BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031C12

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHM93474.1|  alpha-tubulin                                           267   3e-91   Camellia chekiangoleosa
gb|KJB58759.1|  hypothetical protein B456_009G224800                    266   5e-91   Gossypium raimondii
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              267   5e-91   Solanum lycopersicum
gb|ABB02631.1|  unknown                                                 267   5e-91   Solanum tuberosum [potatoes]
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              267   5e-91   Nicotiana tomentosiformis
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     267   5e-91   Nicotiana sylvestris
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   267   5e-91   Nicotiana tomentosiformis
emb|CAD13176.1|  alpha-tubulin                                          267   5e-91   Nicotiana tabacum [American tobacco]
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              267   6e-91   
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     267   6e-91   Nicotiana tomentosiformis
gb|ACH68563.1|  alpha-tubulin                                           267   6e-91   Solanum tuberosum [potatoes]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     267   6e-91   
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                267   6e-91   Solanum tuberosum [potatoes]
ref|NP_001275271.1|  alpha-tubulin-like protein                         267   7e-91   Solanum tuberosum [potatoes]
gb|ABP65320.1|  alpha tubulin                                           267   8e-91   Capsicum annuum
gb|EPS62716.1|  alpha-tubulin                                           266   9e-91   Genlisea aurea
ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              266   9e-91   Solanum lycopersicum
gb|KJB32211.1|  hypothetical protein B456_005G229600                    265   1e-90   Gossypium raimondii
gb|KJB58756.1|  hypothetical protein B456_009G224800                    266   1e-90   Gossypium raimondii
gb|ABC59068.2|  alpha tubulin 1                                         266   1e-90   Camellia sinensis [black tea]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       265   1e-90   Cucumis sativus [cucumbers]
ref|WP_039310890.1|  hypothetical protein                               266   1e-90   
emb|CAJ38386.1|  alpha tubulin                                          265   1e-90   Plantago major [cart-track plant]
dbj|BAB19779.1|  alpha tubulin                                          267   2e-90   Nicotiana tabacum [American tobacco]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                265   2e-90   Erythranthe guttata [common monkey flower]
gb|ADW83724.1|  alpha-tubulin                                           265   2e-90   Musa acuminata AAA Group [Cavendish banana]
gb|AAW57305.1|  alpha-tubulin                                           264   3e-90   Ceratopteris richardii
ref|XP_010099392.1|  Tubulin alpha chain                                265   3e-90   
ref|XP_003608582.1|  Tubulin alpha-5 chain                              265   3e-90   Medicago truncatula
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             265   3e-90   Citrus clementina [clementine]
ref|XP_010093625.1|  Tubulin alpha chain                                265   3e-90   Morus notabilis
ref|NP_001291325.1|  tubulin alpha chain-like                           265   3e-90   Sesamum indicum [beniseed]
emb|CDP02221.1|  unnamed protein product                                265   3e-90   Coffea canephora [robusta coffee]
ref|NP_001289660.1|  tubulin alpha chain-like                           265   3e-90   Eucalyptus grandis [rose gum]
gb|ACN40181.1|  unknown                                                 265   3e-90   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     265   3e-90   Vitis vinifera
gb|KHG18997.1|  Tubulin alpha chain                                     265   3e-90   Gossypium arboreum [tree cotton]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    265   3e-90   Gossypium hirsutum [American cotton]
gb|ABO47736.1|  alpha-tubulin                                           265   3e-90   Gossypium hirsutum [American cotton]
gb|ABO47740.1|  alpha-tubulin                                           265   3e-90   Gossypium hirsutum [American cotton]
gb|AAV92352.1|  alpha tubulin 1                                         265   3e-90   Pseudotsuga menziesii var. menziesii
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Elaeis guineensis
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Tarenaya hassleriana [spider flower]
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   265   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                265   3e-90   Vitis vinifera
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             265   3e-90   Citrus clementina [clementine]
ref|XP_007018369.1|  Tubulin alpha-2 chain                              265   3e-90   Theobroma cacao [chocolate]
gb|AID52921.1|  tubulin alpha chain                                     265   3e-90   Carthamus tinctorius
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        265   3e-90   Cucumis melo [Oriental melon]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     265   3e-90   Sesamum indicum [beniseed]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Tarenaya hassleriana [spider flower]
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          265   3e-90   Tarenaya hassleriana [spider flower]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         265   3e-90   Jatropha curcas
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         265   3e-90   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           265   3e-90   Betula pendula [white birch]
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             265   3e-90   Prunus persica
ref|XP_002522104.1|  tubulin alpha chain, putative                      265   3e-90   Ricinus communis
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     265   3e-90   Phoenix dactylifera
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   264   3e-90   Fragaria vesca subsp. vesca
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Phoenix dactylifera
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                265   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_002510010.1|  tubulin alpha chain, putative                      265   3e-90   Ricinus communis
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              265   3e-90   Cucumis sativus [cucumbers]
ref|XP_001764722.1|  predicted protein                                  265   3e-90   
gb|ABX57816.1|  alpha tubulin                                           265   3e-90   Picea wilsonii
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                264   3e-90   Elaeis guineensis
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    264   3e-90   Citrus sinensis [apfelsine]
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     265   3e-90   Fragaria vesca subsp. vesca
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     265   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        265   4e-90   Glycine max [soybeans]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     264   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             265   4e-90   Prunus persica
ref|XP_007032501.1|  Tubulin alpha-2 chain                              265   4e-90   
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                264   4e-90   Cucumis sativus [cucumbers]
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         264   4e-90   Jatropha curcas
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             264   4e-90   Populus trichocarpa [western balsam poplar]
gb|AGG37283.1|  alpha-tubulin 1                                         264   4e-90   Salix arbutifolia
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          265   4e-90   Malus domestica [apple tree]
gb|ABO47739.1|  alpha-tubulin                                           264   4e-90   Gossypium hirsutum [American cotton]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                265   4e-90   Prunus dulcis [sweet almond]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     264   4e-90   Cucumis melo [Oriental melon]
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     264   4e-90   Eucalyptus grandis [rose gum]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     264   4e-90   Vitis vinifera
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   264   4e-90   Citrus sinensis [apfelsine]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                264   4e-90   Cicer arietinum [garbanzo]
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               264   4e-90   Pisum sativum [garden pea]
gb|AIX10966.1|  tubulin                                                 264   4e-90   Ornithogalum longebracteatum [sea-onion]
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             264   4e-90   Phaseolus vulgaris [French bean]
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             264   4e-90   Selaginella moellendorffii
ref|XP_003603670.1|  Tubulin alpha-7 chain                              264   4e-90   Medicago truncatula
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                264   4e-90   Elaeis guineensis
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                265   4e-90   Nelumbo nucifera [Indian lotus]
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                265   4e-90   Solanum lycopersicum
emb|CAN62392.1|  hypothetical protein VITISV_016172                     264   4e-90   Vitis vinifera
gb|KHN08201.1|  Tubulin alpha chain                                     264   5e-90   Glycine soja [wild soybean]
ref|XP_007042689.1|  Tubulin alpha-2 chain                              264   5e-90   Theobroma cacao [chocolate]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                264   5e-90   Erythranthe guttata [common monkey flower]
gb|AIX10773.1|  alpha tubulin                                           264   5e-90   Panax notoginseng [san-qi]
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                264   6e-90   Nicotiana tomentosiformis
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             263   6e-90   Anemia phyllitidis
gb|AEQ75493.1|  alpha-tubulin                                           263   6e-90   Rosa multiflora [Japanese rose]
gb|ACK76232.1|  alpha-tubulin                                           263   6e-90   Dimocarpus longan [longan]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             263   7e-90   
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   263   7e-90   Citrus sinensis [apfelsine]
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                263   7e-90   Fragaria vesca subsp. vesca
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     263   7e-90   Populus euphratica
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             263   7e-90   Eutrema salsugineum [saltwater cress]
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                263   7e-90   Phoenix dactylifera
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             263   7e-90   Prunus persica
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    263   7e-90   
gb|ABK92520.1|  unknown                                                 263   7e-90   Populus trichocarpa [western balsam poplar]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 263   8e-90   Populus trichocarpa [western balsam poplar]
gb|AGG37289.1|  alpha-tubulin 7                                         263   8e-90   Salix arbutifolia
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              263   8e-90   Fragaria vesca subsp. vesca
gb|AGG37285.1|  alpha-tubulin 3                                         263   8e-90   Salix arbutifolia
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   263   8e-90   Populus euphratica
gb|ABQ59633.1|  alpha-tubulin 3                                         263   9e-90   Populus tremuloides
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             263   9e-90   Prunus persica
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   263   9e-90   Citrus sinensis [apfelsine]
ref|XP_002517492.1|  tubulin alpha chain, putative                      263   9e-90   Ricinus communis
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   263   9e-90   Malus domestica [apple tree]
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               263   9e-90   Erythranthe guttata [common monkey flower]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              263   9e-90   
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        263   1e-89   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAB76917.1|  alpha-tubulin 4                                        262   1e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAW57309.1|  alpha-tubulin                                           265   1e-89   Ceratopteris richardii
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          263   1e-89   Citrus sinensis [apfelsine]
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              263   1e-89   Populus euphratica
gb|AAW57310.1|  alpha-tubulin                                           265   1e-89   Ceratopteris richardii
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                263   1e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAO73546.1|  alpha-tubulin                                           263   1e-89   Ceratopteris richardii
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   263   1e-89   Citrus sinensis [apfelsine]
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     263   1e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010104543.1|  Tubulin alpha chain                                263   1e-89   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    263   1e-89   Gossypium hirsutum [American cotton]
emb|CCA24429.1|  splicing factor putative                               256   1e-89   Albugo laibachii Nc14
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   264   1e-89   Monoraphidium neglectum
gb|KHN42598.1|  Tubulin alpha-2 chain                                   262   1e-89   Glycine soja [wild soybean]
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    263   1e-89   Gossypium hirsutum [American cotton]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             263   1e-89   Phaseolus vulgaris [French bean]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    264   1e-89   Glycine max [soybeans]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              262   1e-89   Glycine max [soybeans]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    262   1e-89   Glycine max [soybeans]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             262   1e-89   
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     264   1e-89   Glycine max [soybeans]
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            262   1e-89   
gb|AFR42026.1|  alpha-tubulin                                           263   1e-89   Populus trichocarpa [western balsam poplar]
gb|KEH43997.1|  tubulin beta-1 chain                                    264   2e-89   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                264   2e-89   Cicer arietinum [garbanzo]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   265   2e-89   Vitis vinifera
gb|AFR42020.1|  alpha-tubulin                                           263   2e-89   Populus trichocarpa [western balsam poplar]
emb|CAB66336.1|  alpha-tubulin                                          265   2e-89   Betula pendula [white birch]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                262   2e-89   Cucumis sativus [cucumbers]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             262   2e-89   Selaginella moellendorffii
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             264   2e-89   Phaseolus vulgaris [French bean]
gb|AFR42035.1|  alpha-tubulin                                           262   2e-89   Populus alba [abele]
gb|AFR42049.1|  alpha-tubulin                                           262   2e-89   Populus fremontii
gb|AFR42036.1|  alpha-tubulin                                           262   2e-89   Populus alba [abele]
dbj|BAC24800.1|  alpha tubulin                                          265   2e-89   Physcomitrella patens
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             262   2e-89   Capsella rubella
gb|ABD92937.1|  alpha tubulin-4A                                        262   2e-89   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        262   2e-89   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ06364.1|  alpha-tubulin                                          261   2e-89   Alopecurus aequalis
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              261   2e-89   Brachypodium distachyon [annual false brome]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             265   2e-89   Populus trichocarpa [western balsam poplar]
gb|ABQ59634.1|  alpha-tubulin 5                                         265   2e-89   Populus tremuloides
gb|AFR42042.1|  alpha-tubulin                                           262   2e-89   Populus fremontii
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     262   2e-89   Sesamum indicum [beniseed]
gb|AFR42054.1|  alpha-tubulin                                           262   2e-89   Populus fremontii
gb|AFR42047.1|  alpha-tubulin                                           262   2e-89   Populus fremontii
dbj|BAP59012.1|  alpha tubulin                                          265   3e-89   Taxus cuspidata [ichii]
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                265   3e-89   Populus euphratica
ref|XP_010096739.1|  Tubulin alpha chain                                261   3e-89   
gb|AHJ80823.1|  Tua1                                                    261   3e-89   Eragrostis tef [tef]
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                261   3e-89   Eucalyptus grandis [rose gum]
gb|AGG37287.1|  alpha-tubulin 5                                         265   3e-89   Salix arbutifolia
emb|CAA06619.1|  alpha-tubulin 1                                        261   3e-89   Eleusine indica [crabgrass]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              261   3e-89   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   261   3e-89   Zea mays [maize]
gb|AHJ80817.1|  Tua1                                                    261   3e-89   Eragrostis tef [tef]
ref|XP_007515802.1|  alpha-tubulin                                      262   3e-89   Bathycoccus prasinos
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    261   3e-89   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          261   3e-89   Miscanthus sinensis
gb|AEW46684.1|  beta-tubulin                                            262   3e-89   Ulva linza
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              261   3e-89   Setaria italica
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                261   3e-89   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHJ80815.1|  Tua1                                                    261   3e-89   Eragrostis tef [tef]
ref|NP_001167663.1|  tubulin alpha-3 chain                              261   4e-89   Zea mays [maize]
dbj|BAJ06362.1|  alpha-tubulin                                          261   4e-89   Alopecurus aequalis
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   261   4e-89   Brachypodium distachyon [annual false brome]
tpg|DAA51109.1|  TPA: alpha tubulin                                     261   4e-89   
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          261   4e-89   
gb|KHG20487.1|  Tubulin alpha chain                                     261   4e-89   Gossypium arboreum [tree cotton]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             261   4e-89   Hordeum vulgare [barley]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              261   4e-89   Oryza brachyantha
emb|CDO97305.1|  unnamed protein product                                261   4e-89   Coffea canephora [robusta coffee]
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   261   5e-89   Beta vulgaris subsp. vulgaris [field beet]
gb|ABO47742.1|  alpha-tubulin                                           260   6e-89   Gossypium hirsutum [American cotton]
gb|AAB08791.1|  alpha tubulin                                           260   6e-89   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            262   6e-89   Oryza sativa Japonica Group [Japonica rice]
gb|ABV55999.1|  alpha-tubulin 7                                         260   6e-89   Populus tremuloides
gb|AAB36609.1|  alpha-tubulin                                           260   6e-89   Eucalyptus globulus subsp. bicostata
gb|AHJ80819.1|  Tua1                                                    260   6e-89   Eragrostis tef [tef]
gb|ABD92930.1|  alpha tubulin-2A                                        260   7e-89   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              260   7e-89   Oryza brachyantha
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                260   7e-89   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             260   7e-89   Hordeum vulgare [barley]
ref|XP_005851144.1|  alpha-tubulin                                      261   7e-89   Chlorella variabilis
gb|AHZ58481.1|  alpha-tubulin                                           260   8e-89   Syntrichia caninervis
ref|XP_008815298.1|  hypothetical protein C922_01473                    262   8e-89   Plasmodium inui San Antonio 1
gb|ABK92552.1|  unknown                                                 263   8e-89   Populus trichocarpa [western balsam poplar]
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              260   8e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              260   8e-89   Oryza brachyantha
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    259   9e-89   Arabis alpina [alpine rockcress]
dbj|BAH19954.1|  AT1G50010                                              259   9e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AFW67748.1|  alpha tubulin4                                          260   9e-89   
ref|NP_171974.1|  tubulin alpha-4 chain                                 259   1e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66630.1|  BnaCnng51680D                                          259   1e-88   Brassica napus [oilseed rape]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          259   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   259   1e-88   Brassica rapa
gb|KIZ03400.1|  Tubulin alpha chain                                     260   1e-88   Monoraphidium neglectum
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    262   1e-88   Tarenaya hassleriana [spider flower]
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        259   1e-88   Camelina sativa [gold-of-pleasure]
gb|KIY91712.1|  Tubulin alpha chain                                     260   1e-88   Monoraphidium neglectum
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             259   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193232.1|  tubulin alpha-6 chain                                 259   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008625876.1|  hypothetical protein YYE_04011                     262   1e-88   Plasmodium vinckei vinckei
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     260   1e-88   Helicosporidium sp. ATCC 50920
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              259   1e-88   
emb|CDY29334.1|  BnaA05g16010D                                          259   1e-88   Brassica napus [oilseed rape]
ref|XP_011398411.1|  Tubulin alpha chain                                260   1e-88   Auxenochlorella protothecoides
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    259   1e-88   Brassica rapa
ref|XP_002508010.1|  alpha tubulin 2                                    260   1e-88   Micromonas commoda
gb|AFW67749.1|  alpha tubulin4                                          259   1e-88   
dbj|BAG99724.1|  unnamed protein product                                258   2e-88   Oryza sativa Japonica Group [Japonica rice]
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              258   2e-88   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005651460.1|  tubulin alpha chain                                259   2e-88   Coccomyxa subellipsoidea C-169
gb|KJB29387.1|  hypothetical protein B456_005G097800                    258   2e-88   Gossypium raimondii
ref|XP_003058621.1|  alpha tubulin                                      259   2e-88   Micromonas pusilla CCMP1545
ref|XP_005643073.1|  tubulin alpha chain                                259   2e-88   Coccomyxa subellipsoidea C-169
gb|AAT09063.1|  alpha tubulin 1                                         258   2e-88   Bigelowiella natans
emb|CAA52158.1|  alpha tubulin                                          261   2e-88   Zea mays [maize]
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                259   2e-88   
ref|XP_001770881.1|  predicted protein                                  259   2e-88   
gb|EJY81124.1|  Alpha tubulin,putative                                  258   3e-88   Oxytricha trifallax
gb|AAW57306.1|  alpha-tubulin                                           260   3e-88   Ceratopteris richardii
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  259   3e-88   Brassica napus [oilseed rape]
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              258   3e-88   Camelina sativa [gold-of-pleasure]
emb|CDW82295.1|  alpha tubulin                                          258   3e-88   Stylonychia lemnae
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                258   3e-88   Oxytricha granulifera
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  259   4e-88   Ostreococcus tauri
emb|CAA62916.1|  alpha-tubulin                                          258   4e-88   Oryza sativa Japonica Group [Japonica rice]
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 258   4e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CDP12358.1|  unnamed protein product                                258   5e-88   Coffea canephora [robusta coffee]
ref|XP_001419217.1|  predicted protein                                  258   5e-88   Ostreococcus lucimarinus CCE9901
gb|ABU93324.1|  tubulin alpha subunit                                   257   5e-88   Monocercomonoides sp. PA
ref|NP_001051132.1|  Os03g0726100                                       257   5e-88   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           257   5e-88   Stentor coeruleus
gb|AIA82435.1|  alpha-tubulin-like protein 03                           257   5e-88   Stentor coeruleus
ref|XP_001777110.1|  predicted protein                                  257   5e-88   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                260   6e-88   Daucus carota [carrots]
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             260   6e-88   Citrus clementina [clementine]
ref|XP_008621874.1|  tubulin alpha                                      256   6e-88   Saprolegnia diclina VS20
gb|ETM52928.1|  tubulin alpha chain                                     256   6e-88   Phytophthora parasitica
gb|ABU93323.1|  tubulin alpha subunit                                   257   6e-88   Monocercomonoides sp. PA
ref|XP_002951007.1|  alpha tubulin                                      259   6e-88   Volvox carteri f. nagariensis
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              256   7e-88   Phoenix dactylifera
gb|ACN40824.1|  unknown                                                 256   7e-88   Picea sitchensis
ref|XP_007512064.1|  alpha-tubulin                                      258   7e-88   Bathycoccus prasinos
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   256   8e-88   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              256   8e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABO47737.1|  alpha-tubulin                                           258   8e-88   Gossypium hirsutum [American cotton]
gb|AIA82436.1|  alpha-tubulin-like protein 04                           256   8e-88   Stentor coeruleus
ref|NP_001067613.1|  Os11g0247300                                       261   8e-88   
gb|ABG78593.1|  alpha-tubulin                                           261   9e-88   Oryza sativa Japonica Group [Japonica rice]
gb|AEG74028.1|  alpha-tubulin                                           256   9e-88   Apopellia endiviifolia (species B)
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   256   1e-87   Vitis vinifera
gb|AAT09064.1|  alpha tubulin 2                                         256   1e-87   Bigelowiella natans
ref|XP_001777081.1|  predicted protein                                  256   1e-87   
gb|ABL61201.1|  alpha-tubulin                                           258   1e-87   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          256   1e-87   
emb|CAD20821.1|  alpha tubulin                                          255   1e-87   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   256   1e-87   
gb|AFK33477.1|  unknown                                                 260   1e-87   
gb|ABL61216.1|  alpha-tubulin                                           258   1e-87   
ref|XP_001782790.1|  predicted protein                                  256   1e-87   
emb|CDP17586.1|  unnamed protein product                                256   1e-87   
gb|AHJ80821.1|  Tua3                                                    256   1e-87   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           255   1e-87   
gb|EPR58771.1|  alpha tubulin TUBA1                                     257   1e-87   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             256   1e-87   
gb|ABB16994.1|  unknown                                                 256   1e-87   
emb|CDJ60085.1|  tubulin alpha chain, putative                          257   1e-87   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             256   1e-87   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             256   1e-87   
ref|XP_002675196.1|  alpha-tubulin                                      255   1e-87   
gb|ABL61224.1|  alpha-tubulin                                           258   1e-87   
gb|ETM30643.1|  tubulin alpha chain                                     255   1e-87   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              256   1e-87   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                256   1e-87   
ref|XP_002959708.1|  alpha tubulin                                      259   1e-87   
ref|XP_001691876.1|  alpha tubulin 1                                    258   1e-87   
gb|AEF79970.1|  alpha-tubulin protein                                   258   1e-87   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             256   1e-87   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    256   1e-87   
emb|CCI41153.1|  unnamed protein product                                255   1e-87   
ref|XP_008900864.1|  tubulin alpha chain                                255   1e-87   
gb|ABL61215.1|  alpha-tubulin                                           258   1e-87   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             255   2e-87   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    256   2e-87   
gb|ABP65323.1|  alpha tubulin                                           255   2e-87   
ref|XP_002904195.1|  alpha-tubulin, putative                            255   2e-87   
gb|ABL61212.1|  alpha-tubulin                                           258   2e-87   
gb|KHN01709.1|  Tubulin alpha chain                                     256   2e-87   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             256   2e-87   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             256   2e-87   
ref|XP_008872990.1|  tubulin alpha chain                                255   2e-87   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             256   2e-87   
ref|XP_002904194.1|  alpha-tubulin                                      255   2e-87   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 257   2e-87   
gb|ETO82054.1|  tubulin alpha chain                                     255   2e-87   
emb|CDJ42547.1|  tubulin alpha chain, putative                          257   2e-87   
emb|CDJ53173.1|  tubulin alpha chain, putative                          257   2e-87   
emb|CDI81818.1|  tubulin alpha chain, putative                          257   2e-87   
ref|XP_002364807.1|  tubulin alpha chain                                257   2e-87   
gb|ADP08782.1|  alpha tubulin                                           257   2e-87   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              255   2e-87   
gb|AAZ23863.1|  alpha-tubulin                                           254   2e-87   
ref|XP_009842456.1|  tubulin alpha chain                                255   2e-87   
dbj|BAJ06363.1|  alpha-tubulin                                          255   2e-87   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   255   2e-87   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                256   2e-87   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     255   2e-87   
gb|ETM52951.1|  tubulin alpha chain                                     255   2e-87   
emb|CAD26886.1|  alpha-tubulin                                          254   2e-87   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              255   2e-87   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   255   2e-87   
gb|AGY80453.1|  tubulin                                                 255   2e-87   
gb|ABD92942.1|  alpha tubulin-1D                                        255   2e-87   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   255   2e-87   
gb|ABR25378.1|  tubulin alpha 3 chain                                   259   2e-87   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             255   2e-87   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             255   2e-87   
gb|AAO46127.1|  alpha-tubulin                                           254   2e-87   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   255   2e-87   
ref|XP_009833023.1|  tubulin alpha chain                                249   2e-87   
gb|ACU20294.1|  unknown                                                 256   2e-87   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     254   2e-87   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     254   2e-87   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   255   2e-87   
ref|NP_001105588.1|  tubulin alpha-6 chain                              254   2e-87   
ref|NP_001105324.1|  tubulin alpha-5 chain                              254   2e-87   
gb|ABL61209.1|  alpha-tubulin                                           258   3e-87   
ref|NP_001060075.1|  Os07g0574800                                       255   3e-87   
gb|AHJ80820.1|  Tua3                                                    254   3e-87   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   254   3e-87   
gb|ABL61205.1|  alpha-tubulin                                           258   3e-87   
gb|AAD11425.1|  alpha tubulin                                           254   3e-87   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              254   3e-87   
emb|CAD26891.1|  alpha-tubulin                                          254   3e-87   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    255   3e-87   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    256   3e-87   
emb|CAD24765.1|  alpha-tubulin                                          254   3e-87   
gb|ABL61206.1|  alpha-tubulin                                           258   3e-87   
gb|AGG37284.1|  alpha-tubulin 2                                         254   3e-87   
gb|ABL61208.1|  alpha-tubulin                                           258   3e-87   
gb|ABO47735.1|  alpha-tubulin                                           256   3e-87   
gb|AGD80034.1|  alpha-tubulin 1                                         254   3e-87   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              254   3e-87   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              254   3e-87   
ref|XP_002532068.1|  tubulin alpha chain, putative                      254   3e-87   
emb|CAA62917.1|  alfa-tubulin                                           259   3e-87   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   256   3e-87   
gb|ABL61210.1|  alpha-tubulin                                           258   3e-87   
gb|ABR25510.1|  tubulin alpha-1 chain                                   254   3e-87   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             254   3e-87   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              254   3e-87   
gb|ABO47741.1|  alpha-tubulin                                           256   3e-87   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              254   3e-87   
gb|ABU93321.1|  tubulin alpha subunit                                   254   3e-87   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              254   3e-87   
gb|ABC97356.1|  alpha tubulin                                           254   3e-87   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             254   4e-87   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              255   4e-87   
gb|ABL61219.1|  alpha-tubulin                                           258   4e-87   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   254   4e-87   
emb|CAE52514.1|  alpha tubulin                                          257   4e-87   
emb|CAL35827.1|  alpha-2 tubulin                                        254   4e-87   
gb|ABL61202.1|  alpha-tubulin                                           258   5e-87   
emb|CAD24768.1|  alpha-tubulin                                          253   5e-87   
gb|ABL61213.1|  alpha-tubulin                                           256   5e-87   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              257   5e-87   
gb|ABL61227.1|  alpha-tubulin                                           258   5e-87   
gb|AAB86649.1|  alpha-tubulin                                           256   6e-87   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   255   6e-87   
gb|ABL61204.1|  alpha-tubulin                                           256   6e-87   
gb|AAB86648.1|  alpha-tubulin                                           256   6e-87   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 254   6e-87   
emb|CCI45804.1|  unnamed protein product                                253   6e-87   
gb|AAX63396.1|  alpha-tubulin                                           256   6e-87   
gb|AGG37286.1|  alpha-tubulin 4                                         253   7e-87   
gb|ABL61217.1|  alpha-tubulin                                           256   7e-87   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   253   7e-87   
gb|ETW30983.1|  tubulin alpha chain                                     257   7e-87   
gb|ABR67425.1|  alpha-tubulin 4                                         253   7e-87   
gb|ABL61203.1|  alpha-tubulin                                           257   8e-87   
emb|CAL80740.1|  alpha-tubulin                                          255   8e-87   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     253   8e-87   
emb|CCA20146.1|  alpha tubulin 1 putative                               253   8e-87   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              253   8e-87   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              253   8e-87   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    253   8e-87   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    253   8e-87   
emb|CAA61255.1|  alpha tubulin                                          255   8e-87   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              253   8e-87   
emb|CDP00974.1|  unnamed protein product                                255   8e-87   
dbj|BAJ98211.1|  predicted protein                                      253   9e-87   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        253   1e-86   
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-86   
gb|AHJ80816.1|  Tua1                                                    253   1e-86   
gb|ABL61214.1|  alpha-tubulin                                           258   1e-86   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             254   1e-86   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                253   1e-86   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      252   1e-86   
gb|ETP23198.1|  tubulin alpha chain                                     254   1e-86   
gb|AAO46130.1|  alpha-tubulin                                           252   1e-86   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-86   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-86   
gb|ABL61226.1|  alpha-tubulin                                           255   1e-86   
gb|AAO46128.1|  alpha-tubulin                                           254   1e-86   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        252   1e-86   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                252   1e-86   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             252   1e-86   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              252   1e-86   
emb|CAD26887.1|  alpha-tubulin                                          252   1e-86   
gb|ETW27380.1|  tubulin alpha chain                                     256   1e-86   
emb|CAD20820.1|  alpha tubulin                                          253   2e-86   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             252   2e-86   
dbj|BAH20267.1|  AT5G19780                                              251   2e-86   
gb|ABL61218.1|  alpha-tubulin                                           256   2e-86   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   252   2e-86   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      252   2e-86   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   252   2e-86   
ref|XP_008877307.1|  tubulin alpha chain                                251   2e-86   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   252   2e-86   
ref|XP_001420620.1|  predicted protein                                  254   2e-86   
ref|XP_007014666.1|  Tubulin alpha-5                                    251   2e-86   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              255   2e-86   
gb|ABO47738.1|  alpha-tubulin                                           253   2e-86   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             253   2e-86   
gb|ETW45898.1|  tubulin alpha chain                                     256   2e-86   
gb|ADJ00012.1|  tubulin alpha chain                                     253   2e-86   
gb|ETW61813.1|  tubulin alpha chain                                     255   2e-86   
gb|AAO63773.2|  alpha-tubulin 2                                         251   3e-86   
gb|EWC76931.1|  tubulin alpha chain                                     255   3e-86   
gb|AHJ80822.1|  Tua1                                                    259   3e-86   
gb|ABL61086.1|  alpha-tubulin                                           254   3e-86   
gb|ETW20218.1|  tubulin alpha chain                                     255   3e-86   
ref|XP_002904166.1|  alpha-tubulin, putative                            253   3e-86   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   250   3e-86   
ref|XP_010454260.1|  PREDICTED: tubulin alpha-3 chain-like              251   3e-86   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      252   3e-86   
gb|AAO23139.1|  alpha tubulin                                           251   3e-86   
ref|NP_197478.1|  tubulin alpha-3                                       251   3e-86   
emb|CAA65330.1|  alpha-tubulin                                          252   3e-86   
gb|AIC33057.1|  tubulin alpha-1 chain                                   251   3e-86   
emb|CDY42294.1|  BnaC02g09000D                                          251   3e-86   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                253   3e-86   
emb|CDX88875.1|  BnaA03g07740D                                          251   3e-86   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              251   3e-86   
gb|ETW56906.1|  tubulin alpha chain                                     255   3e-86   
gb|ETO12554.1|  hypothetical protein RFI_24821                          252   3e-86   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         255   3e-86   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   251   3e-86   
gb|EUD70907.1|  tubulin alpha chain                                     255   3e-86   
ref|XP_002904155.1|  alpha-tubulin, putative                            253   3e-86   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    251   3e-86   
gb|ETI53457.1|  tubulin alpha chain                                     252   4e-86   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             252   4e-86   
ref|XP_008818311.1|  tubulin alpha chain                                255   4e-86   
gb|EUT86396.1|  tubulin alpha chain                                     255   4e-86   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  253   4e-86   
ref|XP_008900811.1|  tubulin alpha chain                                252   4e-86   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         251   4e-86   
gb|AAO46126.1|  alpha-tubulin                                           253   4e-86   
ref|XP_009126389.1|  PREDICTED: tubulin alpha-3 chain-like              250   4e-86   
gb|ABR26150.1|  tubulin alpha-3 chain                                   256   4e-86   
ref|XP_009126391.1|  PREDICTED: tubulin alpha-3 chain-like              250   4e-86   
emb|CBH08958.1|  alpha tubulin, (fragment)                              251   4e-86   
ref|XP_009120857.1|  PREDICTED: tubulin alpha-3 chain                   250   4e-86   
gb|KDP42087.1|  hypothetical protein JCGZ_01875                         250   4e-86   
gb|ETW38327.1|  tubulin alpha chain                                     255   5e-86   
gb|EWC88756.1|  tubulin alpha chain                                     255   5e-86   
emb|CDY44941.1|  BnaA02g04460D                                          250   5e-86   
ref|XP_002786953.1|  Tubulin alpha chain, putative                      251   5e-86   
ref|XP_001351526.1|  alpha-tubulin ii                                   255   5e-86   
gb|ABL61230.1|  alpha-tubulin                                           253   5e-86   
gb|ABL61228.1|  alpha-tubulin                                           253   5e-86   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             253   5e-86   



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   267 bits (683),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  141  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDV  200

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  201  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  260

Query  320  VAEV  309
            VAEV
Sbjct  261  VAEV  264


 Score = 95.5 bits (236),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  265  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   266 bits (680),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  154  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  213

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  214  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  273

Query  320  VAEV  309
            VAEV
Sbjct  274  VAEV  277


 Score = 96.3 bits (238),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  278  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   267 bits (683),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 5e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   267 bits (683),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   267 bits (682),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   267 bits (682),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  263  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  322

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  323  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  382

Query  320  VAEV  309
            VAEV
Sbjct  383  VAEV  386


 Score = 94.7 bits (234),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  387  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  431



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   267 bits (682),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   267 bits (683),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   267 bits (682),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  265  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  324

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  325  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  384

Query  320  VAEV  309
            VAEV
Sbjct  385  VAEV  388


 Score = 94.7 bits (234),  Expect(2) = 7e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   267 bits (682),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   266 bits (680),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  218  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  277

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  278  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  337

Query  320  VAEV  309
            VAEV
Sbjct  338  VAEV  341


 Score = 95.5 bits (236),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  342  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   266 bits (679),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  40   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  99

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMISNSTS
Sbjct  100  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNSTS  159

Query  320  VAEV  309
            VAEV
Sbjct  160  VAEV  163


 Score = 95.5 bits (236),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  164  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   265 bits (678),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  175  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  234

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  235  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  294

Query  320  VAEV  309
            VAEV
Sbjct  295  VAEV  298


 Score = 95.9 bits (237),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  299  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   266 bits (679),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  229  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  288

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  289  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  348

Query  320  VAEV  309
            VAEV
Sbjct  349  VAEV  352


 Score = 95.5 bits (236),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  353  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   266 bits (680),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   265 bits (678),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  229  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  288

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  289  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  348

Query  320  VAEV  309
            VAEV
Sbjct  349  VAEV  352


 Score = 95.5 bits (236),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  353  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   266 bits (679),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  268  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDV  327

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  328  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  387

Query  320  VAEV  309
            VAEV
Sbjct  388  VAEV  391


 Score = 95.1 bits (235),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  392  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  436



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   265 bits (678),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  84   RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  143

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  144  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  203

Query  320  VAEV  309
            VAEV
Sbjct  204  VAEV  207


 Score = 95.1 bits (235),  Expect(2) = 1e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  208  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   267 bits (683),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/124 (100%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRA VHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRALVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   265 bits (677),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   265 bits (676),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  236  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  295

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  296  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  355

Query  320  VAEV  309
            VAEV
Sbjct  356  VAEV  359


 Score = 95.5 bits (236),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  360  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   264 bits (675),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  120  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  179

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTS
Sbjct  180  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTS  239

Query  320  VAEV  309
            VAEV
Sbjct  240  VAEV  243


 Score = 95.5 bits (236),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  244  FSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  280  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  339

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  340  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  399

Query  320  VAEV  309
            VAEV
Sbjct  400  VAEV  403


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  404  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  448



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   265 bits (677),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   265 bits (677),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   264 bits (675),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   264 bits (675),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   264 bits (675),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   265 bits (676),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   264 bits (674),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  245  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  304

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  305  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  364

Query  320  VAEV  309
            VAEV
Sbjct  365  VAEV  368


 Score = 95.5 bits (236),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  369  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   265 bits (676),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   264 bits (675),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  249  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  308

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  309  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  368

Query  320  VAEV  309
            VAEV
Sbjct  369  VAEV  372


 Score = 95.1 bits (235),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  373  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  417



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   264 bits (674),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  269  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  328

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  329  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  388

Query  320  VAEV  309
            VAEV
Sbjct  389  VAEV  392


 Score = 95.1 bits (235),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  393  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  437



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   264 bits (675),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   264 bits (675),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  230  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  289

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  290  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  349

Query  320  VAEV  309
            VAEV
Sbjct  350  VAEV  353


 Score = 94.7 bits (234),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  354  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   264 bits (675),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 5e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   264 bits (675),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   263 bits (673),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   263 bits (673),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  253  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  312

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  313  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  372

Query  320  VAEV  309
            VAEV
Sbjct  373  VAEV  376


 Score = 95.1 bits (235),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  377  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  421



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   263 bits (673),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 6e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  267  RIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  326

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  327  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  386

Query  320  VAEV  309
            VAEV
Sbjct  387  VAEV  390


 Score = 94.7 bits (234),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  391  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  435



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   263 bits (672),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  168  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  227

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  228  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  287

Query  320  VAEV  309
            VAEV
Sbjct  288  VAEV  291


 Score = 95.5 bits (236),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  292  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   263 bits (673),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 7e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   263 bits (673),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   263 bits (673),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   263 bits (673),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   263 bits (673),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   263 bits (673),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   263 bits (673),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   263 bits (672),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   263 bits (671),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   263 bits (672),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   263 bits (672),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   263 bits (672),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  31   RIHFMLSSYAPVISAEKAYHEQLSVSEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGDV  90

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  91   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  150

Query  320  VAEV  309
            VAEV
Sbjct  151  VAEV  154


 Score = 94.7 bits (234),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  155  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   263 bits (671),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNS FEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  314  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSTFEPSSMMAKCDPRHGKYMACCLMYRGDV  373

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  374  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  433

Query  320  VAEV  309
            VAEV
Sbjct  434  VAEV  437


 Score = 95.5 bits (236),  Expect(2) = 9e-90, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  438  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  482



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   262 bits (669),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  102  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  161

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  162  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  221

Query  320  VAEV  309
            V EV
Sbjct  222  VVEV  225


 Score = 95.9 bits (237),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  226  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   265 bits (677),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  79   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  138

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  139  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  198

Query  320  VAEV  309
            VAEV
Sbjct  199  VAEV  202


 Score = 92.8 bits (229),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  203  FSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   263 bits (671),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   265 bits (677),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  80   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  139

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  140  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  199

Query  320  VAEV  309
            VAEV
Sbjct  200  VAEV  203


 Score = 92.8 bits (229),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  204  FSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VA+V
Sbjct  384  VADV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  260  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  319

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  320  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  379

Query  320  VAEV  309
            VAEV
Sbjct  380  VAEV  383


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  384  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  428



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  261  RIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  320

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  321  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  380

Query  320  VAEV  309
            VAEV
Sbjct  381  VAEV  384


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  429



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   263 bits (671),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CCA24429.1| splicing factor putative [Albugo laibachii Nc14]
Length=1644

 Score =   256 bits (654),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMA CLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN+++
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTSA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score =   101 bits (251),  Expect(2) = 1e-89, Method: Composition-based stats.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   264 bits (674),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 124/124 (100%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 94.0 bits (232),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   262 bits (670),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   263 bits (672),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.4 bits (233),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   263 bits (671),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFV+WCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVEWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   264 bits (675),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   262 bits (670),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   262 bits (670),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   262 bits (670),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  266  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMAKCDPRHGKYMACCLMYRGDV  325

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  326  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  385

Query  320  VAEV  309
            VAEV
Sbjct  386  VAEV  389


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  390  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  434



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   264 bits (675),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   262 bits (670),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  31   RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  90

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  91   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  150

Query  320  VAEV  309
            VAEV
Sbjct  151  VAEV  154


 Score = 95.1 bits (235),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  155  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   263 bits (671),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  25   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  84

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  85   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  144

Query  320  VAEV  309
            VAEV
Sbjct  145  VAEV  148


 Score = 94.7 bits (234),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   264 bits (675),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   264 bits (675),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   265 bits (676),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.8 bits (229),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDNKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   263 bits (671),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  25   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  84

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  85   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  144

Query  320  VAEV  309
            VAEV
Sbjct  145  VAEV  148


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   265 bits (676),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.8 bits (229),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDNKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVC ISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCKISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   264 bits (675),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  24   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  83

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  84   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  143

Query  320  VAEV  309
            VAEV
Sbjct  144  VAEV  147


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  148  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  25   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  84

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  85   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  144

Query  320  VAEV  309
            VAEV
Sbjct  145  VAEV  148


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  149  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  23   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  82

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  83   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  142

Query  320  VAEV  309
            VAEV
Sbjct  143  VAEV  146


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  147  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   265 bits (676),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.4 bits (228),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKF LMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFGLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   261 bits (668),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   261 bits (668),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   265 bits (676),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.0 bits (227),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   265 bits (676),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.0 bits (227),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   262 bits (670),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  22   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  81

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  82   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  141

Query  320  VAEV  309
            VAEV
Sbjct  142  VAEV  145


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAP ISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPAISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  24   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  83

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  84   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  143

Query  320  VAEV  309
            VAEV
Sbjct  144  VAEV  147


 Score = 94.7 bits (234),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  148  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   262 bits (669),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  22   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  81

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  82   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  141

Query  320  VAEV  309
            VAEV
Sbjct  142  VAEV  145


 Score = 94.4 bits (233),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  146  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.0 bits (227),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.0 bits (227),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  261  RIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  320

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  321  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  380

Query  320  VAEV  309
            VAEV
Sbjct  381  VAEV  384


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  429



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   261 bits (667),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAHHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   265 bits (676),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 122/124 (98%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 91.7 bits (226),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   262 bits (669),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  229  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  288

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  289  VPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  348

Query  320  VAEV  309
            +AEV
Sbjct  349  IAEV  352


 Score = 94.4 bits (233),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  353  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   262 bits (670),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 94.0 bits (232),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   261 bits (668),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   261 bits (666),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFE SSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFETSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   261 bits (667),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   261 bits (667),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   261 bits (667),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   261 bits (667),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   261 bits (666),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  265  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  324

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  325  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  384

Query  320  VAEV  309
            V EV
Sbjct  385  VVEV  388


 Score = 95.1 bits (235),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   261 bits (666),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  265  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  324

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  325  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  384

Query  320  VAEV  309
            V EV
Sbjct  385  VVEV  388


 Score = 95.1 bits (235),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  389  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   261 bits (666),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISA KAYHEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   261 bits (667),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   261 bits (666),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   261 bits (666),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDL+ VQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLSGVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   261 bits (666),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEIT SAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITTSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   260 bits (665),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEIT+SAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITSSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   260 bits (665),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   262 bits (670),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 121/130 (93%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  159  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  218

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  219  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  278

Query  320  VAEVSHALTI  291
            V EV   + I
Sbjct  279  VVEVFSRIDI  288


 Score = 92.8 bits (229),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  283  FSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   260 bits (665),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPR GKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRRGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   260 bits (664),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE TNSAFEPSS+M KCDPRHGKYMACCLM+RGDV
Sbjct  194  RIHFMLSSYAPVISAEKAYHEQLSVAETTNSAFEPSSLMAKCDPRHGKYMACCLMYRGDV  253

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST 
Sbjct  254  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTR  313

Query  320  VAEV  309
            +AEV
Sbjct  314  LAEV  317


 Score = 95.5 bits (236),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  318  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  362



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   260 bits (665),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  56   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  115

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  116  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  175

Query  320  VAEV  309
            V EV
Sbjct  176  VVEV  179


 Score = 94.7 bits (234),  Expect(2) = 6e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  180  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   260 bits (665),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   260 bits (665),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++VPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   260 bits (665),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   260 bits (665),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   261 bits (667),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 93.6 bits (231),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   260 bits (665),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  15   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  74

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T+
Sbjct  75   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNTA  134

Query  320  VAEV  309
            VAEV
Sbjct  135  VAEV  138


 Score = 94.4 bits (233),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  139  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>ref|XP_008815298.1| hypothetical protein C922_01473 [Plasmodium inui San Antonio 
1]
 gb|EUD67861.1| hypothetical protein C922_01473 [Plasmodium inui San Antonio 
1]
Length=1054

 Score =   262 bits (669),  Expect(2) = 8e-89, Method: Composition-based stats.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPV+SAEKAYHEQLSV+EITNSAFEP++MM KCDPRHGKYMACCLM+RGDV
Sbjct  865  RIHFMLSSYAPVVSAEKAYHEQLSVSEITNSAFEPANMMAKCDPRHGKYMACCLMYRGDV  924

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNST+
Sbjct  925  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTA  984

Query  320  VAEV  309
            +AEV
Sbjct  985  IAEV  988


 Score = 92.8 bits (229),  Expect(2) = 8e-89, Method: Composition-based stats.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309   FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
             FSR+D KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  989   FSRMDQKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  1033



>gb|ABK92552.1| unknown [Populus trichocarpa]
Length=451

 Score =   263 bits (671),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 121/124 (98%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA CMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAFCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.0 bits (227),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   260 bits (664),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   260 bits (664),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++VPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            V EV
Sbjct  384  VVEV  387


 Score = 94.7 bits (234),  Expect(2) = 8e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   259 bits (663),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   259 bits (663),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  62   RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  121

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  122  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  181

Query  320  VAEV  309
            VAEV
Sbjct  182  VAEV  185


 Score = 95.1 bits (235),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  186  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   260 bits (665),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  177  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  236

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  237  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  296

Query  320  VAEV  309
            V EV
Sbjct  297  VVEV  300


 Score = 94.4 bits (233),  Expect(2) = 9e-89, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  301  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  345



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   260 bits (665),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.0 bits (232),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010557535.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   262 bits (669),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV+TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVSTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 92.4 bits (228),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   260 bits (665),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  62   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  121

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  122  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  181

Query  320  VAEV  309
            VAEV
Sbjct  182  VAEV  185


 Score = 94.0 bits (232),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  186  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   259 bits (662),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008625876.1| hypothetical protein YYE_04011 [Plasmodium vinckei vinckei]
 gb|KEG00978.1| hypothetical protein YYE_04011 [Plasmodium vinckei vinckei]
Length=1161

 Score =   262 bits (669),  Expect(2) = 1e-88, Method: Composition-based stats.
 Identities = 115/124 (93%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
             RIHFMLSSYAPV+SAEKAYHEQLSV+EITNSAFEP++MM KCDPRHGKYMACCLM+RGDV
Sbjct  972   RIHFMLSSYAPVVSAEKAYHEQLSVSEITNSAFEPANMMAKCDPRHGKYMACCLMYRGDV  1031

Query  500   VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
             VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNST+
Sbjct  1032  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTA  1091

Query  320   VAEV  309
             +AEV
Sbjct  1092  IAEV  1095


 Score = 92.4 bits (228),  Expect(2) = 1e-88, Method: Composition-based stats.
 Identities = 42/45 (93%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309   FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
             FSR+D KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  1096  FSRMDQKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  1140



>gb|KDD76276.1| tubulin/FtsZ GTPase [Helicosporidium sp. ATCC 50920]
Length=450

 Score =   260 bits (665),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 93.6 bits (231),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPR GKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRXGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.7 bits (234),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  245  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  304

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  305  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  364

Query  320  VAEV  309
            VAEV
Sbjct  365  VAEV  368


 Score = 94.7 bits (234),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  369  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   260 bits (665),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  208  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  267

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  268  VPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  327

Query  320  VAEV  309
            +AEV
Sbjct  328  IAEV  331


 Score = 94.0 bits (232),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  332  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  376



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   259 bits (662),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002508010.1| alpha tubulin 2 [Micromonas sp. RCC299]
 ref|XP_002506067.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO67325.1| alpha tubulin 1 [Micromonas sp. RCC299]
 gb|ACO69268.1| alpha tubulin 2 [Micromonas sp. RCC299]
Length=449

 Score =   260 bits (665),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSA+EP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAYEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 93.6 bits (231),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   259 bits (663),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  134  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  193

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  194  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  253

Query  320  VAEV  309
            V EV
Sbjct  254  VVEV  257


 Score = 94.4 bits (233),  Expect(2) = 1e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  258  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  229  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  288

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNSTS
Sbjct  289  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTS  348

Query  320  VAEV  309
            V EV
Sbjct  349  VVEV  352


 Score = 95.1 bits (235),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  353  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  229  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  288

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNSTS
Sbjct  289  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNSTS  348

Query  320  VAEV  309
            V EV
Sbjct  349  VVEV  352


 Score = 95.1 bits (235),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  353  FSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_005651460.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 gb|EIE26916.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   259 bits (663),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSY+PVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYSPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 94.0 bits (232),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KJB29387.1| hypothetical protein B456_005G097800 [Gossypium raimondii]
Length=451

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISA KAYHEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNSTS
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAEVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003058621.1| alpha tubulin [Micromonas pusilla CCMP1545]
 ref|XP_003062500.1| alpha tubulin [Micromonas pusilla CCMP1545]
 gb|EEH53319.1| alpha tubulin [Micromonas pusilla CCMP1545]
 gb|EEH57076.1| alpha tubulin [Micromonas pusilla CCMP1545]
Length=451

 Score =   259 bits (663),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSA+EP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAYEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 93.6 bits (231),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_005643073.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
 sp|Q9ZRJ4.1|TBA_CHLVU RecName: Full=Tubulin alpha chain [Chlorella vulgaris]
 dbj|BAA03955.1| alpha-tubulin [Chlorella vulgaris]
 gb|EIE18529.1| tubulin alpha chain [Coccomyxa subellipsoidea C-169]
Length=451

 Score =   259 bits (663),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSY+PVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYSPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 94.0 bits (232),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAT09063.1| alpha tubulin 1 [Bigelowiella natans]
Length=453

 Score =   258 bits (660),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDW PTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWSPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 95.1 bits (235),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   261 bits (666),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGDV
Sbjct  69   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGDV  128

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNSTS
Sbjct  129  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNSTS  188

Query  320  VAEV  309
            V EV
Sbjct  189  VVEV  192


 Score = 92.4 bits (228),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  193  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>ref|XP_003080933.1| TBA_CHLVU Tubulin alpha chain (ISS) [Ostreococcus tauri]
Length=475

 Score =   259 bits (662),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 116/124 (94%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  288  RIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  347

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVA+IKT+RTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST+
Sbjct  348  VPKDVNAAVASIKTRRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTA  407

Query  320  VAEV  309
            +AEV
Sbjct  408  IAEV  411


 Score = 94.4 bits (233),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  412  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  456



>ref|XP_001770881.1| predicted protein [Physcomitrella patens]
 gb|EDQ64211.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   259 bits (663),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPV+SAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACC+M+RGDV
Sbjct  264  RIHFMLSSYAPVVSAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCMMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+TS
Sbjct  324  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNTTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 94.0 bits (232),  Expect(2) = 2e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EJY81124.1| Alpha tubulin,putative [Oxytricha trifallax]
Length=450

 Score =   258 bits (659),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   260 bits (665),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 123/124 (99%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACC+M+RGDV
Sbjct  70   RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGDV  129

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  130  VPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  189

Query  320  VAEV  309
            +AEV
Sbjct  190  IAEV  193


 Score = 92.4 bits (228),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 42/45 (93%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  194  FSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>gb|AAQ81585.1| putative tubulin alpha-2/alpha-4 chain [Brassica napus]
Length=450

 Score =   259 bits (663),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 119/124 (96%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 93.2 bits (230),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 43/45 (96%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            F RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FPRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010461854.1| PREDICTED: tubulin alpha-6 chain-like [Camelina sativa]
Length=450

 Score =   258 bits (658),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAV TIK KRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS
Sbjct  324  VPKDVNAAVGTIKNKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  383

Query  320  VAEV  309
            VAEV
Sbjct  384  VAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDW82295.1| alpha tubulin [Stylonychia lemnae]
Length=450

 Score =   258 bits (658),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 118/124 (95%), Positives = 122/124 (98%), Gaps = 0/124 (0%)
 Frame = -1

Query  680  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGDV  501
            RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGDV
Sbjct  264  RIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGDV  323

Query  500  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNSTS  321
            VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RAVCMISNST+
Sbjct  324  VPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRAVCMISNSTA  383

Query  320  VAEV  309
            +AEV
Sbjct  384  IAEV  387


 Score = 95.1 bits (235),  Expect(2) = 3e-88, Method: Compositional matrix adjust.
 Identities = 44/45 (98%), Positives = 44/45 (98%), Gaps = 0/45 (0%)
 Frame = -3

Query  309  FSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  175
            FSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  FSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1104504643240