AK Q
Sbjct  357  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKVLRGPSSRAVAKAQ  416



>emb|CDY69753.1| BnaCnng65160D [Brassica napus]
Length=534

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  416  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  475

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  476  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  530



>ref|XP_004136991.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_008454927.1| PREDICTED: CDPK-related kinase 5 [Cucumis melo]
 gb|KGN43947.1| hypothetical protein Csa_7G074310 [Cucumis sativus]
Length=603

 Score =   217 bits (553),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAM ESR  DFLA+LN LQYR MDF+EFCAAALS+HQLEALDRWEQHARCAYEIFE
Sbjct  484  KHATDAMNESRTLDFLANLNTLQYRGMDFDEFCAAALSIHQLEALDRWEQHARCAYEIFE  543

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNRAIVIEELASELGLGP++PLH VL DWIRHTDGKLSFLGF KLLHGVSSR+ AKV
Sbjct  544  KNGNRAIVIEELASELGLGPAIPLHVVLQDWIRHTDGKLSFLGFVKLLHGVSSRSLAKV  602



>gb|KHN47935.1| CDPK-related protein kinase [Glycine soja]
Length=579

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQHARCAYE+FE
Sbjct  461  KNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQHARCAYELFE  520

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK
Sbjct  521  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAK  577



>ref|XP_003525704.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Glycine max]
Length=578

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI DFLASLNALQYRRM F+EFCAAALSVHQLEAL RWEQHARCAYE+FE
Sbjct  460  KNATDAMKESRIPDFLASLNALQYRRMAFDEFCAAALSVHQLEALGRWEQHARCAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK
Sbjct  520  KDGNRAIVIEELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAK  576



>ref|XP_010515424.1| PREDICTED: CDPK-related kinase 5 [Camelina sativa]
Length=606

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  488  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  547

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  548  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  602



>ref|XP_006290766.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23664.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  487  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  546

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  547  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  601



>ref|XP_010426596.1| PREDICTED: CDPK-related kinase 5-like [Camelina sativa]
Length=607

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  489  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  548

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  549  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  603



>gb|KJB79287.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=419

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  300  KNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQHARCAYELFE  359

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  360  KDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRALAKAQ  419



>gb|KDP38227.1| hypothetical protein JCGZ_04870 [Jatropha curcas]
Length=595

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI DFL+SLNALQYRRMDFEEFCAA LSVHQLEALD+WEQ A  AYE+F+
Sbjct  476  KNATDAMKDSRIPDFLSSLNALQYRRMDFEEFCAAGLSVHQLEALDQWEQRAISAYELFD  535

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHGVSSRT AKVQ
Sbjct  536  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGVSSRTVAKVQ  595



>ref|XP_009101966.1| PREDICTED: CDPK-related kinase 5-like isoform X2 [Brassica rapa]
Length=578

 Score =   216 bits (550),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  460  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  520  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  574



>gb|KJB79285.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
 gb|KJB79286.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=415

 Score =   212 bits (540),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  296  KNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQHARCAYELFE  355

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  356  KDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRALAKAQ  415



>emb|CDY65016.1| BnaCnng45690D [Brassica napus]
Length=594

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  476  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  535

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  536  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  590



>emb|CDY52824.1| BnaAnng11710D [Brassica napus]
Length=594

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  476  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  535

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  536  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  590



>ref|XP_009115721.1| PREDICTED: CDPK-related kinase 5 [Brassica rapa]
Length=594

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  476  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  535

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  536  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  590



>gb|KJB48534.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=575

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQHARCAYEIFE
Sbjct  463  KNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQHARCAYEIFE  522

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSS  401
            K+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSS
Sbjct  523  KEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSS  575



>gb|KFK34304.1| hypothetical protein AALP_AA5G127600 [Arabis alpina]
Length=598

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  480  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  539

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  540  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  594



>ref|XP_009101959.1| PREDICTED: CDPK-related kinase 5-like isoform X1 [Brassica rapa]
Length=608

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  490  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  549

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  550  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  604



>gb|KHN36210.1| CDPK-related protein kinase [Glycine soja]
Length=521

 Score =   214 bits (545),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+ARCAY++FEKD
Sbjct  405  ATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQNARCAYDLFEKD  464

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK Q
Sbjct  465  GNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAKGQ  521



>ref|XP_006404024.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
 gb|ESQ45477.1| hypothetical protein EUTSA_v10010211mg [Eutrema salsugineum]
Length=614

 Score =   216 bits (550),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  496  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  555

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  556  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  610



>ref|XP_006290767.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
 gb|EOA23665.1| hypothetical protein CARUB_v10016874mg [Capsella rubella]
Length=605

 Score =   216 bits (549),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA ++ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  487  KMATDAMKDSRIPEFLAQVSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  546

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  547  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  601



>ref|XP_011007668.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=607

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/120 (87%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  TDAMK+S I DF+ASLNALQYRRMDFEEFCAAALSVHQLEALD WEQ AR AYE+FE
Sbjct  488  KNGTDAMKDSHIPDFIASLNALQYRRMDFEEFCAAALSVHQLEALDLWEQRARSAYELFE  547

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  548  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFVKLLRGASSRILAKAQ  607



>ref|XP_002876036.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52295.1| hypothetical protein ARALYDRAFT_485401 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score =   216 bits (549),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  479  KMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  539  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  593



>ref|NP_190622.1| CDPK-related kinase [Arabidopsis thaliana]
 sp|Q9SCS2.1|CAMK5_ARATH RecName: Full=CDPK-related kinase 5; Short=AtCRK5; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 1 [Arabidopsis 
thaliana]
 emb|CAB62482.1| CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE78676.1| CDPK-related kinase [Arabidopsis thaliana]
Length=601

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  543  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  597



>emb|CDY65651.1| BnaCnng48080D [Brassica napus]
Length=585

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  467  KMATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  526

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVS+RT
Sbjct  527  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSNRT  581



>gb|KJB48530.1| hypothetical protein B456_008G074300 [Gossypium raimondii]
Length=610

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK++RI +FLASLNALQYRRMDF+EFCAAAL+VHQLEALDRWEQHARCAYEIFE
Sbjct  498  KNATDAMKDARIPEFLASLNALQYRRMDFDEFCAAALTVHQLEALDRWEQHARCAYEIFE  557

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSS  401
            K+GNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSS
Sbjct  558  KEGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSS  610



>ref|NP_001190048.1| CDPK-related kinase [Arabidopsis thaliana]
 gb|AEE78677.1| CDPK-related kinase [Arabidopsis thaliana]
Length=632

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  514  KMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  573

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSRT
Sbjct  574  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLLHGVSSRT  628



>ref|XP_004509161.1| PREDICTED: CDPK-related protein kinase-like [Cicer arietinum]
Length=582

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/120 (85%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMKESR+ D LASLNALQYRRMD +EFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  464  RNATDAMKESRMPDLLASLNALQYRRMDCDEFCAAALSVHQLEALDRWEQHARCAYELFE  523

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELA+ELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+  K Q
Sbjct  524  KDGNRAIVIEELATELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLVKPQ  582



>ref|XP_010680435.1| PREDICTED: CDPK-related kinase 5 [Beta vulgaris subsp. vulgaris]
Length=598

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR H+ L SL ALQYRRMDFEEFCAAALSV+QLEAL+RW+QHARCAYE+FE
Sbjct  479  KNATDAMKESRAHEILTSLTALQYRRMDFEEFCAAALSVYQLEALERWDQHARCAYELFE  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGP++P+HAVLHDWIRHTDGKLSFLGF KLLHGVSSRT  K
Sbjct  539  KDGNRPIMIEELASELGLGPNIPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRTLIK  596



>gb|KJB32430.1| hypothetical protein B456_005G240400 [Gossypium raimondii]
Length=578

 Score =   214 bits (545),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQHARCAYE+FE
Sbjct  459  KNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQHARCAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF K+L G SSR  AK Q
Sbjct  519  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKVLRGPSSRAVAKAQ  578



>gb|KHG25548.1| CDPK-related protein kinase [Gossypium arboreum]
Length=578

 Score =   214 bits (544),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKES + DFL SLNALQYRRMDFEEFCAAALSVHQLEA D WEQHARCAY++FE
Sbjct  459  KNATDAMKESHMLDFLLSLNALQYRRMDFEEFCAAALSVHQLEAFDHWEQHARCAYDLFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  519  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRAVAKAQ  578



>ref|XP_003516596.1| PREDICTED: CDPK-related kinase 5-like [Glycine max]
Length=585

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+ARCAY++FEKD
Sbjct  469  ATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQNARCAYDLFEKD  528

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK Q
Sbjct  529  GNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAKGQ  585



>gb|KJB79283.1| hypothetical protein B456_013G042100 [Gossypium raimondii]
Length=583

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  464  KNATDAMKDSHVPDFLFSLNALQYRRMCFEEFCAAALSVHQLEALDRWEQHARCAYELFE  523

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  524  KDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRALAKAQ  583



>gb|KHG30483.1| CDPK-related protein kinase [Gossypium arboreum]
Length=583

 Score =   213 bits (542),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  TDAMK+S + DFL SLNALQYRRM FEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  464  KNVTDAMKDSHVPDFLFSLNALQYRRMGFEEFCAAALSVHQLEALDRWEQHARCAYELFE  523

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNR IVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSFLGF KLL G SSR  AK Q
Sbjct  524  KDGNRPIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFLGFVKLLRGPSSRALAKAQ  583



>ref|XP_010558347.1| PREDICTED: CDPK-related kinase 5-like [Tarenaya hassleriana]
Length=615

 Score =   213 bits (543),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  496  KSATDAMKDSRIPEFLAQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  555

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSS  401
            K+GNR I+IEELASELGLGP+VP+HAVLHDWIRHTDGKLSFLGF KLLHGVSS
Sbjct  556  KEGNRPIMIEELASELGLGPAVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSS  608



>gb|AAL30814.1|AF435446_1 calcium/calmodulin-dependent protein kinase CaMK1 [Arabidopsis 
thaliana]
 emb|CAA70572.1| CDPK-related protein kinase [Arabidopsis thaliana]
Length=601

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FL  L+ALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYE+FE
Sbjct  483  KMATDAMKDSRIPEFLGQLSALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDW+RHTDGKLSFLGF KL HGVSSRT
Sbjct  543  KEGNRPIMIDELASELGLGPSVPVHAVLHDWLRHTDGKLSFLGFVKLQHGVSSRT  597



>ref|XP_010550381.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Tarenaya hassleriana]
Length=614

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALS+HQLEAL+RWEQHARCAYE+FE
Sbjct  496  KNATDAMKDSRISEFLAQLSALQYRRMDFEEFCAAALSIHQLEALERWEQHARCAYELFE  555

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR 
Sbjct  556  KEGNRPIMIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRV  610



>ref|XP_006657969.1| PREDICTED: CDPK-related protein kinase-like [Oryza brachyantha]
Length=416

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ + LASL+ALQYRRMDF+EFCAAALSVHQLEALDRWEQHAR AY+ FEKD
Sbjct  299  ATDAMKESRVQEILASLSALQYRRMDFQEFCAAALSVHQLEALDRWEQHARSAYDFFEKD  358

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  359  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  416



>ref|XP_010550380.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Tarenaya hassleriana]
Length=646

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SRI +FLA L+ALQYRRMDFEEFCAAALS+HQLEAL+RWEQHARCAYE+FE
Sbjct  528  KNATDAMKDSRISEFLAQLSALQYRRMDFEEFCAAALSIHQLEALERWEQHARCAYELFE  587

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            K+GNR I+I+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR 
Sbjct  588  KEGNRPIMIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSRV  642



>ref|XP_011005000.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=416

 Score =   206 bits (525),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AMK+SR+ DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  AR AYE+FE
Sbjct  297  KNATNAMKDSRVPDFLASLNPLQYRRMDFEEFCAAALNVHQLETLDQWKHLARSAYELFE  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG SSRT AK Q
Sbjct  357  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGTSSRTIAKAQ  416



>gb|EPS69494.1| hypothetical protein M569_05270 [Genlisea aurea]
Length=657

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 119/145 (82%), Gaps = 3/145 (2%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AM ESRI +FL SLNALQYRRMDFEEFCAAA SV+QLEALDRWEQHARC YE FE
Sbjct  478  KNATEAMNESRIFEFLTSLNALQYRRMDFEEFCAAASSVYQLEALDRWEQHARCGYEFFE  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            K+GNR I+IEELASELGL PSVP+HAVLHDW+RHTDGKLSFLGF KLLHGVSSR+ AK  
Sbjct  538  KEGNRTIMIEELASELGLSPSVPVHAVLHDWVRHTDGKLSFLGFVKLLHGVSSRSLAKT-  596

Query  379  *HSTRPPTRLDHHHPLATSFSSELI  305
              ++R     DH   L+++ +S  +
Sbjct  597  --NSRTIYLSDHDGKLSSTTTSSCL  619



>ref|XP_008457867.1| PREDICTED: CDPK-related kinase 5-like [Cucumis melo]
Length=622

 Score =   211 bits (536),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQHAR AY++FE
Sbjct  503  KNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQHARYAYDLFE  562

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK
Sbjct  563  KDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSSRTLAK  620



>ref|XP_006384440.1| hypothetical protein POPTR_0004s15110g [Populus trichocarpa]
 gb|ERP62237.1| hypothetical protein POPTR_0004s15110g [Populus trichocarpa]
Length=596

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AMK+SRI DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  AR AYEIFE
Sbjct  477  KNATNAMKDSRIPDFLASLNQLQYRRMDFEEFCAAALNVHQLETLDQWKHLARSAYEIFE  536

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG SSRT AK Q
Sbjct  537  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGTSSRTIAKAQ  596



>ref|XP_004148051.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN62050.1| hypothetical protein Csa_2G292800 [Cucumis sativus]
Length=621

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+ MKESRI D L SL+ALQYRRMDFEEFCAAA+S+HQLEALDRWEQHAR AY++FE
Sbjct  502  KNITNGMKESRIPDLLTSLSALQYRRMDFEEFCAAAVSIHQLEALDRWEQHARYAYDLFE  561

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR IVIEELASELGL PSVP+HAVLHDWIRHTDGKLSFLGF KLLHG SSRT AK
Sbjct  562  KDGNRPIVIEELASELGLSPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHGPSSRTLAK  619



>gb|KDO49130.1| hypothetical protein CISIN_1g007776mg [Citrus sinensis]
Length=547

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQHAR AYE+FE
Sbjct  428  KNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQHARSAYELFE  487

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV SRT  K
Sbjct  488  KDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGVPSRTMGK  545



>ref|XP_004511959.1| PREDICTED: CDPK-related kinase 5-like [Cicer arietinum]
Length=587

 Score =   209 bits (533),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFL SLNALQYRRMDF+EFCAAALSVHQLEA+D WE+ ARCAY++FEKD
Sbjct  471  ATDAMKESRIADFLGSLNALQYRRMDFDEFCAAALSVHQLEAIDHWEKRARCAYDLFEKD  530

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GN+AIVI+ELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK Q
Sbjct  531  GNKAIVIDELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAKAQ  587



>ref|XP_006480135.1| PREDICTED: CDPK-related kinase 5-like [Citrus sinensis]
Length=593

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQHAR AYE+FE
Sbjct  474  KNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQHARSAYELFE  533

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV SRT  K
Sbjct  534  KDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGVPSRTMGK  591



>ref|XP_011001201.1| PREDICTED: CDPK-related kinase 5-like [Populus euphratica]
Length=596

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AMK+SR+ DFLASLN LQYRRMDFEEFCAAAL+VHQLE LD+W+  AR AYE+FE
Sbjct  477  KNATNAMKDSRVPDFLASLNPLQYRRMDFEEFCAAALNVHQLETLDQWKHLARSAYELFE  536

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRAIVIEELASELGLGPS+P+HAVL+DWIRHTDGKLSF GF KLLHG SSRT AK Q
Sbjct  537  KDGNRAIVIEELASELGLGPSIPVHAVLNDWIRHTDGKLSFHGFVKLLHGTSSRTIAKAQ  596



>gb|KDO49131.1| hypothetical protein CISIN_1g007776mg [Citrus sinensis]
Length=590

 Score =   208 bits (530),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQHAR AYE+FE
Sbjct  471  KNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQHARSAYELFE  530

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVI+ELASELGL PS+PLH VLHDWIRHTDGKLSF GF KLLHGV SRT  K
Sbjct  531  KDGNRAIVIDELASELGLAPSIPLHVVLHDWIRHTDGKLSFHGFVKLLHGVPSRTMGK  588



>gb|EEC82459.1| hypothetical protein OsI_26896 [Oryza sativa Indica Group]
Length=453

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AY+ FEKD
Sbjct  336  ATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYDFFEKD  395

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  396  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  453



>ref|XP_008676192.1| PREDICTED: CDPK-related protein kinase-like [Zea mays]
Length=127

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESR+ D L SL+ALQYRRMD  EFCAA +SVHQLEALDRWEQHAR AYE FEK+
Sbjct  10   ATNAMKESRVQDILVSLSALQYRRMDLHEFCAAVVSVHQLEALDRWEQHARSAYEYFEKE  69

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
             NRAIVI+ELASELGL PSVPLH +L DWIR+TDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  70   VNRAIVIDELASELGLSPSVPLHVILQDWIRYTDGKLSFLGFVKLLHGMSSRSLSKMR  127



>tpg|DAA63630.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=416

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  299  ATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  358

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  359  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  416



>ref|XP_006423061.1| hypothetical protein CICLE_v10028073mg [Citrus clementina]
 gb|ESR36301.1| hypothetical protein CICLE_v10028073mg [Citrus clementina]
Length=590

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESRI D LA LNALQYR MDFEEFCAAAL+VHQLEALD WEQHAR AYE+FE
Sbjct  471  KNATDAMKESRISDLLAPLNALQYRAMDFEEFCAAALNVHQLEALDLWEQHARSAYELFE  530

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVI+ELASELGL PS+PLH VL+DWIRHTDGKLSF GF KLLHGV SRT  K
Sbjct  531  KDGNRAIVIDELASELGLAPSIPLHVVLNDWIRHTDGKLSFHGFVKLLHGVPSRTMGK  588



>dbj|BAK06421.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=592

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQHAR AYEIFEKD
Sbjct  475  ATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQHARSAYEIFEKD  534

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  535  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  592



>ref|XP_008668447.1| PREDICTED: uncharacterized protein LOC100383682 isoform X1 [Zea 
mays]
 tpg|DAA41478.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=598

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  481  ATDAMKESRVQDILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYEYFEKE  540

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  541  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  598



>ref|XP_003611786.1| CDPK-related protein kinase [Medicago truncatula]
 gb|AES94744.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=587

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQ+ ALD WE+ AR A+++FEKD
Sbjct  471  ATDAMKESRIADFLASLNALQYRRMDFDEFCAAALSVHQVVALDHWEKRARYAFDLFEKD  530

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GN+AIVI+ELASELGLGPS+P+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AKVQ
Sbjct  531  GNKAIVIDELASELGLGPSIPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSVAKVQ  587



>ref|NP_001060297.1| Os07g0619800 [Oryza sativa Japonica Group]
 dbj|BAF22211.1| Os07g0619800 [Oryza sativa Japonica Group]
 dbj|BAG90553.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE67603.1| hypothetical protein OsJ_25154 [Oryza sativa Japonica Group]
Length=453

 Score =   202 bits (513),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T AMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AY+ FEKD
Sbjct  336  ATYAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYDFFEKD  395

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  396  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  453



>ref|XP_006829951.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
 gb|ERM97367.1| hypothetical protein AMTR_s00073p00197610 [Amborella trichopoda]
Length=606

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K++TDAMKESR+H+ L S+ AL YR+MDFEEFCAAA+SVHQLE LDRWEQHAR A+E+F+
Sbjct  486  KHATDAMKESRVHELLTSMTALLYRKMDFEEFCAAAISVHQLEGLDRWEQHARSAFELFD  545

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            K+GNRAIVIEELASELGLGP VP+HAVLHDWIRHTDGKLSFLGF KLLHGVSSR
Sbjct  546  KEGNRAIVIEELASELGLGPCVPVHAVLHDWIRHTDGKLSFLGFVKLLHGVSSR  599



>ref|XP_003562669.1| PREDICTED: CDPK-related kinase 5-like [Brachypodium distachyon]
Length=601

 Score =   205 bits (521),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQHAR AYE+FE+D
Sbjct  484  ATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQHARSAYELFERD  543

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  544  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKIR  601



>ref|XP_004958339.1| PREDICTED: CDPK-related kinase 5-like [Setaria italica]
Length=604

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AYE FEKD
Sbjct  487  ATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKD  546

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  547  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  604



>ref|XP_009389551.1| PREDICTED: CDPK-related kinase 5-like [Musa acuminata subsp. 
malaccensis]
Length=607

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  TD MKE  + D L SL ALQYRRMDF+EFCAA LSVHQLE LDRWEQHARCAYE+FE
Sbjct  485  KNVTDQMKELHVQDILVSLGALQYRRMDFDEFCAATLSVHQLEGLDRWEQHARCAYELFE  544

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTA  392
            KDGNRAIVIEELASELGL PSVP+H VL DWIRHTDGKLSFLGF KLLHGVSSR+A
Sbjct  545  KDGNRAIVIEELASELGLSPSVPVHVVLRDWIRHTDGKLSFLGFVKLLHGVSSRSA  600



>ref|XP_006836275.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
 gb|ERM99128.1| hypothetical protein AMTR_s00101p00154790 [Amborella trichopoda]
Length=580

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMKESR+ DF++S+ ALQYRR+DFEEFCAAA SVHQ+E L+ WEQHAR AYE+FE
Sbjct  458  KNATDAMKESRVLDFVSSIGALQYRRLDFEEFCAAATSVHQMEGLENWEQHARRAYELFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNRAIVIEELASELGLGPSVP+H VLHDWIRH+DGKLSFLGF +LLHG+SSR   K
Sbjct  518  KDGNRAIVIEELASELGLGPSVPVHVVLHDWIRHSDGKLSFLGFVRLLHGISSRYMPK  575



>gb|EMS58490.1| CDPK-related protein kinase [Triticum urartu]
Length=672

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKE+R+ + L SL+ALQYRRMDF EFCAAA+SVHQLEALDRWEQHAR AYEIFEKD
Sbjct  555  ATDAMKETRVQEILVSLSALQYRRMDFHEFCAAAVSVHQLEALDRWEQHARSAYEIFEKD  614

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  615  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  672



>ref|XP_010028268.1| PREDICTED: CDPK-related kinase 5 [Eucalyptus grandis]
 gb|KCW54983.1| hypothetical protein EUGRSUZ_I00953 [Eucalyptus grandis]
Length=621

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMKESR+ DFL SL+ALQYRRMDFEEFCAA LSVHQLEA+DRWEQ ARCAYEIFE
Sbjct  503  RNATDAMKESRVLDFLTSLSALQYRRMDFEEFCAATLSVHQLEAVDRWEQLARCAYEIFE  562

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNRAIVI+ELASELG+  SVP++AVLHDWIRHTDGKLSF GF KLLHG+SSR+ AK 
Sbjct  563  KEGNRAIVIDELASELGVSSSVPVYAVLHDWIRHTDGKLSFHGFLKLLHGISSRSLAKT  621



>ref|XP_002463191.1| hypothetical protein SORBIDRAFT_02g039460 [Sorghum bicolor]
 gb|EER99712.1| hypothetical protein SORBIDRAFT_02g039460 [Sorghum bicolor]
Length=601

 Score =   203 bits (516),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  484  ATDAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  543

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  544  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  601



>gb|AAV64211.1| putative CDPK-related protein kinase [Zea mays]
 gb|AAV64248.1| putative CDPK-related protein kinase [Zea mays]
Length=602

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  485  ATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  544

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  545  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  602



>gb|ACG29695.1| hypothetical protein [Zea mays]
Length=603

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  486  ATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  545

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  546  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  603



>tpg|DAA63631.1| TPA: LOW QUALITY PROTEIN: putative protein kinase superfamily 
protein [Zea mays]
Length=601

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  484  ATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  543

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  544  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  601



>ref|XP_007156824.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
 gb|ESW28818.1| hypothetical protein PHAVU_002G020800g [Phaseolus vulgaris]
Length=589

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAM ESR+ DFL SLNALQ+RRMDF+EFCAAALSVHQLE  D+WEQ AR AYE+FEKD
Sbjct  473  ATDAMNESRVPDFLTSLNALQFRRMDFDEFCAAALSVHQLETHDQWEQRARYAYELFEKD  532

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK Q
Sbjct  533  GNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAKAQ  589



>dbj|BAC79915.1| putative CDPK-related protein kinase [Oryza sativa Japonica Group]
 dbj|BAC79879.1| putative CDPK-related protein kinase [Oryza sativa Japonica Group]
Length=599

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T AMKESR+ + L SL+ALQYRRMDF+EFCAAA+SVHQLEALDRWEQHAR AY+ FEKD
Sbjct  482  ATYAMKESRVQEILVSLSALQYRRMDFQEFCAAAVSVHQLEALDRWEQHARSAYDFFEKD  541

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PSVPLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  542  GNRAIVIDELASELGLSPSVPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  599



>ref|NP_001146922.1| LOC100280531 [Zea mays]
 gb|ACG24432.1| CDPK-related protein kinase [Zea mays]
Length=602

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESR+ D L SL+ALQYRRM+F+EFCAAA+SVHQLEALDRWEQHAR AYE FEK+
Sbjct  485  ATDAMKESRVQDILVSLSALQYRRMEFQEFCAAAVSVHQLEALDRWEQHARSAYEHFEKE  544

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVI+ELASELGL PS PLH VL DWIRHTDGKLSFLGF KLLHG+SSR+ +K++
Sbjct  545  GNRAIVIDELASELGLSPSAPLHVVLQDWIRHTDGKLSFLGFVKLLHGMSSRSLSKMR  602



>ref|XP_007155948.1| hypothetical protein PHAVU_003G2460001g, partial [Phaseolus vulgaris]
 gb|ESW27942.1| hypothetical protein PHAVU_003G2460001g, partial [Phaseolus vulgaris]
Length=101

 Score =   186 bits (471),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/100 (91%), Positives = 95/100 (95%), Gaps = 1/100 (1%)
 Frame = -2

Query  685  LNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKDGNRAIVIEELASELGL  506
            LNALQYRRM F+EFCAAALSVHQLEALDRWEQHARCAYE+FEKDGNRAIVIEELASELGL
Sbjct  1    LNALQYRRMAFDEFCAAALSVHQLEALDRWEQHARCAYELFEKDGNRAIVIEELASELGL  60

Query  505  GPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GPSVP+HAVLHDWIRHTDGKLSFLGF KLLHG  SR+ AK
Sbjct  61   GPSVPVHAVLHDWIRHTDGKLSFLGFVKLLHG-PSRSLAK  99



>ref|XP_010523218.1| PREDICTED: CDPK-related kinase 8 isoform X2 [Tarenaya hassleriana]
Length=589

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI DFLASLN LQYR MDFEEFCAAA+SVHQ E+L  WEQ  R AYEIFEK+
Sbjct  472  ATEAMKESRIPDFLASLNGLQYRGMDFEEFCAAAMSVHQHESLGCWEQSVRHAYEIFEKN  531

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVIEELASELG+GPS+P+H+VLHDWIRH+DGKLS+LGF KLLHGVS+R  AK +
Sbjct  532  GNRAIVIEELASELGVGPSIPVHSVLHDWIRHSDGKLSYLGFVKLLHGVSNRPLAKTR  589



>ref|XP_010523217.1| PREDICTED: CDPK-related kinase 8 isoform X1 [Tarenaya hassleriana]
Length=590

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI DFLASLN LQYR MDFEEFCAAA+SVHQ E+L  WEQ  R AYEIFEK+
Sbjct  473  ATEAMKESRIPDFLASLNGLQYRGMDFEEFCAAAMSVHQHESLGCWEQSVRHAYEIFEKN  532

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            GNRAIVIEELASELG+GPS+P+H+VLHDWIRH+DGKLS+LGF KLLHGVS+R  AK +
Sbjct  533  GNRAIVIEELASELGVGPSIPVHSVLHDWIRHSDGKLSYLGFVKLLHGVSNRPLAKTR  590



>ref|XP_008359596.1| PREDICTED: CDPK-related kinase 1-like [Malus domestica]
Length=182

 Score =   184 bits (468),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + STDAMK+SR+ D++  +++++YR++DFEEFCA+A+SVHQLE ++ WE+HAR AYE+FE
Sbjct  64   RNSTDAMKDSRVLDYVNMISSIRYRKLDFEEFCASAISVHQLEGMESWEEHARRAYELFE  123

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEE+ASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR+  K
Sbjct  124  KDGNRPIMIEEVASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRSFQK  181



>ref|NP_181647.1| CDPK-related kinase 1 [Arabidopsis thaliana]
 sp|O80673.1|CAMK1_ARATH RecName: Full=CDPK-related kinase 1; Short=AtCRK1; AltName: Full=Calcium/calmodulin-dependent 
protein kinase 3; AltName: 
Full=Calmodulin-binding protein kinase 3; Short=AtCBK3; Short=CaM-binding 
protein kinase 3 [Arabidopsis thaliana]
 gb|AAD38058.1|AF153351_1 CDPK-related kinase 1 [Arabidopsis thaliana]
 gb|AAL30816.1|AF435448_1 calcium/calmodulin-dependent protein kinase CaMK3 [Arabidopsis 
thaliana]
 gb|AAD12016.1| CPDK-related protein kinase [Arabidopsis thaliana]
 gb|AEC09936.1| CDPK-related kinase 1 [Arabidopsis thaliana]
Length=576

 Score =   194 bits (493),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  458  KSSTDAMKDSRVFDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  575



>ref|NP_001167827.1| uncharacterized LOC100381527 [Zea mays]
 gb|ACN26229.1| unknown [Zea mays]
 tpg|DAA41583.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=415

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++ ALQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  297  KNSTDAMKDSRVVDFVNTVCALQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DW+RH DGKLSFLGF KLLHGVSSR+  K
Sbjct  357  KEGNRPIVIEELASELGLGPSVPLHVVLQDWVRHADGKLSFLGFIKLLHGVSSRSIPK  414



>ref|XP_002313096.2| hypothetical protein POPTR_0009s10880g [Populus trichocarpa]
 gb|EEE87051.2| hypothetical protein POPTR_0009s10880g [Populus trichocarpa]
Length=591

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +T+AMK+SRI DFL+SLN  Q+ R+DFEEFCAAAL+VHQLEA D+W+Q AR AYE+FE
Sbjct  472  KNATNAMKDSRIPDFLSSLNPFQHGRIDFEEFCAAALNVHQLEAHDQWKQLARSAYELFE  531

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKVQ  380
            KDGNRA+VIEELASELGLGPS+P+HA+L+DWI H DGKLSF GF KLLHG SSRT AK Q
Sbjct  532  KDGNRALVIEELASELGLGPSIPVHAILNDWISHADGKLSFHGFVKLLHGTSSRTIAKAQ  591



>ref|XP_006430540.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43780.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=415

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR AY++F+
Sbjct  297  KNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQHARHAYDLFD  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  357  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  414



>ref|XP_002879911.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56170.1| hypothetical protein ARALYDRAFT_483182 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA + WEQHAR AYE+FE
Sbjct  459  KSSTDAMKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEATETWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  576



>ref|XP_004249131.1| PREDICTED: CDPK-related kinase 1 [Solanum lycopersicum]
Length=574

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++++LQYR++DFEEFCAA++SVHQLE ++ WEQHAR  YE FE
Sbjct  456  KNSTDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAASISVHQLEGMESWEQHARRGYEFFE  515

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  516  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  573



>ref|XP_004142011.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 ref|XP_004167564.1| PREDICTED: CDPK-related protein kinase-like [Cucumis sativus]
 gb|KGN48509.1| hypothetical protein Csa_6G490240 [Cucumis sativus]
Length=604

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+AMKESR  DFLASLNALQ+RRMDFEEFCAA LSV QLE L  WEQ AR AYE FE
Sbjct  486  KNGTEAMKESRTIDFLASLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQLARSAYEAFE  545

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            KDGNRAI+IEELASELGL PSVP+H+VL DWIRHTDGKLSFLGF KLLHG SSR
Sbjct  546  KDGNRAIMIEELASELGLSPSVPVHSVLQDWIRHTDGKLSFLGFVKLLHGPSSR  599



>ref|XP_006393243.1| hypothetical protein EUTSA_v10011327mg [Eutrema salsugineum]
 gb|ESQ30529.1| hypothetical protein EUTSA_v10011327mg [Eutrema salsugineum]
Length=608

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI +FLA LN LQYR MDFEEFCAAAL+VHQ E+LD WEQ  R AYE+F+K+
Sbjct  490  ATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAALNVHQHESLDCWEQSIRHAYELFDKN  549

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GFAKLLHGVS R + K 
Sbjct  550  GNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFAKLLHGVSVRPSVKT  606



>ref|XP_007202163.1| hypothetical protein PRUPE_ppa006385mg [Prunus persica]
 gb|EMJ03362.1| hypothetical protein PRUPE_ppa006385mg [Prunus persica]
Length=414

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STDAMK+SR+ D++  +++++YR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FEKD
Sbjct  298  STDAMKDSRVLDYVNMISSIRYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYELFEKD  357

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  358  GNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  413



>gb|ACU18167.1| unknown [Glycine max]
Length=256

 Score =   183 bits (465),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FE
Sbjct  138  RSATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYEMFE  197

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  198  KEGNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  255



>gb|KDO53615.1| hypothetical protein CISIN_1g0074582mg, partial [Citrus sinensis]
Length=444

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR AY++F+
Sbjct  326  KNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQHARHAYDLFD  385

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  386  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  443



>emb|CDY35427.1| BnaA03g19330D [Brassica napus]
Length=567

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQHAR AYE+FE
Sbjct  449  KSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQHARRAYELFE  508

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  509  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLHK  566



>ref|XP_009618516.1| PREDICTED: CDPK-related kinase 7-like [Nicotiana tomentosiformis]
Length=577

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++++LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR  YE FE
Sbjct  459  KNSTDAMKDSRVLDFVNTVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQHARRGYEFFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  576



>ref|XP_009133469.1| PREDICTED: CDPK-related kinase 1 [Brassica rapa]
Length=567

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQHAR AYE+FE
Sbjct  449  KSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQHARRAYELFE  508

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  509  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLHK  566



>ref|XP_006411380.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
 gb|ESQ52833.1| hypothetical protein EUTSA_v10016437mg [Eutrema salsugineum]
Length=576

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  458  KSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  575



>emb|CDY22505.1| BnaC03g23150D [Brassica napus]
Length=568

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+Q+EA++ WEQHAR AYE+FE
Sbjct  450  KSATDAMKDSRVIDFVHMISCLQYKKLDFEEFCASALSVYQMEAMETWEQHARRAYELFE  509

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT
Sbjct  510  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRT  564



>ref|XP_010517602.1| PREDICTED: CDPK-related kinase 1 isoform X3 [Camelina sativa]
Length=373

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+A+SV+QLEA+  WEQHAR AYE+FE
Sbjct  255  KSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASAISVYQLEAMATWEQHARRAYELFE  314

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  315  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRALQK  372



>ref|XP_006362272.1| PREDICTED: CDPK-related kinase 1-like [Solanum tuberosum]
Length=574

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++++LQYR++DFEEFCAA++SVHQLE ++ WEQHAR  YE FE
Sbjct  456  KNSTDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAASISVHQLEGMESWEQHARRGYEFFE  515

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  516  KEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  573



>emb|CDX76010.1| BnaA04g02740D [Brassica napus]
Length=570

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SRI DF+  ++ LQY+R+DFEEFCA+ALSVHQLEA+  WE+HAR AYE+FE
Sbjct  452  KSSTEATKDSRILDFVDMISCLQYKRLDFEEFCASALSVHQLEAMGTWEKHARRAYELFE  511

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  512  KDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  569



>ref|XP_009761409.1| PREDICTED: CDPK-related kinase 1-like [Nicotiana sylvestris]
Length=577

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SR+ DF+ ++++LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR  YE FE
Sbjct  459  KNATDAMKDSRVFDFVNTVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQHARRGYEFFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KEGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  576



>gb|EEE59106.1| hypothetical protein OsJ_10964 [Oryza sativa Japonica Group]
Length=415

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQHAR AYE F+
Sbjct  297  KNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFD  356

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSRT  K 
Sbjct  357  KEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT  415



>emb|CDY47375.1| BnaC04g24880D [Brassica napus]
Length=574

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SRI DF+  ++ LQY+++DFEEFCA+ALSVHQLEA+  WE+HAR AYE+FE
Sbjct  456  KSSTEATKDSRILDFVDMISCLQYKKLDFEEFCASALSVHQLEAMGTWEKHARRAYELFE  515

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF KLLHGVSSRT  K
Sbjct  516  KDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVKLLHGVSSRTLQK  573



>ref|XP_006482068.1| PREDICTED: CDPK-related kinase 7-like [Citrus sinensis]
Length=576

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR AY++F+
Sbjct  458  KNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQHARHAYDLFD  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  575



>ref|XP_011079071.1| PREDICTED: CDPK-related kinase 1-like [Sesamum indicum]
Length=579

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  +++LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE FE
Sbjct  461  KNSTDAMKDSRVLDYVNVVSSLQYRKLDFEEFCAAAISVHQLEGMESWEQHARHAYEFFE  520

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR+  K
Sbjct  521  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRSFQK  578



>ref|XP_009142724.1| PREDICTED: CDPK-related kinase 1-like [Brassica rapa]
Length=577

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDA K+SR+ DF+  ++ LQYR++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  459  KTATDATKDSRVLDFVHMISCLQYRKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLHK  576



>ref|XP_008668263.1| PREDICTED: uncharacterized LOC100381527 isoform X1 [Zea mays]
 tpg|DAA41584.1| TPA: putative protein kinase superfamily protein isoform 1 [Zea 
mays]
 tpg|DAA41585.1| TPA: putative protein kinase superfamily protein isoform 2 [Zea 
mays]
Length=592

 Score =   190 bits (482),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++ ALQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  474  KNSTDAMKDSRVVDFVNTVCALQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  533

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DW+RH DGKLSFLGF KLLHGVSSR+  K
Sbjct  534  KEGNRPIVIEELASELGLGPSVPLHVVLQDWVRHADGKLSFLGFIKLLHGVSSRSIPK  591



>ref|XP_008440253.1| PREDICTED: CDPK-related kinase 5 isoform X2 [Cucumis melo]
Length=604

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K  T+AMKESR  DFLASLNALQ+RRMDFEEFCAA LSV QLE L  WEQ AR AYE FE
Sbjct  486  KNGTEAMKESRTIDFLASLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQLARSAYEAFE  545

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTA  392
            KDGNRAI+IEELASELGL PS P+H+VL DWIRHTDGKLSFLGF KLLHG SSR  
Sbjct  546  KDGNRAIMIEELASELGLSPSAPVHSVLQDWIRHTDGKLSFLGFVKLLHGPSSRAG  601



>ref|XP_006430539.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
 gb|ESR43779.1| hypothetical protein CICLE_v10011368mg [Citrus clementina]
Length=576

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  + +LQYR++DFEEFCAAA+SVHQLE ++ WEQHAR AY++F+
Sbjct  458  KNSTDAMKDSRVLDYVNMIGSLQYRKLDFEEFCAAAISVHQLEGMETWEQHARHAYDLFD  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  575



>ref|XP_006293901.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
 gb|EOA26799.1| hypothetical protein CARUB_v10022894mg [Capsella rubella]
Length=576

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  458  KSATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  575



>gb|KFK36961.1| hypothetical protein AALP_AA4G195100 [Arabis alpina]
Length=579

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDA K+SR+ DF+  ++ +QY+++DFEEFCA+ALSV+QLEAL+ WEQHAR AYE+FE
Sbjct  461  KSATDATKDSRVLDFVHMISCIQYKKLDFEEFCASALSVYQLEALETWEQHARRAYELFE  520

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  521  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  578



>ref|NP_175381.1| CDPK-related kinase 8 [Arabidopsis thaliana]
 sp|Q9FX86.1|CAMK8_ARATH RecName: Full=CDPK-related kinase 8; Short=AtCRK8; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK8 [Arabidopsis 
thaliana]
 gb|AAG13044.1|AC011807_3 Putative CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AAQ89619.1| At1g49580 [Arabidopsis thaliana]
 dbj|BAF01277.1| putative CDPK-related protein kinase [Arabidopsis thaliana]
 gb|AEE32444.1| CDPK-related kinase 8 [Arabidopsis thaliana]
Length=606

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI +FLA LN LQYR MDFEEFCAAA++VHQ E+LD WEQ  R AYE+F+K+
Sbjct  488  ATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAAINVHQHESLDCWEQSIRHAYELFDKN  547

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GF KLLHGVS R + K 
Sbjct  548  GNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFVKLLHGVSVRASGKT  604



>emb|CDX79956.1| BnaA05g02000D [Brassica napus]
Length=577

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  459  KTATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  576



>emb|CDP06189.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + STDAMK+SR+ ++++ ++ LQY++MDFEEFCAAA+SVHQLE ++ WEQHAR AYE+FE
Sbjct  459  RMSTDAMKDSRVLEYVSLVSCLQYKKMDFEEFCAAAISVHQLEGMESWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  576



>emb|CDY23873.1| BnaC04g01640D [Brassica napus]
Length=578

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDA K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  460  KTATDATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  520  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  577



>ref|XP_007028316.1| CDPK-related kinase 1 [Theobroma cacao]
 gb|EOY08818.1| CDPK-related kinase 1 [Theobroma cacao]
Length=576

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  ++ LQYR++DFEEFCAA++SVHQLE ++ WEQHAR AY++FE
Sbjct  458  KNSTDAMKDSRVLDYVNMISTLQYRKLDFEEFCAASISVHQLEGMETWEQHARRAYDLFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHG+SSRT  K
Sbjct  518  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGISSRTFQK  575



>ref|XP_006658886.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Oryza brachyantha]
Length=504

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  386  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQHARRAYELFD  445

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  446  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  503



>ref|XP_011000411.1| PREDICTED: CDPK-related kinase 7-like [Populus euphratica]
Length=578

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K+STDAMK+SR+ D++  +++LQYR++DFEEF A A+SVHQLE +D WEQHAR AYE+FE
Sbjct  460  KHSTDAMKDSRVLDYVNMISSLQYRKLDFEEFSAVAVSVHQLEGMDCWEQHARRAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  520  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  577



>ref|XP_002891522.1| hypothetical protein ARALYDRAFT_474093 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67781.1| hypothetical protein ARALYDRAFT_474093 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI +FLA LN LQYR MDFEEFCAAA++ HQ E+LD WEQ  R AYE+F+K+
Sbjct  490  ATEAMKESRIPEFLALLNGLQYRGMDFEEFCAAAINFHQHESLDCWEQSIRHAYELFDKN  549

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            GNRAIVIEELASELG+GPS+P+H+VLHDWIRHTDGKLSF GF KLLHGVS R +AK 
Sbjct  550  GNRAIVIEELASELGVGPSIPVHSVLHDWIRHTDGKLSFFGFVKLLHGVSVRPSAKT  606



>ref|XP_004958484.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Setaria italica]
Length=592

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  474  KNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  533

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  534  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  591



>ref|XP_008240668.1| PREDICTED: CDPK-related kinase 7 [Prunus mume]
Length=576

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STDAMK+SR+ D++  +++++YR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FEKD
Sbjct  460  STDAMKDSRVLDYVNMISSIRYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYELFEKD  519

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  520  GNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  575



>ref|NP_001169442.1| uncharacterized LOC100383313 [Zea mays]
 gb|ACN33785.1| unknown [Zea mays]
 tpg|DAA63857.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=592

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  474  KNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  533

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  534  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  591



>ref|XP_003562581.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Brachypodium distachyon]
Length=596

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  478  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  538  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  595



>dbj|BAK00699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=595

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  477  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  536

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  537  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  594



>gb|EEE59103.1| hypothetical protein OsJ_10960 [Oryza sativa Japonica Group]
Length=574

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  456  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQHARRAYELFD  515

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  516  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  573



>dbj|BAC16472.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
 dbj|BAD31271.1| putative calcium/calmodulin-dependent protein kinase CaMK [Oryza 
sativa Japonica Group]
Length=594

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  476  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQHARRAYELFD  535

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  536  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  593



>gb|EEC82532.1| hypothetical protein OsI_27055 [Oryza sativa Indica Group]
Length=591

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  473  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAVSVYQMEALETWEQHARRAYELFD  532

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  533  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  590



>gb|KHN42064.1| CDPK-related protein kinase [Glycine soja]
Length=654

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLASLNALQYRRMDF+EFCAAALSVHQLE LD+WEQ+ARCAY++FEKD
Sbjct  298  ATDAMKESRIPDFLASLNALQYRRMDFDEFCAAALSVHQLETLDQWEQNARCAYDLFEKD  357

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSF  437
            GN+AIVI+ELASELGLGPSVP+HAVLHDWIRHTDGKL++
Sbjct  358  GNKAIVIDELASELGLGPSVPVHAVLHDWIRHTDGKLTY  396



>ref|XP_010673049.1| PREDICTED: CDPK-related kinase 7-like [Beta vulgaris subsp. vulgaris]
Length=578

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + +TDAMK+SR  +++  ++++QYR+MDFEE+CAAA SVHQLEA+D WEQHAR AYE+FE
Sbjct  460  RIATDAMKDSRAMEYVNLVSSIQYRKMDFEEYCAAATSVHQLEAMDTWEQHARRAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  520  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  577



>gb|EYU20808.1| hypothetical protein MIMGU_mgv1a003516mg [Erythranthe guttata]
Length=580

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMKESR+ D++  +++LQYR++DFEE+CAAA+SVHQLE  + WEQHAR AYE+FE
Sbjct  462  KISTDAMKESRVVDYVNVVSSLQYRKLDFEEYCAAAISVHQLEGSEGWEQHARNAYELFE  521

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVS+RT  K
Sbjct  522  KNGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSARTFQK  579



>ref|XP_010542604.1| PREDICTED: CDPK-related kinase 1 [Tarenaya hassleriana]
Length=575

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ D++  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  457  KSSTEATKDSRVLDYVNMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  516

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  517  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLHK  574



>ref|XP_002463267.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
 gb|EER99788.1| hypothetical protein SORBIDRAFT_02g040850 [Sorghum bicolor]
Length=593

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AY++F+
Sbjct  475  KNSTDAMKDSRVVDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYDLFD  534

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  535  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  592



>gb|KDP27484.1| hypothetical protein JCGZ_20019 [Jatropha curcas]
Length=577

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            + STDA+K+SR+ D+++ +++LQYR+MDFEEFCAA++SVHQLE +D WEQHAR A+E+FE
Sbjct  459  RNSTDAVKDSRVLDYVSMVSSLQYRKMDFEEFCAASISVHQLEGMDCWEQHARRAFELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRAFQK  576



>ref|XP_009420969.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=576

 Score =   187 bits (475),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STD MK+S++ +F+  +++LQYR++DFEEF AAA+SVHQ+EALD WEQHAR  YE FE
Sbjct  458  KNSTDTMKDSKVLEFVNMVSSLQYRKLDFEEFAAAAISVHQMEALDTWEQHARQGYEFFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLS LGF KLLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSLLGFVKLLHGVSSRTIPK  575



>gb|EMT10573.1| Calcium/calmodulin-dependent serine/threonine-protein kinase 
1 [Aegilops tauschii]
Length=625

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+ ++  LQYR++DFEEF A+A+SV+Q+EAL+ WEQHAR AYE+F+
Sbjct  507  KNSTDAMKDSRVIDFVNTVCTLQYRKLDFEEFAASAISVYQMEALETWEQHARRAYELFD  566

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            K+GNR IVIEELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSR+  K
Sbjct  567  KEGNRPIVIEELASELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK  624



>ref|XP_010525467.1| PREDICTED: CDPK-related kinase 1-like [Tarenaya hassleriana]
Length=573

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ D++  +++LQY+++DFEEFCA+ALSV+QLEA++ WE+HAR AYE+FE
Sbjct  455  KSSTEAMKDSRVLDYVNMISSLQYKKLDFEEFCASALSVYQLEAMETWEEHARRAYELFE  514

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELA ELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  515  KDGNRPIMIEELAPELGLGPSVPVHIVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  572



>ref|XP_002522159.1| calcium-dependent protein kinase, putative [Ricinus communis]
 gb|EEF40200.1| calcium-dependent protein kinase, putative [Ricinus communis]
Length=512

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STDA K+SR+ D+++ +++LQYR++DFEEFCAA++SVHQLE +D WEQHAR AYE+FEKD
Sbjct  396  STDATKDSRVLDYVSMVSSLQYRKLDFEEFCAASISVHQLEGMDCWEQHARRAYELFEKD  455

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  456  GNRPIMIEELASELGLSTSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  511



>ref|XP_009371242.1| PREDICTED: CDPK-related kinase 7-like [Pyrus x bretschneideri]
Length=577

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STDAMK+SR+ D++  +++L+YR++DFEEFCA+A+SVHQLE ++ WEQHAR AYE+FEKD
Sbjct  461  STDAMKDSRVLDYVNMISSLRYRKLDFEEFCASAISVHQLEGMESWEQHARRAYELFEKD  520

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR+  K
Sbjct  521  GNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRSFQK  576



>ref|NP_191235.1| CDPK-related kinase 7 [Arabidopsis thaliana]
 sp|Q9LET1.1|CAMK7_ARATH RecName: Full=CDPK-related kinase 7; Short=AtCRK7; AltName: Full=Calcium/calmodulin-dependent 
protein kinase CRK7 [Arabidopsis 
thaliana]
 emb|CAC00739.1| calcium-dependent protein kinase-like [Arabidopsis thaliana]
 gb|AEE79562.1| CDPK-related kinase 7 [Arabidopsis thaliana]
Length=577

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE++E
Sbjct  459  KSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELYE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELA+ELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRVIMIEELATELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  576



>ref|XP_008798377.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KYST+AMK+SR+ DF + +++LQYR++DF+EF AAA+SV+Q+E L  WEQHAR AYE+FE
Sbjct  459  KYSTEAMKDSRVLDFASMVSSLQYRKLDFDEFAAAAISVYQMEGLHNWEQHARHAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGVSSR+  K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFVKLLHGVSSRSIPK  576



>ref|XP_008777902.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Phoenix dactylifera]
Length=577

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF+  +++LQYR++DFEEF AAA+SV+Q+E LD WEQHAR AYE+FE
Sbjct  459  KNSTDAMKDSRVLDFVNMVSSLQYRKLDFEEFAAAAISVYQMEGLDSWEQHARSAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGVSS +  K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFLKLLHGVSSCSIPK  576



>gb|EEC75325.1| hypothetical protein OsI_11701 [Oryza sativa Indica Group]
Length=596

 Score =   187 bits (474),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQHAR AYE F+
Sbjct  478  KNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFD  537

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSRT  K 
Sbjct  538  KEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT  596



>ref|NP_001050179.1| Os03g0366200 [Oryza sativa Japonica Group]
 dbj|BAF12093.1| Os03g0366200 [Oryza sativa Japonica Group]
Length=597

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQHAR AYE F+
Sbjct  479  KNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFD  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSRT  K 
Sbjct  539  KEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT  597



>ref|XP_010517599.1| PREDICTED: CDPK-related kinase 1 isoform X1 [Camelina sativa]
 ref|XP_010517600.1| PREDICTED: CDPK-related kinase 1 isoform X2 [Camelina sativa]
Length=571

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDA K+SR+ DF+  ++ LQY+++DFEEFCA+A+SV+QLEA+  WEQHAR AYE+FE
Sbjct  453  KSSTDATKDSRVLDFVHMISCLQYKKLDFEEFCASAISVYQLEAMATWEQHARRAYELFE  512

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  513  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRALQK  570



>sp|Q10KY3.1|CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent serine/threonine-protein 
kinase 1; AltName: Full=Calcium/calmodulin-binding serine/threonine-protein 
kinase; Short=CaM-binding protein kinase; 
AltName: Full=OsCBK [Oryza sativa Japonica Group]
 gb|ABF96128.1| CDPK-related protein kinase, putative, expressed [Oryza sativa 
Japonica Group]
Length=600

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQHAR AYE F+
Sbjct  482  KNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFD  541

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNR IVI+ELASELGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSRT  K 
Sbjct  542  KEGNRPIVIDELASELGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT  600



>ref|XP_009139075.1| PREDICTED: CDPK-related kinase 7-like [Brassica rapa]
Length=575

 Score =   186 bits (473),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SRI DF+  ++ LQY+R+DFEEFCA+A+SV+QLEA+  WEQHAR AYE+FE
Sbjct  457  KSSTEATKDSRILDFVDMISCLQYKRLDFEEFCASAISVYQLEAMGTWEQHARRAYELFE  516

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  517  KDGNRVIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRRLQK  574



>ref|XP_003554117.2| PREDICTED: CDPK-related kinase 1 [Glycine max]
Length=448

 Score =   184 bits (466),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FEK+
Sbjct  332  ATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYEMFEKE  391

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  392  GNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  447



>ref|XP_006402951.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
 gb|ESQ44404.1| hypothetical protein EUTSA_v10005861mg [Eutrema salsugineum]
Length=576

 Score =   186 bits (472),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  458  KSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  575



>ref|XP_010508754.1| PREDICTED: CDPK-related kinase 1-like [Camelina sativa]
Length=577

 Score =   186 bits (472),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDA K+SR+ D++  ++ LQY+++DFEEFCA+ALSV+QLEA+  WEQHAR AYE+FE
Sbjct  459  KSSTDATKDSRVLDYVHMISCLQYKKLDFEEFCASALSVYQLEAMATWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  519  KDGNRPIMIEELASELGLGPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRALQK  576



>ref|XP_003624963.1| Calcium-dependent protein kinase-like protein [Medicago truncatula]
 gb|ABD33022.1| Protein kinase; Calcium-binding EF-hand [Medicago truncatula]
 gb|AES81181.1| calmodulin-domain kinase CDPK protein [Medicago truncatula]
Length=595

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 100/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDA K+SR+ D+   ++++QYR++DFEEFCAAA+SVHQLE +D WEQHAR AYE+FEKD
Sbjct  479  ATDASKDSRVLDYANMVSSIQYRKLDFEEFCAAAISVHQLEGMDTWEQHARRAYELFEKD  538

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT
Sbjct  539  GNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRT  591



>ref|XP_002878106.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54365.1| hypothetical protein ARALYDRAFT_486115 [Arabidopsis lyrata subsp. 
lyrata]
Length=577

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF+  ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  459  KSSTEATKDSRVLDFVHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELA+ELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  519  KDGNRVIMIEELATELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  576



>ref|XP_002862200.1| hypothetical protein ARALYDRAFT_921091 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38458.1| hypothetical protein ARALYDRAFT_921091 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  299  ATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN  358

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            GNR IVIEELASELG+G S+P+H +LHDWIRHTDGKLSFLGF KLLHGVS+R
Sbjct  359  GNRVIVIEELASELGVGSSIPVHTILHDWIRHTDGKLSFLGFVKLLHGVSTR  410



>ref|XP_010907987.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like isoform X1 [Elaeis guineensis]
Length=577

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ DF++ +++LQYR++DFEEF AAA+SV+Q+E LD WE HAR AYE+FE
Sbjct  459  KNSTDAMKDSRVLDFVSMVSSLQYRKLDFEEFAAAAVSVYQMEGLDSWEHHARSAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGVSS +  K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPIHVVLQDWVRHSDGKLSFLGFLKLLHGVSSCSIPK  576



>ref|XP_004493390.1| PREDICTED: CDPK-related kinase 7-like [Cicer arietinum]
Length=593

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FEKD
Sbjct  477  ATDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYELFEKD  536

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRT  395
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT
Sbjct  537  GNRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRT  589



>ref|XP_006299075.1| hypothetical protein CARUB_v10015215mg [Capsella rubella]
 gb|EOA31973.1| hypothetical protein CARUB_v10015215mg [Capsella rubella]
Length=598

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/112 (77%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  480  ATDAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN  539

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            GNR IVIEELASELG+G S+P+H +LHDWIRHTDGKLSFLGF KLLHGVS+R
Sbjct  540  GNRVIVIEELASELGVGSSIPVHTILHDWIRHTDGKLSFLGFVKLLHGVSTR  591



>ref|XP_010909915.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Elaeis guineensis]
Length=577

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY T+AMK+SR+ DF   +++LQY ++DFEEF AAA+SV+Q+E LD WEQHAR AYE+FE
Sbjct  459  KYMTEAMKDSRVLDFANMVSSLQYGKLDFEEFAAAAISVYQMEGLDTWEQHARRAYELFE  518

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGVSSR+  K
Sbjct  519  KDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFVKLLHGVSSRSIQK  576



>ref|XP_008440252.1| PREDICTED: CDPK-related kinase 5 isoform X1 [Cucumis melo]
Length=605

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 97/117 (83%), Gaps = 1/117 (1%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLAS-LNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIF  563
            K  T+AMKESR  DFLAS LNALQ+RRMDFEEFCAA LSV QLE L  WEQ AR AYE F
Sbjct  486  KNGTEAMKESRTIDFLASQLNALQFRRMDFEEFCAATLSVRQLEDLGHWEQLARSAYEAF  545

Query  562  EKDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTA  392
            EKDGNRAI+IEELASELGL PS P+H+VL DWIRHTDGKLSFLGF KLLHG SSR  
Sbjct  546  EKDGNRAIMIEELASELGLSPSAPVHSVLQDWIRHTDGKLSFLGFVKLLHGPSSRAG  602



>ref|XP_009393900.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=577

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STD MK+SR+ DF   ++ALQYR++DFEEF AAA+SVHQ+E LD WEQHAR  YE FEKD
Sbjct  461  STDTMKDSRVLDFANVVSALQYRKLDFEEFAAAAISVHQMEVLDTWEQHARNGYEFFEKD  520

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELASELGL PSVP+H VL DWIRH+DGKLS LGF KLLHG SSRT  K
Sbjct  521  GNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSLLGFIKLLHGFSSRTIPK  576



>ref|XP_010909914.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Elaeis guineensis]
Length=601

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            KY T+AMK+SR+ DF   +++LQY ++DFEEF AAA+SV+Q+E LD WEQHAR AYE+FE
Sbjct  483  KYMTEAMKDSRVLDFANMVSSLQYGKLDFEEFAAAAISVYQMEGLDTWEQHARRAYELFE  542

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DW+RH+DGKLSFLGF KLLHGVSSR+  K
Sbjct  543  KDGNRPIMIEELASELGLSPSVPVHVVLQDWVRHSDGKLSFLGFVKLLHGVSSRSIQK  600



>ref|XP_010466044.1| PREDICTED: CDPK-related kinase 2-like [Camelina sativa]
Length=605

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  487  ATDAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN  546

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTA  392
            GNR IVIEELASELG+G S+P+H +LHDWIRHTDGKLSFLGF KLLHGVS+R A
Sbjct  547  GNRVIVIEELASELGVGSSMPVHTILHDWIRHTDGKLSFLGFVKLLHGVSTRQA  600



>ref|XP_010427515.1| PREDICTED: CDPK-related kinase 7-like isoform X2 [Camelina sativa]
Length=584

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  465  KSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  524

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  525  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  582



>ref|XP_006290768.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
 gb|EOA23666.1| hypothetical protein CARUB_v10016875mg [Capsella rubella]
Length=568

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  450  KSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  509

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  510  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  567



>ref|XP_010507434.1| PREDICTED: CDPK-related kinase 2 [Camelina sativa]
Length=601

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +TDAMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  483  ATDAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN  542

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTA  392
            GNR IVIEELASELG+G S+P+H +LHDWIRHTDGKLSFLGF KLLHG+S+R A
Sbjct  543  GNRVIVIEELASELGVGSSMPVHTILHDWIRHTDGKLSFLGFVKLLHGISTRQA  596



>gb|KFK35999.1| hypothetical protein AALP_AA4G064700 [Arabis alpina]
Length=601

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI +FLA LN LQ++ MDFEEFCAAAL+VHQ E+LD WEQ  R AYE+F+K+
Sbjct  483  ATEAMKESRIPEFLALLNGLQHKGMDFEEFCAAALNVHQHESLDCWEQSVRHAYELFDKN  542

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            GNRAIVIEELASELG+GPS+ +H++LHDWIRHTDGKLSF GF KLLHGVS+R++ K 
Sbjct  543  GNRAIVIEELASELGVGPSITVHSILHDWIRHTDGKLSFFGFVKLLHGVSTRSSVKT  599



>ref|XP_002322616.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
 gb|EEF04377.1| CDPK-related kinase 1 family protein [Populus trichocarpa]
Length=578

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K+STDAMK+SR+ D++  ++ LQYR++DFEEF A A+SVHQLE +D WEQHAR AYE+FE
Sbjct  460  KHSTDAMKDSRVLDYVNMISTLQYRKLDFEEFSAVAISVHQLEGMDCWEQHARRAYELFE  519

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  520  KDGNRPIMIEELASELGLSRSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  577



>ref|XP_010516279.1| PREDICTED: CDPK-related kinase 7 [Camelina sativa]
Length=582

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+A+SV+QLEA++ WEQHAR AYE+FE
Sbjct  463  KSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASAISVYQLEAMETWEQHARRAYELFE  522

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  523  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  580



>ref|XP_010427514.1| PREDICTED: CDPK-related kinase 7-like isoform X1 [Camelina sativa]
Length=611

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  492  KSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMETWEQHARRAYELFE  551

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  552  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  609



>ref|XP_010504583.1| PREDICTED: CDPK-related kinase 7-like [Camelina sativa]
Length=582

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+A K+SR+ DF   ++ LQY+++DFEEFCA+ALSV+QLEA++ WEQHAR AYE+FE
Sbjct  463  KSSTEATKDSRVLDFAHMISCLQYKKLDFEEFCASALSVYQLEAMEIWEQHARRAYELFE  522

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGLGPSVP+  VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  523  KDGNRVIMIEELASELGLGPSVPVQVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTLQK  580



>gb|AAK54157.1|AF368282_1 CaMK1 [Oryza sativa]
Length=597

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K ST+AMK+SR+ DF+ +++ +QYR++DFEEF AAA+SV+Q+E L+ WEQHAR AYE F+
Sbjct  479  KNSTNAMKDSRVVDFVNTISNIQYRKLDFEEFSAAAISVYQMEGLETWEQHARQAYEFFD  538

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAKV  383
            K+GNR IVI+ELAS LGLGPSVPLH VL DWIRH DGKLSFLGF KLLHGVSSRT  K 
Sbjct  539  KEGNRPIVIDELASGLGLGPSVPLHVVLQDWIRHPDGKLSFLGFMKLLHGVSSRTIPKT  597



>ref|XP_011075448.1| PREDICTED: CDPK-related kinase 1 [Sesamum indicum]
Length=579

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K +TDAMK+SR+ D++  +++LQ+R+MDFEEFC+AA+SVHQLE ++ WEQHAR AY+ FE
Sbjct  461  KNATDAMKDSRVLDYVNVVSSLQHRKMDFEEFCSAAISVHQLEGMESWEQHARRAYDFFE  520

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHG+SSR   K
Sbjct  521  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGISSRAFQK  578



>gb|KJB35809.1| hypothetical protein B456_006G129900 [Gossypium raimondii]
Length=576

 Score =   183 bits (465),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDAMK+SR+ D++  ++++QYR++DFEEFCA+A+SVHQLE ++ WEQHAR AY++F+
Sbjct  458  KNSTDAMKDSRVLDYVNMISSIQYRKLDFEEFCASAVSVHQLEGMETWEQHARRAYDLFD  517

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL  SVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  518  KDGNRPIMIEELASELGLSSSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  575



>ref|XP_007163947.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
 gb|ESW35941.1| hypothetical protein PHAVU_L003400g [Phaseolus vulgaris]
Length=580

 Score =   183 bits (465),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = -2

Query  730  TDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKDG  551
            TDA K+SR+ D++  ++++QYR++DFEEFCAAA+SVHQLE ++ WEQHAR AYE+FEK+G
Sbjct  465  TDASKDSRVLDYVNMVSSIQYRKLDFEEFCAAAISVHQLEGMESWEQHARRAYELFEKEG  524

Query  550  NRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            NR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSRT  K
Sbjct  525  NRPIMIEELASELGLSPSVPIHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRTFQK  579



>ref|XP_008464947.1| PREDICTED: CDPK-related kinase 1-like isoform X3 [Cucumis melo]
Length=447

 Score =   181 bits (458),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -2

Query  739  KYSTDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFE  560
            K STDA+K+SR+ D+   ++++QYR++DFEEFCAAA+S++QLE ++ WEQHAR AY++F+
Sbjct  329  KNSTDAIKDSRVLDYANVVSSIQYRKLDFEEFCAAAISIYQLEGMENWEQHARHAYDLFD  388

Query  559  KDGNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            KDGNR I+IEELASELGL PSVP+H VL DWIRH+DGKLSFLGF +LLHGVSSR   K
Sbjct  389  KDGNRPIMIEELASELGLSPSVPVHVVLQDWIRHSDGKLSFLGFVRLLHGVSSRAFQK  446



>ref|XP_009405856.1| PREDICTED: calcium/calmodulin-dependent serine/threonine-protein 
kinase 1-like [Musa acuminata subsp. malaccensis]
Length=573

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 98/116 (84%), Gaps = 0/116 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            STDAMK+S I DF+  +++LQYR++DFEEF AAA+SVHQ+EALD WEQHAR  YE FEKD
Sbjct  457  STDAMKDSGILDFVNMVSSLQYRKLDFEEFAAAAISVHQMEALDAWEQHARHGYEFFEKD  516

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSRTAAK  386
            GNR I+IEELAS+LGL PSVP+H VL DWIRH+DGKLS LGF KLLHG SSRT  K
Sbjct  517  GNRPIMIEELASDLGLSPSVPVHVVLQDWIRHSDGKLSLLGFVKLLHGFSSRTIPK  572



>ref|XP_002883163.1| hypothetical protein ARALYDRAFT_898284 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59422.1| hypothetical protein ARALYDRAFT_898284 [Arabidopsis lyrata subsp. 
lyrata]
Length=600

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  482  ATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSIRHAYELFEMN  541

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            GNR IVIEELASELG+G S+P+H +LHDWIRHTDGKLSFLGF KLLHGVS+R
Sbjct  542  GNRVIVIEELASELGVGSSIPVHTILHDWIRHTDGKLSFLGFVKLLHGVSTR  593



>ref|XP_009112142.1| PREDICTED: CDPK-related kinase 2 [Brassica rapa]
Length=594

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/112 (76%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -2

Query  733  STDAMKESRIHDFLASLNALQYRRMDFEEFCAAALSVHQLEALDRWEQHARCAYEIFEKD  554
            +T+AMKESRI DFLA LN LQY+ MDFEEFCAA++SVHQ E+LD WEQ  R AYE+FE +
Sbjct  476  ATEAMKESRIPDFLALLNGLQYKGMDFEEFCAASISVHQHESLDCWEQSVRHAYELFEMN  535

Query  553  GNRAIVIEELASELGLGPSVPLHAVLHDWIRHTDGKLSFLGFAKLLHGVSSR  398
            GNR IVIEELASELG+G SVP+H +LHDWIRH+DGKLSFLGF KLLHGVS+R
Sbjct  536  GNRVIVIEELASELGVGSSVPVHTILHDWIRHSDGKLSFLGFVKLLHGVSTR  587



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1494411655520