BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031B22

Length=681
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009629724.1|  PREDICTED: phospholipase A1-IIdelta-like           285   2e-90   Nicotiana tomentosiformis
ref|XP_009766306.1|  PREDICTED: phospholipase A1-IIdelta-like           283   2e-89   Nicotiana sylvestris
gb|KDO63393.1|  hypothetical protein CISIN_1g014927mg                   270   6e-85   Citrus sinensis [apfelsine]
ref|XP_006468997.1|  PREDICTED: phospholipase A1-IIdelta-like           270   8e-85   Citrus sinensis [apfelsine]
ref|XP_006446810.1|  hypothetical protein CICLE_v10015386mg             269   1e-84   Citrus clementina [clementine]
ref|XP_004251807.1|  PREDICTED: phospholipase A1-IIdelta-like           265   4e-83   Solanum lycopersicum
ref|XP_011028053.1|  PREDICTED: phospholipase A1-IIdelta                265   4e-83   Populus euphratica
ref|XP_002303465.1|  lipase family protein                              264   1e-82   
ref|XP_006350025.1|  PREDICTED: phospholipase A1-IIdelta-like           262   5e-82   Solanum tuberosum [potatoes]
ref|XP_006348881.1|  PREDICTED: phospholipase A1-IIdelta-like           263   1e-81   Solanum tuberosum [potatoes]
gb|EPS65211.1|  hypothetical protein M569_09564                         261   1e-81   Genlisea aurea
ref|XP_003540985.1|  PREDICTED: phospholipase A1-IIdelta-like           254   6e-81   
ref|XP_004303191.1|  PREDICTED: phospholipase A1-IIdelta                260   9e-81   Fragaria vesca subsp. vesca
gb|KDP47123.1|  hypothetical protein JCGZ_22119                         258   1e-80   Jatropha curcas
ref|XP_009593784.1|  PREDICTED: phospholipase A1-IIdelta                260   2e-80   Nicotiana tomentosiformis
gb|EYU41122.1|  hypothetical protein MIMGU_mgv1a021036mg                258   2e-80   Erythranthe guttata [common monkey flower]
gb|KHN34242.1|  Phospholipase A1-IIdelta                                253   5e-80   Glycine soja [wild soybean]
emb|CDO98286.1|  unnamed protein product                                257   7e-80   Coffea canephora [robusta coffee]
ref|XP_004243279.1|  PREDICTED: phospholipase A1-IIdelta                258   1e-79   Solanum lycopersicum
ref|XP_008348571.1|  PREDICTED: phospholipase A1-IIdelta-like           256   2e-79   
ref|XP_010052794.1|  PREDICTED: phospholipase A1-IIdelta                256   3e-79   Eucalyptus grandis [rose gum]
gb|EYU41119.1|  hypothetical protein MIMGU_mgv1a025698mg                253   2e-78   Erythranthe guttata [common monkey flower]
ref|XP_002518706.1|  triacylglycerol lipase, putative                   250   3e-77   Ricinus communis
emb|CDP15943.1|  unnamed protein product                                250   3e-77   Coffea canephora [robusta coffee]
ref|XP_007048712.1|  Alpha/beta-Hydrolases superfamily protein          249   5e-77   
ref|XP_010525104.1|  PREDICTED: phospholipase A1-IIdelta                248   1e-76   Tarenaya hassleriana [spider flower]
ref|XP_007132834.1|  hypothetical protein PHAVU_011G128500g             246   1e-75   Phaseolus vulgaris [French bean]
ref|XP_011082995.1|  PREDICTED: phospholipase A1-IIdelta                246   1e-75   Sesamum indicum [beniseed]
ref|XP_010276983.1|  PREDICTED: phospholipase A1-IIdelta                245   3e-75   Nelumbo nucifera [Indian lotus]
ref|XP_007048713.1|  Alpha/beta-Hydrolases superfamily protein          244   5e-75   
ref|XP_003607601.1|  Feruloyl esterase A                                244   9e-75   Medicago truncatula
ref|XP_004505480.1|  PREDICTED: phospholipase A1-IIdelta-like           242   2e-73   
ref|XP_007217233.1|  hypothetical protein PRUPE_ppa005547mg             240   5e-73   Prunus persica
gb|KJB71435.1|  hypothetical protein B456_011G123300                    239   5e-73   Gossypium raimondii
ref|XP_010104406.1|  Phospholipase A1-IIdelta                           238   6e-73   Morus notabilis
ref|XP_006411537.1|  hypothetical protein EUTSA_v10016724mg             238   1e-72   Eutrema salsugineum [saltwater cress]
ref|XP_010925002.1|  PREDICTED: phospholipase A1-II 5-like              238   2e-72   Elaeis guineensis
ref|XP_009401938.1|  PREDICTED: phospholipase A1-II 5                   238   3e-72   
ref|XP_008343100.1|  PREDICTED: phospholipase A1-IIdelta-like           236   5e-72   
ref|XP_008353849.1|  PREDICTED: phospholipase A1-IIdelta-like           236   8e-72   
ref|XP_008343102.1|  PREDICTED: phospholipase A1-IIdelta-like           236   1e-71   
ref|XP_008362525.1|  PREDICTED: phospholipase A1-IIdelta-like           236   1e-71   
ref|XP_002281095.2|  PREDICTED: phospholipase A1-IIdelta                237   2e-71   Vitis vinifera
ref|XP_002881867.1|  hypothetical protein ARALYDRAFT_483364             235   2e-71   
ref|XP_002522219.1|  hypothetical protein RCOM_1733320                  227   2e-71   
ref|XP_008228927.1|  PREDICTED: phospholipase A1-IIdelta                236   2e-71   Prunus mume [ume]
ref|NP_181797.1|  phospholipase A1-IIdelta                              234   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65213.1|  hypothetical protein M569_09566                         234   3e-71   Genlisea aurea
emb|CBI21996.3|  unnamed protein product                                236   3e-71   Vitis vinifera
ref|XP_010517807.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    233   7e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010517806.1|  PREDICTED: phospholipase A1-IIdelta-like iso...    233   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010506105.1|  PREDICTED: phospholipase A1-IIdelta-like           233   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010508539.1|  PREDICTED: phospholipase A1-IIdelta isoform X1     233   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010525149.1|  PREDICTED: phospholipase A1-IIdelta-like           233   1e-70   Tarenaya hassleriana [spider flower]
ref|XP_006294314.1|  hypothetical protein CARUB_v10023322mg             233   2e-70   Capsella rubella
gb|ACJ85535.1|  unknown                                                 233   2e-70   Medicago truncatula
ref|XP_010925003.1|  PREDICTED: phospholipase A1-II 5-like              233   3e-70   Elaeis guineensis
emb|CDY14851.1|  BnaC04g48480D                                          231   4e-70   Brassica napus [oilseed rape]
ref|XP_010689863.1|  PREDICTED: phospholipase A1-IIdelta-like           231   8e-70   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY47985.1|  BnaA04g24630D                                          228   3e-69   Brassica napus [oilseed rape]
ref|XP_009142078.1|  PREDICTED: phospholipase A1-IIdelta                228   9e-69   Brassica rapa
gb|KFK37117.1|  hypothetical protein AALP_AA4G215100                    228   1e-68   Arabis alpina [alpine rockcress]
ref|XP_008807980.1|  PREDICTED: phospholipase A1-II 5                   227   5e-68   Phoenix dactylifera
gb|KFK37118.1|  hypothetical protein AALP_AA4G215200                    223   1e-67   Arabis alpina [alpine rockcress]
ref|XP_010507708.1|  PREDICTED: phospholipase A1-IIdelta-like           221   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010689845.1|  PREDICTED: phospholipase A1-IIdelta-like           222   2e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010413021.1|  PREDICTED: phospholipase A1-IIdelta-like           221   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006411539.1|  hypothetical protein EUTSA_v10017651mg             221   4e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010512889.1|  PREDICTED: phospholipase A1-IIdelta-like           217   9e-65   Camelina sativa [gold-of-pleasure]
gb|AAD01804.1|  lipase                                                  218   2e-64   Dianthus caryophyllus [carnation]
ref|XP_004969721.1|  PREDICTED: phospholipase A1-II 5-like              218   2e-64   Setaria italica
ref|XP_006858341.1|  hypothetical protein AMTR_s00064p00160550          207   1e-63   
ref|NP_001044041.1|  Os01g0710700                                       215   3e-63   
sp|B8A8C9.1|PLA5_ORYSI  RecName: Full=Phospholipase A1-II 5             214   9e-63   Oryza sativa Indica Group [Indian rice]
gb|EEE55280.1|  hypothetical protein OsJ_03214                          215   9e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002458388.1|  hypothetical protein SORBIDRAFT_03g032660          211   2e-61   
ref|XP_002881868.1|  hypothetical protein ARALYDRAFT_903642             209   2e-61   
ref|XP_006644603.1|  PREDICTED: phospholipase A1-II 5-like              210   3e-61   Oryza brachyantha
emb|CDY50817.1|  BnaC04g52540D                                          208   3e-61   Brassica napus [oilseed rape]
ref|XP_003569665.1|  PREDICTED: phospholipase A1-II 5                   207   4e-60   Brachypodium distachyon [annual false brome]
emb|CDM83808.1|  unnamed protein product                                203   1e-58   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63050.1|  Phospholipase A1-II 5                                   204   2e-58   Triticum urartu
gb|EMT00730.1|  Lipase                                                  194   2e-56   
ref|XP_008675114.1|  PREDICTED: phospholipase A1-II 5                   197   2e-56   Zea mays [maize]
dbj|BAJ88202.1|  predicted protein                                      195   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85876.1|  predicted protein                                      195   1e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010274489.1|  PREDICTED: phospholipase A1-IIdelta-like           184   2e-54   Nelumbo nucifera [Indian lotus]
gb|ABK24664.1|  unknown                                                 187   5e-53   Picea sitchensis
gb|ABR18391.1|  unknown                                                 174   6e-48   Picea sitchensis
gb|ABK23399.1|  unknown                                                 173   8e-48   Picea sitchensis
ref|XP_010107463.1|  Phospholipase A1-IIdelta                           156   1e-41   Morus notabilis
ref|XP_009353256.1|  PREDICTED: phospholipase A1-IIgamma-like           157   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_010279083.1|  PREDICTED: phospholipase A1-IIgamma-like           155   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_008812184.1|  PREDICTED: phospholipase A1-II 1                   155   3e-41   Phoenix dactylifera
ref|XP_009352805.1|  PREDICTED: phospholipase A1-IIgamma-like           156   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_010912683.1|  PREDICTED: phospholipase A1-II 1                   154   8e-41   Elaeis guineensis
ref|XP_008383647.1|  PREDICTED: phospholipase A1-IIgamma                154   1e-40   Malus domestica [apple tree]
ref|XP_010655496.1|  PREDICTED: phospholipase A1-IIgamma isoform X2     151   3e-40   
ref|XP_006362440.1|  PREDICTED: phospholipase A1-II 1-like              152   6e-40   Solanum tuberosum [potatoes]
emb|CBI30665.3|  unnamed protein product                                151   7e-40   Vitis vinifera
ref|XP_002266982.2|  PREDICTED: phospholipase A1-IIgamma isoform X1     151   1e-39   Vitis vinifera
ref|XP_004485882.1|  PREDICTED: phospholipase A1-IIgamma-like           151   2e-39   
ref|XP_010054330.1|  PREDICTED: phospholipase A1-IIgamma-like           150   2e-39   Eucalyptus grandis [rose gum]
ref|XP_004233849.2|  PREDICTED: phospholipase A1-IIgamma-like           150   2e-39   
ref|XP_010104409.1|  Phospholipase A1-IIdelta                           150   3e-39   Morus notabilis
ref|XP_004293927.1|  PREDICTED: phospholipase A1-IIgamma-like           150   5e-39   Fragaria vesca subsp. vesca
ref|XP_008225210.1|  PREDICTED: phospholipase A1-IIgamma                150   6e-39   Prunus mume [ume]
ref|XP_007213350.1|  hypothetical protein PRUPE_ppa1027164mg            149   7e-39   
ref|XP_004232957.2|  PREDICTED: phospholipase A1-II 1-like              149   9e-39   Solanum lycopersicum
ref|XP_007148062.1|  hypothetical protein PHAVU_006G177300g             149   1e-38   Phaseolus vulgaris [French bean]
gb|EYU17473.1|  hypothetical protein MIMGU_mgv1a008748mg                147   2e-38   Erythranthe guttata [common monkey flower]
ref|XP_011462291.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    148   2e-38   Fragaria vesca subsp. vesca
gb|KHN08451.1|  Phospholipase A1-IIgamma                                147   3e-38   Glycine soja [wild soybean]
ref|XP_009765842.1|  PREDICTED: phospholipase A1-II 1-like              147   4e-38   Nicotiana sylvestris
ref|XP_009389474.1|  PREDICTED: phospholipase A1-II 5-like              147   4e-38   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDM83551.1|  unnamed protein product                                147   4e-38   Triticum aestivum [Canadian hard winter wheat]
gb|KDP21073.1|  hypothetical protein JCGZ_21544                         147   5e-38   Jatropha curcas
ref|XP_003541709.1|  PREDICTED: phospholipase A1-IIgamma-like           147   5e-38   Glycine max [soybeans]
gb|KHN18919.1|  Phospholipase A1-IIgamma                                147   5e-38   Glycine soja [wild soybean]
ref|XP_009393076.1|  PREDICTED: phospholipase A1-II 1                   147   6e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003593747.1|  Lipase                                             147   8e-38   
ref|XP_003547164.1|  PREDICTED: phospholipase A1-IIgamma-like           147   9e-38   
dbj|BAJ96485.1|  predicted protein                                      146   1e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW74072.1|  hypothetical protein EUGRSUZ_E02710                     146   1e-37   Eucalyptus grandis [rose gum]
ref|XP_010277744.1|  PREDICTED: phospholipase A1-IIgamma-like           146   1e-37   Nelumbo nucifera [Indian lotus]
gb|KJB57431.1|  hypothetical protein B456_009G163800                    145   1e-37   Gossypium raimondii
ref|XP_010054329.1|  PREDICTED: phospholipase A1-IIgamma-like           146   1e-37   Eucalyptus grandis [rose gum]
gb|EAY75191.1|  hypothetical protein OsI_03083                          145   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010057070.1|  PREDICTED: phospholipase A1-IIgamma-like           146   2e-37   Eucalyptus grandis [rose gum]
ref|XP_008449390.1|  PREDICTED: phospholipase A1-IIgamma                146   2e-37   Cucumis melo [Oriental melon]
ref|XP_009601720.1|  PREDICTED: phospholipase A1-II 1-like              145   2e-37   Nicotiana tomentosiformis
emb|CDO96758.1|  unnamed protein product                                145   2e-37   Coffea canephora [robusta coffee]
gb|EMT15519.1|  Lipase                                                  145   2e-37   
ref|XP_004140112.1|  PREDICTED: phospholipase A1-IIgamma-like           145   3e-37   Cucumis sativus [cucumbers]
sp|A2WT95.2|PLA1_ORYSI  RecName: Full=Phospholipase A1-II 1             145   3e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_002522554.1|  triacylglycerol lipase, putative                   145   4e-37   
emb|CDO96757.1|  unnamed protein product                                143   8e-37   Coffea canephora [robusta coffee]
ref|XP_011045903.1|  PREDICTED: phospholipase A1-IIgamma                144   9e-37   Populus euphratica
ref|XP_002305750.2|  lipase class 3 family protein                      143   1e-36   Populus trichocarpa [western balsam poplar]
gb|EPS68355.1|  hypothetical protein M569_06415                         138   1e-36   Genlisea aurea
ref|XP_010686320.1|  PREDICTED: phospholipase A1-IIgamma-like           143   1e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010279086.1|  PREDICTED: phospholipase A1-IIgamma-like           142   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_006644442.1|  PREDICTED: phospholipase A1-II 1-like isofor...    142   3e-36   
ref|XP_006644443.1|  PREDICTED: phospholipase A1-II 1-like isofor...    142   4e-36   
ref|XP_009415331.1|  PREDICTED: phospholipase A1-II 5-like              142   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456057.1|  hypothetical protein SORBIDRAFT_03g029630          142   4e-36   
ref|XP_007025426.1|  Alpha/beta-Hydrolases superfamily protein          142   4e-36   
gb|EMS63185.1|  Phospholipase A1-II 1                                   145   6e-36   Triticum urartu
ref|XP_008675277.1|  PREDICTED: phospholipase A1-II 1                   141   9e-36   Zea mays [maize]
ref|XP_011074749.1|  PREDICTED: phospholipase A1-IIgamma                141   1e-35   Sesamum indicum [beniseed]
dbj|BAA89335.1|  EEF53                                                  136   1e-35   Solanum melongena [aubergine]
ref|XP_011027707.1|  PREDICTED: phospholipase A1-IIgamma-like           140   1e-35   Populus euphratica
ref|XP_006467671.1|  PREDICTED: phospholipase A1-IIgamma-like           140   1e-35   Citrus sinensis [apfelsine]
ref|XP_004969327.1|  PREDICTED: phospholipase A1-II 1-like              140   1e-35   
gb|EAZ12914.1|  hypothetical protein OsJ_02837                          139   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006449477.1|  hypothetical protein CICLE_v10015361mg             140   2e-35   Citrus clementina [clementine]
sp|A2WT96.2|PLA2_ORYSI  RecName: Full=Phospholipase A1-II 2             139   3e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_008675278.1|  PREDICTED: phospholipase A1-II 2-like              139   3e-35   Zea mays [maize]
ref|NP_001043730.2|  Os01g0651200                                       139   4e-35   
ref|XP_003569462.2|  PREDICTED: LOW QUALITY PROTEIN: putative pen...    143   4e-35   
dbj|BAD68802.1|  lipase-like protein                                    139   4e-35   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75192.1|  hypothetical protein OsI_03084                          139   4e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_009773996.1|  PREDICTED: phospholipase A1-II 1-like              139   6e-35   Nicotiana sylvestris
ref|XP_009415339.1|  PREDICTED: phospholipase A1-II 5-like              138   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518795.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    139   7e-35   Tarenaya hassleriana [spider flower]
ref|XP_009775805.1|  PREDICTED: phospholipase A1-IIgamma-like           138   9e-35   Nicotiana sylvestris
ref|XP_002316835.2|  lipase class 3 family protein                      138   9e-35   
ref|XP_004232943.1|  PREDICTED: phospholipase A1-II 1                   138   1e-34   Solanum lycopersicum
ref|XP_006646154.1|  PREDICTED: phospholipase A1-II 2-like              137   1e-34   
gb|KJB69607.1|  hypothetical protein B456_011G033600                    138   1e-34   Gossypium raimondii
ref|XP_011101305.1|  PREDICTED: phospholipase A1-II 1-like              138   1e-34   Sesamum indicum [beniseed]
ref|XP_004969328.1|  PREDICTED: phospholipase A1-II 2-like              138   1e-34   Setaria italica
ref|XP_002525127.1|  triacylglycerol lipase, putative                   137   2e-34   Ricinus communis
gb|KFK37116.1|  hypothetical protein AALP_AA4G215000                    136   2e-34   Arabis alpina [alpine rockcress]
ref|XP_006852476.1|  hypothetical protein AMTR_s00021p00129470          137   2e-34   
ref|XP_004134929.1|  PREDICTED: phospholipase A1-IIgamma-like           137   3e-34   
gb|EMS52156.1|  Phospholipase A1-II 2                                   136   3e-34   Triticum urartu
gb|EYU36835.1|  hypothetical protein MIMGU_mgv1a020546mg                137   3e-34   Erythranthe guttata [common monkey flower]
gb|KGN49294.1|  hypothetical protein Csa_6G519470                       137   4e-34   Cucumis sativus [cucumbers]
ref|XP_002456058.1|  hypothetical protein SORBIDRAFT_03g029640          137   4e-34   
ref|XP_006340582.1|  PREDICTED: phospholipase A1-IIgamma-like           136   4e-34   
ref|NP_001043734.1|  Os01g0651800                                       136   6e-34   
ref|XP_009795642.1|  PREDICTED: phospholipase A1-IIgamma-like           136   6e-34   Nicotiana sylvestris
sp|B9EYD3.2|PLA4_ORYSJ  RecName: Full=Phospholipase A1-II 4             135   7e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009628625.1|  PREDICTED: phospholipase A1-IIgamma-like           135   8e-34   Nicotiana tomentosiformis
ref|XP_002525129.1|  triacylglycerol lipase, putative                   135   9e-34   Ricinus communis
sp|A2WTA0.1|PLA3_ORYSI  RecName: Full=Phospholipase A1-II 3; Flag...    135   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_009619316.1|  PREDICTED: phospholipase A1-IIgamma-like           135   1e-33   Nicotiana tomentosiformis
ref|XP_010108436.1|  Phospholipase A1-IIgamma                           135   1e-33   Morus notabilis
dbj|BAH56866.1|  AT2G42690                                              135   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003566945.1|  PREDICTED: phospholipase A1-II 2-like              135   1e-33   
ref|XP_009777407.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    134   2e-33   Nicotiana sylvestris
ref|XP_009777406.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    134   2e-33   Nicotiana sylvestris
ref|NP_001056386.2|  Os05g0574000                                       130   2e-33   
ref|XP_006362431.1|  PREDICTED: phospholipase A1-II 1-like              134   2e-33   Solanum tuberosum [potatoes]
ref|XP_009131946.1|  PREDICTED: phospholipase A1-IIgamma-like           134   3e-33   Brassica rapa
ref|XP_009626666.1|  PREDICTED: phospholipase A1-IIgamma-like           134   3e-33   Nicotiana tomentosiformis
ref|XP_007153707.1|  hypothetical protein PHAVU_003G058100g             134   3e-33   Phaseolus vulgaris [French bean]
emb|CDX99456.1|  BnaC01g10960D                                          134   3e-33   
gb|KFK28527.1|  hypothetical protein AALP_AA7G008200                    134   3e-33   Arabis alpina [alpine rockcress]
gb|KCW89613.1|  hypothetical protein EUGRSUZ_A01896                     132   4e-33   Eucalyptus grandis [rose gum]
ref|XP_008647947.1|  PREDICTED: triacylglycerol lipase isoform X1       133   5e-33   
ref|XP_006362433.1|  PREDICTED: phospholipase A1-II 1-like              133   5e-33   Solanum tuberosum [potatoes]
ref|NP_001151242.1|  triacylglycerol lipase                             133   5e-33   
ref|XP_006362430.1|  PREDICTED: phospholipase A1-IIgamma-like           133   5e-33   Solanum tuberosum [potatoes]
ref|XP_010439839.1|  PREDICTED: phospholipase A1-IIgamma-like           134   6e-33   Camelina sativa [gold-of-pleasure]
ref|XP_004232965.1|  PREDICTED: phospholipase A1-IIgamma-like           132   9e-33   Solanum lycopersicum
ref|XP_009787871.1|  PREDICTED: phospholipase A1-IIgamma-like           133   9e-33   Nicotiana sylvestris
ref|XP_010070312.1|  PREDICTED: phospholipase A1-II 1                   133   1e-32   Eucalyptus grandis [rose gum]
ref|XP_006414089.1|  hypothetical protein EUTSA_v10025238mg             132   2e-32   Eutrema salsugineum [saltwater cress]
ref|XP_004232942.2|  PREDICTED: phospholipase A1-IIgamma-like           131   2e-32   
gb|EMT15520.1|  Feruloyl esterase A                                     134   2e-32   
ref|XP_006282609.1|  hypothetical protein CARUB_v10004827mg             132   3e-32   Capsella rubella
gb|EMT11182.1|  hypothetical protein F775_27795                         132   3e-32   
ref|XP_004231490.1|  PREDICTED: phospholipase A1-II 1                   131   3e-32   Solanum lycopersicum
emb|CDY53993.1|  BnaA03g58180D                                          130   3e-32   Brassica napus [oilseed rape]
ref|XP_002867985.1|  lipase class 3 family protein                      131   4e-32   
ref|XP_006654823.1|  PREDICTED: phospholipase A1-II 6-like              131   4e-32   Oryza brachyantha
ref|NP_193590.1|  phospholipase A1-IIgamma                              131   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006644445.1|  PREDICTED: phospholipase A1-II 3-like              131   5e-32   Oryza brachyantha
gb|EMT05279.1|  Lipase                                                  129   5e-32   
ref|XP_006364325.1|  PREDICTED: phospholipase A1-IIgamma-like           130   5e-32   Solanum tuberosum [potatoes]
gb|EEE64775.1|  hypothetical protein OsJ_19631                          130   8e-32   Oryza sativa Japonica Group [Japonica rice]
emb|CDY01554.1|  BnaC07g35440D                                          130   8e-32   
ref|XP_009414857.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    130   9e-32   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q6F358.1|PLA6_ORYSJ  RecName: Full=Phospholipase A1-II 6             130   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|EAY99121.1|  hypothetical protein OsI_21080                          130   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_010469763.1|  PREDICTED: phospholipase A1-IIbeta-like            130   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004232962.1|  PREDICTED: phospholipase A1-IIgamma-like           129   1e-31   Solanum lycopersicum
ref|XP_008439757.1|  PREDICTED: phospholipase A1-IIgamma                130   1e-31   Cucumis melo [Oriental melon]
ref|NP_001149813.1|  triacylglycerol lipase                             129   2e-31   Zea mays [maize]
gb|AFW79273.1|  hypothetical protein ZEAMMB73_515320                    129   2e-31   
gb|EMT07769.1|  hypothetical protein F775_18307                         126   2e-31   
emb|CDM85400.1|  unnamed protein product                                129   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001152663.1|  triacylglycerol lipase precursor                   129   2e-31   Zea mays [maize]
ref|XP_004232966.1|  PREDICTED: phospholipase A1-IIgamma-like           129   2e-31   Solanum lycopersicum
ref|XP_003565876.1|  PREDICTED: phospholipase A1-II 6-like              129   3e-31   
ref|XP_009389473.1|  PREDICTED: phospholipase A1-II 5-like              128   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010434518.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    129   3e-31   Camelina sativa [gold-of-pleasure]
gb|ABQ95989.1|  phospholipase A1                                        128   3e-31   Capsicum annuum
ref|XP_003528480.1|  PREDICTED: phospholipase A1-IIgamma-like           128   3e-31   Glycine max [soybeans]
ref|XP_004969332.1|  PREDICTED: phospholipase A1-II 3-like              129   4e-31   Setaria italica
emb|CDX76515.1|  BnaA08g08850D                                          128   4e-31   
ref|XP_003569464.1|  PREDICTED: phospholipase A1-II 3-like              128   5e-31   
ref|XP_002456062.1|  hypothetical protein SORBIDRAFT_03g029680          128   5e-31   Sorghum bicolor [broomcorn]
ref|XP_002440294.1|  hypothetical protein SORBIDRAFT_09g029220          127   6e-31   Sorghum bicolor [broomcorn]
ref|XP_004232964.1|  PREDICTED: phospholipase A1-IIgamma-like           127   7e-31   Solanum lycopersicum
gb|EMS68153.1|  Phospholipase A1-II 7                                   127   7e-31   Triticum urartu
ref|XP_006362432.1|  PREDICTED: phospholipase A1-IIgamma-like           127   7e-31   Solanum tuberosum [potatoes]
dbj|BAJ90094.1|  predicted protein                                      127   7e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006364324.1|  PREDICTED: phospholipase A1-IIgamma-like           127   8e-31   Solanum tuberosum [potatoes]
gb|AAC63840.1|  putative lipase                                         127   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646158.1|  PREDICTED: phospholipase A1-II 4-like              127   1e-30   Oryza brachyantha
ref|XP_010414181.1|  PREDICTED: phospholipase A1-IIbeta-like            127   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_002441554.1|  hypothetical protein SORBIDRAFT_09g029230          126   1e-30   
dbj|BAJ95995.1|  predicted protein                                      127   1e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT21704.1|  Putative lipase                                         127   1e-30   
ref|XP_010529190.1|  PREDICTED: phospholipase A1-IIgamma-like           127   1e-30   Tarenaya hassleriana [spider flower]
sp|O82274.2|PLA19_ARATH  RecName: Full=Phospholipase A1-IIbeta          126   2e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDP11819.1|  unnamed protein product                                126   2e-30   Coffea canephora [robusta coffee]
ref|XP_009408789.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    127   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011027708.1|  PREDICTED: phospholipase A1-IIgamma-like           126   2e-30   Populus euphratica
gb|KDP21364.1|  hypothetical protein JCGZ_21835                         127   2e-30   Jatropha curcas
ref|XP_004505625.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    127   3e-30   Cicer arietinum [garbanzo]
pdb|2YIJ|A  Chain A, Crystal Structure Of Phospholipase A1              126   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31237.1|  hypothetical protein AALP_AA6G086300                    125   3e-30   Arabis alpina [alpine rockcress]
ref|XP_003538937.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    126   4e-30   Glycine max [soybeans]
ref|XP_004961147.1|  PREDICTED: phospholipase A1-II 7-like              125   4e-30   Setaria italica
ref|XP_002881156.1|  hypothetical protein ARALYDRAFT_320861             125   4e-30   
ref|XP_003574515.1|  PREDICTED: phospholipase A1-II 7-like              125   4e-30   Brachypodium distachyon [annual false brome]
ref|XP_011032046.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    126   5e-30   Populus euphratica
ref|XP_006295721.1|  hypothetical protein CARUB_v10024849mg             125   5e-30   Capsella rubella
gb|EEE64776.1|  hypothetical protein OsJ_19632                          123   5e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008655140.1|  PREDICTED: triacylglycerol lipase isoform X1       129   5e-30   
gb|KEH23856.1|  phospholipase A1                                        125   6e-30   Medicago truncatula
ref|XP_010557125.1|  PREDICTED: phospholipase A1-IIbeta isoform X1      125   6e-30   Tarenaya hassleriana [spider flower]
ref|XP_004232956.1|  PREDICTED: phospholipase A1-II 1-like              125   6e-30   Solanum lycopersicum
ref|XP_010940258.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    125   6e-30   Elaeis guineensis
ref|XP_009108369.1|  PREDICTED: phospholipase A1-IIgamma                125   7e-30   Brassica rapa
ref|XP_009757707.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    124   7e-30   
ref|XP_008784887.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    125   7e-30   
ref|XP_010104408.1|  Phospholipase A1-IIdelta                           125   7e-30   
ref|XP_004168244.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    125   8e-30   
gb|EMT30117.1|  Mono- and diacylglycerol lipase                         125   8e-30   
ref|XP_009628626.1|  PREDICTED: phospholipase A1-IIgamma-like           124   8e-30   
gb|KJB57432.1|  hypothetical protein B456_009G163900                    124   9e-30   
ref|XP_010510242.1|  PREDICTED: phospholipase A1-IIbeta                 124   1e-29   
emb|CDM86668.1|  unnamed protein product                                124   1e-29   
gb|EYU46244.1|  hypothetical protein MIMGU_mgv1a004190mg                125   1e-29   
gb|ABK96341.1|  unknown                                                 124   1e-29   
ref|XP_003607369.1|  Lipase                                             124   1e-29   
ref|XP_011047800.1|  PREDICTED: phospholipase A1-II 4-like              124   1e-29   
ref|XP_004493749.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   2e-29   
ref|XP_004493750.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   2e-29   
ref|XP_007153706.1|  hypothetical protein PHAVU_003G058000g             123   2e-29   
ref|XP_002305084.2|  hypothetical protein POPTR_0004s05380g             123   2e-29   
ref|XP_010414252.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   2e-29   
ref|XP_010469840.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   2e-29   
tpg|DAA55829.1|  TPA: hypothetical protein ZEAMMB73_274435              119   3e-29   
ref|XP_010469841.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   3e-29   
ref|XP_009757709.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    123   3e-29   
ref|XP_004146954.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    124   3e-29   
emb|CDX84801.1|  BnaA03g14290D                                          123   3e-29   
ref|NP_001056387.1|  Os05g0574100                                       123   3e-29   
ref|XP_008674529.1|  PREDICTED: phospholipase A1-II 7-like              119   3e-29   
ref|XP_008227339.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    124   3e-29   
ref|XP_002891639.1|  lipase class 3 family protein                      124   3e-29   
ref|XP_009132769.1|  PREDICTED: phospholipase A1-IIbeta-like            123   3e-29   
gb|KDP22109.1|  hypothetical protein JCGZ_25940                         123   3e-29   
dbj|BAJ99811.1|  predicted protein                                      123   4e-29   
ref|XP_011047741.1|  PREDICTED: phospholipase A1-IIgamma-like           122   4e-29   
ref|XP_002313345.2|  hypothetical protein POPTR_0009s05660g             123   4e-29   
emb|CDY68806.1|  BnaA01g34930D                                          118   4e-29   
gb|EMT05578.1|  hypothetical protein F775_13080                         122   6e-29   
gb|EMS50697.1|  Phospholipase A1-II 1                                   121   7e-29   
gb|KFK42995.1|  hypothetical protein AALP_AA1G065900                    122   7e-29   
ref|XP_004232955.1|  PREDICTED: phospholipase A1-II 1-like isofor...    122   8e-29   
ref|XP_010316799.1|  PREDICTED: phospholipase A1-II 1-like isofor...    122   8e-29   
ref|NP_564590.1|  DAD1-like lipase 2                                    122   8e-29   
ref|XP_010686321.1|  PREDICTED: phospholipase A1-IIgamma-like           122   1e-28   
ref|XP_003567848.1|  PREDICTED: phospholipase A1-II 7-like              121   1e-28   
ref|XP_006362445.1|  PREDICTED: phospholipase A1-IIgamma-like           121   1e-28   
ref|XP_010108435.1|  Phospholipase A1-IIgamma                           121   1e-28   
ref|XP_004961148.1|  PREDICTED: phospholipase A1-II 6-like              121   1e-28   
ref|XP_010544180.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    122   1e-28   
ref|XP_010510341.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    122   2e-28   
gb|KFK35847.1|  hypothetical protein AALP_AA4G044700                    122   2e-28   
ref|XP_006576919.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    121   2e-28   
ref|XP_002438517.1|  hypothetical protein SORBIDRAFT_10g021250          120   2e-28   
ref|XP_006393053.1|  hypothetical protein EUTSA_v10011370mg             122   2e-28   
ref|XP_009399030.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    121   2e-28   
ref|XP_004232963.1|  PREDICTED: phospholipase A1-IIgamma-like           120   2e-28   
ref|XP_002879267.1|  lipase class 3 family protein                      121   3e-28   
ref|XP_010686472.1|  PREDICTED: phospholipase A1-II 1-like              120   3e-28   
ref|XP_008802654.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    120   3e-28   
ref|XP_010696586.1|  PREDICTED: phospholipase A1-IIgamma-like           120   3e-28   
ref|XP_002456959.1|  hypothetical protein SORBIDRAFT_03g046400          120   4e-28   
ref|XP_002488949.1|  hypothetical protein SORBIDRAFT_1306s002010        120   4e-28   
ref|NP_001132361.1|  uncharacterized protein LOC100193806 precursor     120   4e-28   
ref|XP_002440467.1|  hypothetical protein SORBIDRAFT_09g001420          119   5e-28   
ref|XP_010031778.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    120   5e-28   
ref|XP_004154680.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    120   5e-28   
ref|XP_006349747.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    120   5e-28   
ref|NP_001168256.1|  hypothetical protein                               119   5e-28   
gb|KDP31780.1|  hypothetical protein JCGZ_12241                         119   5e-28   
ref|XP_010938535.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    120   5e-28   
ref|XP_007209593.1|  hypothetical protein PRUPE_ppa011396mg             116   6e-28   
ref|XP_006428509.1|  hypothetical protein CICLE_v10011873mg             119   7e-28   
ref|XP_007211838.1|  hypothetical protein PRUPE_ppa004631mg             119   7e-28   
ref|XP_003608142.1|  Lipase                                             118   8e-28   
ref|XP_009399031.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    119   1e-27   
ref|XP_009142882.1|  PREDICTED: phospholipase A1-IIdelta-like           118   1e-27   
ref|XP_006410159.1|  hypothetical protein EUTSA_v10016488mg             119   1e-27   
gb|ABR16123.1|  unknown                                                 119   1e-27   
ref|XP_006491814.1|  PREDICTED: phospholipase A1-IIgamma-like           118   1e-27   
ref|XP_008655897.1|  PREDICTED: phospholipase A1-II 7-like              119   1e-27   
ref|XP_010496242.1|  PREDICTED: phospholipase A1-IIgamma                118   1e-27   
ref|XP_010679169.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    119   1e-27   
ref|XP_010518797.1|  PREDICTED: phospholipase A1-IIgamma-like           118   1e-27   
gb|AFK47098.1|  unknown                                                 118   1e-27   
ref|XP_011042424.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    119   2e-27   
tpg|DAA45463.1|  TPA: hypothetical protein ZEAMMB73_472202              118   2e-27   
ref|XP_006853094.1|  hypothetical protein AMTR_s00038p00116940          119   2e-27   
ref|XP_010938722.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    118   2e-27   
emb|CDY23963.1|  BnaC03g17280D                                          118   2e-27   
ref|XP_009603052.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    119   2e-27   
ref|XP_004139114.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    118   2e-27   
ref|XP_002306818.1|  hypothetical protein POPTR_0005s24000g             118   2e-27   
ref|XP_006293988.1|  hypothetical protein CARUB_v10022980mg             118   2e-27   
emb|CDY29665.1|  BnaA04g17620D                                          118   3e-27   
gb|KGN66495.1|  hypothetical protein Csa_1G614650                       118   3e-27   
ref|XP_006410236.1|  hypothetical protein EUTSA_v10016726mg             117   3e-27   
ref|XP_009141072.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    118   3e-27   
gb|KJB35773.1|  hypothetical protein B456_006G127600                    118   3e-27   
emb|CDY34061.1|  BnaC03g62710D                                          117   3e-27   
ref|XP_010558870.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    118   4e-27   
ref|XP_010274199.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    118   4e-27   
gb|ABR17156.1|  unknown                                                 117   4e-27   
ref|XP_009782117.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    117   4e-27   
emb|CDX97819.1|  BnaC04g41200D                                          117   4e-27   
ref|XP_004505133.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    116   5e-27   
ref|XP_008238422.1|  PREDICTED: phospholipase A1-IIgamma-like           116   5e-27   
gb|ACJ76846.1|  chloroplast lipase protein                              117   5e-27   
ref|XP_001781080.1|  predicted protein                                  116   5e-27   
ref|XP_007131548.1|  hypothetical protein PHAVU_011G022500g             117   6e-27   
ref|XP_004232958.1|  PREDICTED: phospholipase A1-II 1-like              116   6e-27   
emb|CDY10228.1|  BnaC05g04710D                                          117   6e-27   
ref|NP_565701.1|  phospholipase A1-Igamma2                              117   6e-27   
ref|XP_008450415.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    117   7e-27   
ref|XP_006420095.1|  hypothetical protein CICLE_v10006964mg             117   7e-27   
ref|XP_007034959.1|  Alpha/beta-Hydrolases superfamily protein, p...    117   7e-27   
gb|KDO53917.1|  hypothetical protein CISIN_1g048560mg                   116   7e-27   
ref|XP_004505132.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    116   7e-27   
ref|XP_010278159.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    117   8e-27   
ref|XP_009119028.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    117   8e-27   
ref|XP_004301748.1|  PREDICTED: phospholipase A1-IIgamma-like           115   9e-27   
ref|NP_849603.1|  phospholipase A1-Igamma1                              116   1e-26   
gb|AFW74936.1|  hypothetical protein ZEAMMB73_664132                    115   1e-26   
ref|XP_008238421.1|  PREDICTED: phospholipase A1-IIgamma-like           115   1e-26   
ref|XP_010522024.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    116   1e-26   
ref|XP_003518894.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    116   1e-26   
ref|XP_008648636.1|  PREDICTED: phospholipase A1-II 7-like              115   1e-26   
ref|XP_008656338.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    117   1e-26   
gb|KFK42950.1|  hypothetical protein AALP_AA1G060100                    115   2e-26   
ref|XP_006428645.1|  hypothetical protein CICLE_v10011864mg             115   2e-26   
ref|XP_010500719.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    116   2e-26   
ref|XP_002302074.2|  hypothetical protein POPTR_0002s04560g             115   2e-26   
emb|CDY10187.1|  BnaC05g04300D                                          115   2e-26   
ref|XP_009119078.1|  PREDICTED: phospholipase A1-IIalpha                115   2e-26   
ref|XP_008648833.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    115   2e-26   
ref|XP_006470637.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    115   3e-26   
ref|XP_006446147.1|  hypothetical protein CICLE_v10014848mg             115   3e-26   
ref|XP_004146952.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    115   3e-26   
ref|XP_010102366.1|  Phospholipase A1-Igamma3                           115   3e-26   
ref|XP_006362439.1|  PREDICTED: phospholipase A1-IIgamma-like           114   3e-26   
ref|XP_002437873.1|  hypothetical protein SORBIDRAFT_10g004170          115   3e-26   
emb|CDP03693.1|  unnamed protein product                                114   3e-26   
ref|XP_006374296.1|  hypothetical protein POPTR_0015s05770g             114   3e-26   
ref|XP_010457831.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    115   3e-26   
ref|XP_010457830.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    114   3e-26   
ref|XP_010461974.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    115   4e-26   
ref|XP_007210039.1|  hypothetical protein PRUPE_ppa017270mg             114   4e-26   
emb|CDY57813.1|  BnaA10g28020D                                          115   4e-26   
ref|XP_011005460.1|  PREDICTED: phospholipase A1-II 4-like              114   5e-26   
ref|XP_008355592.1|  PREDICTED: phospholipase A1-IIgamma-like           112   5e-26   
ref|XP_004962195.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    115   5e-26   
ref|XP_008451272.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    114   5e-26   
ref|XP_007025432.1|  Alpha/beta-Hydrolases superfamily protein, p...    114   6e-26   
ref|XP_006374295.1|  hypothetical protein POPTR_0015s05760g             114   6e-26   
ref|XP_006417878.1|  hypothetical protein EUTSA_v10007393mg             114   6e-26   
ref|XP_003518893.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    114   6e-26   
ref|XP_003608120.1|  Lipase                                             113   7e-26   
ref|XP_011026041.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    114   8e-26   
gb|EYU19151.1|  hypothetical protein MIMGU_mgv1a006227mg                113   8e-26   
ref|XP_010279084.1|  PREDICTED: phospholipase A1-II 1-like isofor...    113   9e-26   
ref|XP_008783171.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    114   9e-26   
ref|XP_010279085.1|  PREDICTED: phospholipase A1-IIgamma-like iso...    113   1e-25   
ref|XP_008372307.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    114   1e-25   
ref|XP_010657149.1|  PREDICTED: phospholipase A1-IIgamma-like           113   1e-25   
ref|XP_010479626.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    114   1e-25   
ref|XP_008346158.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    114   1e-25   
emb|CBI21954.3|  unnamed protein product                                113   1e-25   
ref|XP_008355590.1|  PREDICTED: phospholipase A1-IIgamma-like           111   1e-25   
ref|XP_002892359.1|  lipase class 3 family protein                      114   1e-25   
ref|XP_008451275.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    114   1e-25   
ref|XP_009354875.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    114   1e-25   
emb|CAN83233.1|  hypothetical protein VITISV_005768                     113   1e-25   
ref|XP_009333706.1|  PREDICTED: phospholipase A1-IIgamma-like           112   1e-25   
ref|XP_006417941.1|  hypothetical protein EUTSA_v10007767mg             112   1e-25   
ref|XP_002285367.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    113   2e-25   
ref|XP_007162494.1|  hypothetical protein PHAVU_001G156900g             113   2e-25   
gb|KJB22934.1|  hypothetical protein B456_004G074700                    113   2e-25   
ref|XP_006307213.1|  hypothetical protein CARUB_v10008812mg             113   2e-25   
gb|KJB22933.1|  hypothetical protein B456_004G074700                    113   2e-25   
dbj|BAJ85084.1|  predicted protein                                      112   2e-25   
ref|XP_010927018.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    113   2e-25   
ref|XP_010475428.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    112   3e-25   
ref|XP_008345355.1|  PREDICTED: phospholipase A1-IIgamma-like           112   3e-25   
ref|XP_002455039.1|  hypothetical protein SORBIDRAFT_03g003410          112   3e-25   
gb|KHN32323.1|  Phospholipase A1-Igamma1, chloroplastic                 110   3e-25   
ref|XP_002437113.1|  hypothetical protein SORBIDRAFT_10g021260          111   4e-25   
ref|XP_007050417.1|  Alpha/beta-Hydrolases superfamily protein          112   4e-25   
ref|XP_009147767.1|  PREDICTED: phospholipase A1-Igamma3, chlorop...    112   4e-25   
gb|AFW75599.1|  hypothetical protein ZEAMMB73_741719                    114   4e-25   
emb|CDY49813.1|  BnaC06g04560D                                          112   5e-25   
ref|XP_010475356.1|  PREDICTED: phospholipase A1-IIalpha-like           111   6e-25   
ref|XP_006307284.1|  hypothetical protein CARUB_v10008898mg             112   6e-25   
ref|XP_010501341.1|  PREDICTED: phospholipase A1-IIalpha-like           111   6e-25   
ref|XP_011005461.1|  PREDICTED: phospholipase A1-IIgamma-like           110   6e-25   
ref|XP_007144693.1|  hypothetical protein PHAVU_007G177100g             111   6e-25   
emb|CDY22842.1|  BnaA06g02350D                                          111   7e-25   
ref|XP_006306316.1|  hypothetical protein CARUB_v10012192mg             110   7e-25   
gb|KCW74061.1|  hypothetical protein EUGRSUZ_E02689                     110   7e-25   
emb|CDX86530.1|  BnaC08g01730D                                          110   9e-25   
gb|KEH23857.1|  phospholipase A1                                        110   9e-25   
ref|XP_011096641.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    111   9e-25   
ref|XP_010058981.1|  PREDICTED: phospholipase A1-IIgamma-like           110   1e-24   
gb|KJB42205.1|  hypothetical protein B456_007G142100                    111   1e-24   
gb|EMS63790.1|  Phospholipase A1-II 7                                   111   1e-24   
ref|XP_004289898.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    111   1e-24   
ref|XP_007025431.1|  Alpha/beta-Hydrolases superfamily protein          110   1e-24   
ref|XP_003532708.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    110   1e-24   
ref|XP_009367748.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    110   1e-24   
ref|XP_006469038.1|  PREDICTED: LOW QUALITY PROTEIN: phospholipas...    110   1e-24   
ref|XP_009384367.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    110   1e-24   
emb|CBI30963.3|  unnamed protein product                                108   1e-24   
ref|XP_003518892.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    110   1e-24   
ref|XP_010457749.1|  PREDICTED: phospholipase A1-IIalpha                110   1e-24   
gb|EEE55096.1|  hypothetical protein OsJ_02844                          108   2e-24   
tpg|DAA53108.1|  TPA: hypothetical protein ZEAMMB73_566262              109   2e-24   
ref|XP_009110999.1|  PREDICTED: phospholipase A1-IIalpha-like           109   2e-24   
gb|EMT07991.1|  Lipase                                                  110   2e-24   
ref|XP_008451639.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    110   2e-24   
gb|KCW75867.1|  hypothetical protein EUGRSUZ_D00253                     108   3e-24   
gb|KDP21366.1|  hypothetical protein JCGZ_21837                         109   3e-24   
emb|CAN74039.1|  hypothetical protein VITISV_012945                     109   3e-24   
ref|XP_003528482.1|  PREDICTED: phospholipase A1-IIgamma-like           108   3e-24   
ref|XP_002281907.1|  PREDICTED: phospholipase A1-Igamma2, chlorop...    109   3e-24   
ref|XP_010052014.1|  PREDICTED: phospholipase A1-Igamma1, chlorop...    109   3e-24   
ref|XP_006443915.1|  hypothetical protein CICLE_v10019700mg             109   4e-24   



>ref|XP_009629724.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana tomentosiformis]
Length=453

 Score =   285 bits (730),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 155/178 (87%), Gaps = 0/178 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA+LATLA+FD+ ENGVTDIPV+AIVFGSPQ+GN+ F++ + E +NLKILH++NKI
Sbjct  276  GHSLGASLATLAAFDVVENGVTDIPVSAIVFGSPQVGNKAFNEKIKEYSNLKILHVKNKI  335

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+IP YP ALLGY  +G E VID RKS  LK S +TGDWHNLQ MLHVVAGWNGED+EFE
Sbjct  336  DLIPLYPSALLGYANTGTELVIDSRKSPSLKDSRDTGDWHNLQGMLHVVAGWNGEDKEFE  395

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            L+VKR VALVNKS  FL++E LIPGSWWVEKN+SMVLDENGE ++A P+DEDLPVPEY
Sbjct  396  LQVKRSVALVNKSSSFLKDEYLIPGSWWVEKNRSMVLDENGEWIMAPPSDEDLPVPEY  453



>ref|XP_009766306.1| PREDICTED: phospholipase A1-IIdelta-like [Nicotiana sylvestris]
Length=470

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/178 (74%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA+LATLA+FD+ ENGVTDIPV+AIVFGSPQ+GN+ F++ + E +NL ILH++NKI
Sbjct  293  GHSLGASLATLAAFDVVENGVTDIPVSAIVFGSPQVGNKAFNEKIKEYSNLNILHVKNKI  352

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+I  YP ALLGY  +G E VID RKS  LK S +TGDWHNLQ MLHVVAGWNGED+EFE
Sbjct  353  DLITLYPSALLGYANTGTELVIDSRKSPSLKDSRDTGDWHNLQGMLHVVAGWNGEDKEFE  412

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            LKVKR VALVNKS  FL++E LIPGSWWVEKN+SMVLDENGE +LA P+DEDLPVPEY
Sbjct  413  LKVKRSVALVNKSSSFLKDEYLIPGSWWVEKNRSMVLDENGEWILAPPSDEDLPVPEY  470



>gb|KDO63393.1| hypothetical protein CISIN_1g014927mg [Citrus sinensis]
Length=416

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGA+L+ L++FDL ENGVTDIPV A VFG PQ+GN+ F++ +   TN+K+LH+R
Sbjct  236  IFTGHSLGASLSILSAFDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVR  295

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+I  YPG LLGYV +G E VID RKS  LK+S+N  DWHNLQAMLHVVAGWNG+D 
Sbjct  296  NTIDLITHYPGRLLGYVNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDG  355

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFELKVKR +ALVNKSCEFL++ELL+PGSW VEKNK MV DE+GE VLA P DEDLPVPE
Sbjct  356  EFELKVKRSLALVNKSCEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPE  415

Query  139  Y  137
            +
Sbjct  416  F  416



>ref|XP_006468997.1| PREDICTED: phospholipase A1-IIdelta-like [Citrus sinensis]
Length=416

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGA+L+ L++FDL ENGVTDIPV A VFG PQ+GN+ F++ +   TN+K+LH+R
Sbjct  236  IFTGHSLGASLSILSAFDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVR  295

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+I  YPG LLGYV +G E VID RKS  LK+S+N  DWHNLQAMLHVVAGWNG+D 
Sbjct  296  NTIDLITHYPGRLLGYVNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDG  355

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFELKVKR +ALVNKSCEFL++ELL+PGSW VEKNK MV DE+GE VLA P DEDLPVPE
Sbjct  356  EFELKVKRSLALVNKSCEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPE  415

Query  139  Y  137
            +
Sbjct  416  F  416



>ref|XP_006446810.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
 gb|ESR60050.1| hypothetical protein CICLE_v10015386mg [Citrus clementina]
Length=416

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I+ GHSLGA L+ L++FDL ENGVTDIPV A VFG PQ+GN+ F++ +   TN+K+LH+R
Sbjct  236  ILTGHSLGACLSILSAFDLAENGVTDIPVAAFVFGCPQVGNKAFNERLKSYTNVKVLHVR  295

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+I  YPG LLGYV +G E VID RKS  LK+S+N  DWHNLQAMLHVVAGWNG+D 
Sbjct  296  NTIDLITHYPGRLLGYVNTGTELVIDTRKSPSLKESVNPSDWHNLQAMLHVVAGWNGDDG  355

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFELKVKR +ALVNKSCEFL++ELL+PGSW VEKNK MV DE+GE VLA P DEDLPVPE
Sbjct  356  EFELKVKRSLALVNKSCEFLKDELLVPGSWCVEKNKGMVRDEDGEWVLAPPTDEDLPVPE  415

Query  139  Y  137
            +
Sbjct  416  F  416



>ref|XP_004251807.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum lycopersicum]
Length=410

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 149/179 (83%), Gaps = 1/179 (1%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGV-TDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNK  494
            GHSLGA+LA LASFD+ ENGV  DIPV+AIVFGSPQ+GN+ F++ + + +NL ILH++NK
Sbjct  232  GHSLGASLAVLASFDVVENGVPVDIPVSAIVFGSPQVGNKAFNERIKKFSNLNILHVKNK  291

Query  493  IDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREF  314
            ID+I  YP AL GYV SG+E VID RKS  LK S + GDWHNLQ MLHVVAGWNGED++F
Sbjct  292  IDLITLYPSALFGYVNSGIELVIDSRKSPSLKDSKDMGDWHNLQGMLHVVAGWNGEDKKF  351

Query  313  ELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            ELKVKR VALVNKS  FL+++ LIPGSWW+EKN+ MV D+NGE +LA P+DEDLPVPEY
Sbjct  352  ELKVKRSVALVNKSSSFLKDDYLIPGSWWIEKNRGMVFDKNGEWILAPPSDEDLPVPEY  410



>ref|XP_011028053.1| PREDICTED: phospholipase A1-IIdelta [Populus euphratica]
Length=413

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGA+L+ L++FDL ENG+TDIPV+A VFGSPQ+GN+ F++   +  NLK++HI+
Sbjct  233  IFTGHSLGASLSILSAFDLVENGITDIPVSAFVFGSPQVGNKEFNERFNKYPNLKVMHIK  292

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            NKID+IP YPG L+GY  +G+EF ID RKS  LK S N  DWHNLQAMLH+VAGWNGE++
Sbjct  293  NKIDVIPHYPGRLMGYASTGIEFEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEEQ  352

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            +FELKVKR +ALVNKSCEFL +E L+PG WWVEKNK MV +E+G+ VLA P++EDLPVPE
Sbjct  353  DFELKVKRSLALVNKSCEFLNDECLVPGIWWVEKNKGMVRNEDGDWVLAPPDEEDLPVPE  412

Query  139  Y  137
            Y
Sbjct  413  Y  413



>ref|XP_002303465.1| lipase family protein [Populus trichocarpa]
 gb|EEE78444.1| lipase family protein [Populus trichocarpa]
Length=411

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGA+L+ L++FDL ENG+TDIPV+A VFGSPQ+GN+ F++   +  NLK+LHI+
Sbjct  231  IFTGHSLGASLSILSAFDLVENGITDIPVSAFVFGSPQVGNKEFNERFNKYPNLKVLHIK  290

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            NKID+IP YPG L+GYV +G+EF ID RKS  LK S N  DWHNLQAMLH+VAGWNGE++
Sbjct  291  NKIDVIPHYPGRLMGYVYTGIEFEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEEQ  350

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFELKVKR +ALVNKS EFL++E L+PG WWVEKNK MV +E+GE VLA P++EDLPVPE
Sbjct  351  EFELKVKRSLALVNKSSEFLKDECLVPGIWWVEKNKGMVRNEDGEWVLAPPDEEDLPVPE  410



>ref|XP_006350025.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=412

 Score =   262 bits (670),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/179 (69%), Positives = 148/179 (83%), Gaps = 1/179 (1%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGV-TDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNK  494
            GHSLGA+LA LASFD+ ENGV  DIPV+AIVFGSPQ+GN+ F++ + +  NL ILH++NK
Sbjct  234  GHSLGASLAVLASFDVVENGVPADIPVSAIVFGSPQVGNKAFNERIKKFPNLNILHVKNK  293

Query  493  IDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREF  314
            ID+IP YP AL GYV SG++ VID RKS  LK S   GDWHNLQ MLHVVAGWNGED++F
Sbjct  294  IDLIPLYPSALFGYVNSGIDLVIDSRKSPSLKDSKVAGDWHNLQGMLHVVAGWNGEDKKF  353

Query  313  ELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            ELKVKR VALVNKS   L++E LIPGSWW+EKNK MV+D+NGE +LA P++EDLPVPEY
Sbjct  354  ELKVKRSVALVNKSSSLLKDEYLIPGSWWIEKNKGMVIDKNGEWILAPPSEEDLPVPEY  412



>ref|XP_006348881.1| PREDICTED: phospholipase A1-IIdelta-like [Solanum tuberosum]
Length=488

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGATL+ LA+FDL ENGVTDIPV+AI+FGSPQ+GN+ F+  + E  NLKILH++NKI
Sbjct  234  GHSLGATLSILAAFDLVENGVTDIPVSAIIFGSPQVGNRAFNDKLKEFPNLKILHVKNKI  293

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+IP YP +LLGYV SG+E VID RKS  LK S N  DWHNLQAMLH++AGWNGE+ EFE
Sbjct  294  DVIPLYPSSLLGYVNSGIELVIDTRKSPSLKDSKNPSDWHNLQAMLHIIAGWNGENGEFE  353

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            +KVKR +ALVNKS   L++++LIPGSWWVEKNK +VLDE+GE +LA P DED+P+PE
Sbjct  354  MKVKRSLALVNKSSSILKDDILIPGSWWVEKNKGVVLDEDGEWILAPPLDEDIPIPE  410



>gb|EPS65211.1| hypothetical protein M569_09564 [Genlisea aurea]
Length=417

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+LA +A+FDL ENGV DIPV AIVFGSPQ+GN  F + + +  NLKILH+RN
Sbjct  238  LTGHSLGASLAIVAAFDLVENGVADIPVAAIVFGSPQVGNGAFKRRVEKFPNLKILHVRN  297

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
            KID+IP YPG +LGY   G+EF ID+RKS  LK S N  DWHNLQAMLH VAGWNGE  E
Sbjct  298  KIDVIPHYPGRVLGYAPVGVEFQIDNRKSPSLKHSKNPSDWHNLQAMLHTVAGWNGEKGE  357

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR  ALVNKS   L +ELLIPGSWW+EKNK M+LDENG+ VL+ P DED+P PE+
Sbjct  358  FELKVKRSAALVNKSAAILNDELLIPGSWWIEKNKGMILDENGDWVLSPPADEDMPTPEF  417



>ref|XP_003540985.1| PREDICTED: phospholipase A1-IIdelta-like, partial [Glycine max]
Length=268

 Score =   254 bits (650),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGATL+ +++FDL ENGVT++PVTAIVFGSPQ+GN+ F++      NLK+LH++
Sbjct  87   VIVGHSLGATLSIVSAFDLVENGVTEVPVTAIVFGSPQVGNKAFNERFNMFPNLKVLHVK  146

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY   G E VID RKS  LK S N GDWHNLQAMLHVVAGWNG+  
Sbjct  147  NVIDLIPHYPGKLLGYEYMGTELVIDTRKSPSLKDSRNPGDWHNLQAMLHVVAGWNGKKE  206

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFE++VKR VALVNKSCEFL+EE  +PGSWWVEKNK MV  E+GE VL +P++ED+PV E
Sbjct  207  EFEMRVKRSVALVNKSCEFLKEEYGVPGSWWVEKNKGMVKREDGEWVLDAPDEEDVPVLE  266



>ref|XP_004303191.1| PREDICTED: phospholipase A1-IIdelta [Fragaria vesca subsp. vesca]
Length=453

 Score =   260 bits (665),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+LA ++ FDL ENGVTDIPV A VFG PQ+GN+ F   +    NL+I+HI+N
Sbjct  274  LTGHSLGASLAVVSGFDLVENGVTDIPVAAFVFGCPQVGNKAFKTRISTHPNLRIMHIKN  333

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             IDMIP YPG LLGY   G + VID RKS  LK S + GDWHNLQAMLHVVAGWNGE+ E
Sbjct  334  TIDMIPHYPGRLLGYRNIGTDVVIDTRKSPYLKDSKDPGDWHNLQAMLHVVAGWNGEEGE  393

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR VALVNKSC+FL+ E  +P  WWVEKNK MV DENGE VLA P DEDLPVPEY
Sbjct  394  FELKVKRSVALVNKSCDFLKTECSVPALWWVEKNKGMVRDENGEWVLAPPADEDLPVPEY  453



>gb|KDP47123.1| hypothetical protein JCGZ_22119 [Jatropha curcas]
Length=416

 Score =   258 bits (660),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGA+L+ LA+FD+ ENG+TDIPV A VFGSPQ+GN+ F++   +  NLK+LHIR
Sbjct  236  IFTGHSLGASLSILAAFDIVENGITDIPVAAFVFGSPQVGNKAFNERFKKYGNLKVLHIR  295

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            NKID+IP YPG L+GY  +G E  ID RKS  LK S N  DWHNLQAMLH+VAGWNGED+
Sbjct  296  NKIDVIPHYPGRLMGYQYTGTELEIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEDK  355

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
             F+L+VKR +ALVNKSCEFL++E ++PGSWW+EKNK MV  E+GE  L  P++ED PVPE
Sbjct  356  AFKLQVKRSLALVNKSCEFLKDECMVPGSWWIEKNKGMVRGEDGEWALVPPDEEDKPVPE  415

Query  139  Y  137
            Y
Sbjct  416  Y  416



>ref|XP_009593784.1| PREDICTED: phospholipase A1-IIdelta [Nicotiana tomentosiformis]
Length=483

 Score =   260 bits (665),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 149/177 (84%), Gaps = 0/177 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA+L+ LA+FDL ENGVTDIPV+AI+FGSPQ+GN+ F++ + +  NLKILH++NKI
Sbjct  234  GHSLGASLSILAAFDLVENGVTDIPVSAIIFGSPQVGNKAFNERLKKFPNLKILHVKNKI  293

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+I  YP +LLGYV SG+E VID RKS  LK + N  DWHNLQAMLH+VAGWNGE+ EFE
Sbjct  294  DLITHYPSSLLGYVNSGIELVIDTRKSPSLKDTKNPSDWHNLQAMLHIVAGWNGENEEFE  353

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            LKVKR +ALVNKS   L++E+LIPGSWWVEKNK +VL E+GE +LA P+DED+P+PE
Sbjct  354  LKVKRSLALVNKSSSILKDEILIPGSWWVEKNKGVVLAEDGEWILAPPSDEDIPIPE  410



>gb|EYU41122.1| hypothetical protein MIMGU_mgv1a021036mg [Erythranthe guttata]
Length=418

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+LA L++FDL ENGV +IPV+AIVFGSPQ+GN+ F+  + +  NLK+LH+RN
Sbjct  239  LTGHSLGASLAILSAFDLVENGVDNIPVSAIVFGSPQVGNKAFNDRVLDFANLKVLHVRN  298

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
            KID+IP YP  LLGY  +G+E V+D RKS  LK S + GDWHNLQA+LHVVAGWNG+D E
Sbjct  299  KIDLIPLYPSGLLGYRNTGIELVVDGRKSPSLKDSKSPGDWHNLQAILHVVAGWNGDDGE  358

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR +ALVNKS   L++E LIPGSWW+EKNK +VLDE+GE VLA P+DED PVPE+
Sbjct  359  FELKVKRSLALVNKSSAILKDEYLIPGSWWIEKNKGLVLDEDGEWVLAPPSDEDQPVPEF  418



>gb|KHN34242.1| Phospholipase A1-IIdelta [Glycine soja]
Length=275

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGATL+ +++FDL ENGVT+ PVTAIVFGSPQ+GN+ F++      NLK+LH++
Sbjct  94   VIVGHSLGATLSIVSAFDLVENGVTEAPVTAIVFGSPQVGNKAFNERFNMFPNLKVLHVK  153

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY   G E VID RKS  LK S N GDWHNLQAMLHVVAGWNG+  
Sbjct  154  NVIDLIPHYPGKLLGYEYMGTELVIDTRKSPSLKDSRNPGDWHNLQAMLHVVAGWNGKKE  213

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFE++VKR VALVNKSCEFL+EE  +PGSWWVEKNK MV  E+GE VL +P++ED+PV E
Sbjct  214  EFEMRVKRSVALVNKSCEFLKEEYGVPGSWWVEKNKGMVKREDGEWVLDAPDEEDVPVLE  273



>emb|CDO98286.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   257 bits (656),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 143/178 (80%), Gaps = 0/178 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA+L+ LA+FDL ENG+ DIPV AIVFGSPQ+GN+ F+  + +  NLK+LH+RNKI
Sbjct  240  GHSLGASLSILAAFDLVENGLHDIPVAAIVFGSPQVGNKTFNNRLKQFPNLKVLHVRNKI  299

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+IP YP  LLGY  SG+E VID RKS  LK S N  DWHNLQAMLHVVAGWN    +FE
Sbjct  300  DLIPHYPSHLLGYHNSGIELVIDTRKSPFLKDSKNPSDWHNLQAMLHVVAGWNAAHGDFE  359

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            LKVKR +ALVNKSC FL++E L+P SWW+EKNK MVLDENG  ++A+P DEDLPVPE+
Sbjct  360  LKVKRSLALVNKSCGFLKDECLVPESWWIEKNKGMVLDENGGWIVATPADEDLPVPEH  417



>ref|XP_004243279.1| PREDICTED: phospholipase A1-IIdelta [Solanum lycopersicum]
Length=469

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 147/177 (83%), Gaps = 0/177 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA+L+ LA+FDL ENGVTDIPV+AIVFGSPQ+GN+ F+  + E  NLKILH++NKI
Sbjct  222  GHSLGASLSILAAFDLVENGVTDIPVSAIVFGSPQVGNRAFNDKLKEFPNLKILHVKNKI  281

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+I  YP +LLGYV SG+E VID RKS  LK S N  DWHNLQAMLH++AGWNGE  EFE
Sbjct  282  DVITLYPSSLLGYVNSGIELVIDTRKSPCLKDSKNPSDWHNLQAMLHIIAGWNGEHGEFE  341

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            +KVKR +ALVNKS   L++E+LIPGSWWVEKNK +VLDE+GE +LA P +ED+P+PE
Sbjct  342  MKVKRSLALVNKSSSMLKDEILIPGSWWVEKNKGVVLDEDGEWILAPPLEEDIPIPE  398



>ref|XP_008348571.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=442

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            V GHSLGA+LA L++FDL ENGV+DIPV A VFGSPQ+GN+ F   + +  NLKILH RN
Sbjct  262  VTGHSLGASLAILSAFDLVENGVSDIPVAAFVFGSPQVGNKAFKARIEKYPNLKILHTRN  321

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP  LLGYV  G E VID RKS  LK+S + GDWHNLQ MLHVVAGWNGE+ E
Sbjct  322  TIDLIPLYPSPLLGYVDVGTELVIDSRKSPFLKESKDAGDWHNLQGMLHVVAGWNGEEGE  381

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESVLASPNDEDLPVPE  140
            F+L+VKR VALVNKS  FL++E  +P SWWVEKNK MVLDE +GE VLA P+DEDLPVPE
Sbjct  382  FKLRVKRSVALVNKSSNFLKKECFVPASWWVEKNKGMVLDESSGEWVLAPPSDEDLPVPE  441

Query  139  Y  137
            +
Sbjct  442  F  442



>ref|XP_010052794.1| PREDICTED: phospholipase A1-IIdelta [Eucalyptus grandis]
 gb|KCW89651.1| hypothetical protein EUGRSUZ_A01923 [Eucalyptus grandis]
Length=452

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+L+ L+ FD+ ENGV DIPV+A VFGSPQ+GN+ F +      NLK LHIRN
Sbjct  273  LTGHSLGASLSILSGFDIVENGVRDIPVSAFVFGSPQVGNKAFAERCKSYPNLKFLHIRN  332

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP  LLGYV SG+E  ID RKS  LK S N  DWHNLQAMLH+VAGWNGED E
Sbjct  333  TIDLIPHYPSKLLGYVYSGVELEIDTRKSPNLKDSKNPSDWHNLQAMLHIVAGWNGEDGE  392

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR +ALVNKSC+FL+ E L+P SWWVEKNK MVLDE+GE V+ S  DEDLPVPE+
Sbjct  393  FELKVKRSLALVNKSCDFLKPECLVPPSWWVEKNKGMVLDEDGEWVMGSLADEDLPVPEF  452



>gb|EYU41119.1| hypothetical protein MIMGU_mgv1a025698mg [Erythranthe guttata]
Length=408

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+LA L+ FDL ENGV DIPV+AIVFGSPQIGN  F+K +    NLK+LH++N
Sbjct  229  LTGHSLGASLAILSGFDLVENGVRDIPVSAIVFGSPQIGNHAFNKRLLRYPNLKVLHVKN  288

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
            KID+IP YP AL GY  +G+E  +D+RKS  LK S N  DWHNLQA+LHVVAGWNG D E
Sbjct  289  KIDLIPRYPSALFGYKDTGIELEVDNRKSPSLKDSKNPSDWHNLQAILHVVAGWNGADGE  348

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR +ALVNKS   L++E L+PGSWWVEKN+ +VLDE+G+ VLA  +DED PVPE+
Sbjct  349  FELKVKRSLALVNKSSAILKDEYLVPGSWWVEKNRGLVLDEDGDWVLAPTSDEDHPVPEF  408



>ref|XP_002518706.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF43631.1| triacylglycerol lipase, putative [Ricinus communis]
Length=417

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGA+L+ LA+FDL ENGV DIPV A+VFGSPQ+GN+ F+    + +NLK+LHI+
Sbjct  237  LLTGHSLGASLSILAAFDLVENGVADIPVAALVFGSPQVGNKAFNDRFKKHSNLKVLHIK  296

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N+ID IP YPG LLGY  +G E  ID RKS  LK S N  DWHNLQAMLH+VAGWNG+  
Sbjct  297  NQIDAIPHYPGRLLGYEYTGTELEIDTRKSPSLKGSKNPSDWHNLQAMLHIVAGWNGDKE  356

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
             FELKVKR +ALVNKSC FL++E L+PGSWWVEKN+ MV  ++GE  LA  ++ED PVPE
Sbjct  357  PFELKVKRSLALVNKSCAFLKDECLVPGSWWVEKNRGMVRGDDGEWTLAPADEEDRPVPE  416

Query  139  Y  137
            Y
Sbjct  417  Y  417



>emb|CDP15943.1| unnamed protein product [Coffea canephora]
Length=414

 Score =   250 bits (638),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGA L+ L++FDL ENGVTDIPV+AIVFGSPQ+GN+ F+  + E  NLKILH++NKI
Sbjct  237  GHSLGAALSILSAFDLVENGVTDIPVSAIVFGSPQVGNKAFNDRVLEFPNLKILHVKNKI  296

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+IP YP  LLGYV +G    ID RKS  LK S N  DWHNLQA+LHVV GWNG   EFE
Sbjct  297  DLIPLYPSGLLGYVNTGTLLEIDTRKSPHLKDSKNPSDWHNLQAILHVVNGWNGSKGEFE  356

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            LKVKR +ALVNKS  FL+EE L P +WWVEKNK MV+DENG+ +LA P DEDLPVPE
Sbjct  357  LKVKRSLALVNKSSAFLKEEYLAPETWWVEKNKGMVIDENGDWILAPPADEDLPVPE  413



>ref|XP_007048712.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92869.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=411

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            +  GHSLGA+LA L++FD  EN + DIPVTA VFG PQ+G++ F++ +    NLKILH +
Sbjct  232  VFTGHSLGASLAVLSAFDTVENCIHDIPVTAFVFGCPQVGDKAFNERLKRHLNLKILHTK  291

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGYV +G E +ID RKS  LK S N GDWHNLQAMLH+VAGWNG+D 
Sbjct  292  NTIDVIPRYPGELLGYVNTGTELIIDTRKSPSLKDSKNNGDWHNLQAMLHIVAGWNGKDG  351

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFELKVKR +ALVNKSC FL++ELL+PGSWWVEKNK ++  E+GE ++A P+DEDL VPE
Sbjct  352  EFELKVKRSLALVNKSCAFLKDELLVPGSWWVEKNKGLIKTEDGEWIMA-PSDEDLLVPE  410



>ref|XP_010525104.1| PREDICTED: phospholipase A1-IIdelta [Tarenaya hassleriana]
Length=407

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 143/182 (79%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            IV GHSLGAT A LASFDL EN V D +PVTAIVFG PQ+GN+ F+  +    NLKILH+
Sbjct  228  IVTGHSLGATEAILASFDLAENAVADTVPVTAIVFGCPQVGNKEFNDQVMRHKNLKILHV  287

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RNKID++  YPG  L YV +G++FVID RKS  LK S   GDWHNLQAMLHVVAGWNG+ 
Sbjct  288  RNKIDLLTRYPGPFLHYVDTGIDFVIDTRKSPYLKNSKTPGDWHNLQAMLHVVAGWNGKK  347

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF L VKR +ALVNKSCEFL++E LIPGSWWVEKNK M+ +E+GE ++ASP++E  PVP
Sbjct  348  GEFHLMVKRSLALVNKSCEFLKDEYLIPGSWWVEKNKGMIKNEDGEWIMASPDEE--PVP  405

Query  142  EY  137
            E+
Sbjct  406  EF  407



>ref|XP_007132834.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132835.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 ref|XP_007132836.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04828.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04829.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
 gb|ESW04830.1| hypothetical protein PHAVU_011G128500g [Phaseolus vulgaris]
Length=414

 Score =   246 bits (628),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGATL+ ++ FDL ENGVTDIPVTAIVFGSPQ+GN+ F+  +    NL +LH+ 
Sbjct  233  VIMGHSLGATLSIVSGFDLVENGVTDIPVTAIVFGSPQVGNRAFNNRLKRLGNLNVLHVT  292

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY  +G+E VID RKS  LK+S N  DWHNLQAMLHVVAGWNG   
Sbjct  293  NVIDLIPHYPGKLLGYEHTGVELVIDTRKSPSLKESKNPSDWHNLQAMLHVVAGWNGARE  352

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
             FELKVKR +ALVNKSC FL++E  +P SWWVEKNK MV  E+GE V  +P++ED PVPE
Sbjct  353  GFELKVKRSLALVNKSCSFLKDECGVPESWWVEKNKGMVKREDGEWVSNAPDEEDRPVPE  412

Query  139  Y  137
            +
Sbjct  413  H  413



>ref|XP_011082995.1| PREDICTED: phospholipase A1-IIdelta [Sesamum indicum]
Length=402

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 1/180 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLG  LATL++FDL ENGV +IPV+AIVFGSPQ+G++VF++ M +  NLK+LH+RN
Sbjct  224  LTGHSLGGCLATLSAFDLVENGVNNIPVSAIVFGSPQVGDKVFNERMRQYPNLKVLHVRN  283

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
            +ID+IP YP   LGY  +G++  ID+RKS  LK S N  DWHNLQAMLHVVAGWNG   E
Sbjct  284  RIDLIPLYPSEFLGYKNTGIQLEIDNRKSPSLKDSKNPSDWHNLQAMLHVVAGWNGPHEE  343

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR +ALVNKS   L++E LIPGSWWVEKNK +V DENGE    +P DED PVPE+
Sbjct  344  FELKVKRSLALVNKSSSILKDEYLIPGSWWVEKNKGLVRDENGEWTWPAP-DEDQPVPEF  402



>ref|XP_010276983.1| PREDICTED: phospholipase A1-IIdelta [Nelumbo nucifera]
Length=428

 Score =   245 bits (626),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA LA L++FD+ ENG++ IPV AIVFG PQ+GN+ FD+ + + +NL+ILH++N
Sbjct  250  LTGHSLGACLAILSAFDVVENGLS-IPVAAIVFGCPQVGNKAFDQRIKKFSNLRILHVKN  308

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP   LGY  +G E VID RKS  LK S N  DWHNLQAMLHVVAGWNG D+E
Sbjct  309  AIDLIPHYPSRALGYHYTGTELVIDTRKSPSLKDSKNPSDWHNLQAMLHVVAGWNGADKE  368

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            FELKVKR +ALVNKSC++L+EELL+P SWWVEKNK MVL++N E  L  P ++D+PVPE+
Sbjct  369  FELKVKRTIALVNKSCDYLKEELLVPPSWWVEKNKGMVLNQNEEWELTPPFEDDIPVPEF  428



>ref|XP_007048713.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX92870.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=420

 Score =   244 bits (624),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            +  GHSLGA+L+ +++FD+ ENGV D IPV A VFG PQ+GN+ FD+ M +  N+ +LHI
Sbjct  239  VFTGHSLGASLSVISAFDVAENGVADDIPVAAFVFGCPQVGNKAFDERMKKYPNVSVLHI  298

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            +N ID+IP YP  LLGYV +G E VID RKS  LK S N  DWHNLQAMLH+VAGWNGE+
Sbjct  299  KNSIDLIPHYPSRLLGYVNTGTELVIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGEE  358

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+LKVKR +ALVNKSC FL++E L+P SWWVEKNK +V +E+GE V+A   DED+P+P
Sbjct  359  GEFKLKVKRSLALVNKSCAFLKDECLVPESWWVEKNKGLVRNEDGEWVMAPQTDEDMPIP  418

Query  142  E  140
            E
Sbjct  419  E  419



>ref|XP_003607601.1| Feruloyl esterase A [Medicago truncatula]
 gb|AES89798.1| phospholipase A1 [Medicago truncatula]
Length=442

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGA+L+ +++FDL ENGVTDIPVTA VFGSPQ+GN+ F+    +  NLK+LH+R
Sbjct  262  VLVGHSLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNDRFKKFQNLKVLHVR  321

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY  +G E VID RKST LK S N  DWHNLQAMLH+VAGWNG D 
Sbjct  322  NVIDLIPHYPGKLLGYEYTGTELVIDTRKSTSLKDSKNPSDWHNLQAMLHIVAGWNGSDG  381

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EFE+KVKR +ALVNKSC++L+EE  +P SWWV  NK MV  E+ E V A P  EDLPVPE
Sbjct  382  EFEVKVKRSLALVNKSCDYLKEECHVPASWWVATNKGMVRREDEEWVDA-PEKEDLPVPE  440



>ref|XP_004505480.1| PREDICTED: phospholipase A1-IIdelta-like [Cicer arietinum]
Length=480

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGA+L+ +++FDL ENGVTDIPVTA VFGSPQ+GN+ F++   +  NLK+LH+R
Sbjct  300  VLVGHSLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNERFKKFQNLKVLHVR  359

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY  +G+E  ID RKS  LK S   GDWHNLQAMLH+VAGWNG   
Sbjct  360  NVIDLIPHYPGKLLGYEYTGVELEIDTRKSPSLKDSKTPGDWHNLQAMLHIVAGWNGSGG  419

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
             FE+KVKR +ALVNKSC+FL+EE  +PGSWWVEKNK  V  E+GE V   P +EDLP PE
Sbjct  420  VFEMKVKRSLALVNKSCDFLKEECHVPGSWWVEKNKGFVRREDGEWV-DQPAEEDLPAPE  478



>ref|XP_007217233.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
 gb|EMJ18432.1| hypothetical protein PRUPE_ppa005547mg [Prunus persica]
Length=455

 Score =   240 bits (613),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA+L+ L++FDL ENGV D IPV A VFG P++GN+     +    NLKILH R
Sbjct  274  ITGHSLGASLSILSAFDLVENGVADDIPVAAFVFGCPEVGNKALKNRIQSYPNLKILHTR  333

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY   G E VID RKS  LK+S N  DWHNLQ MLHVVAGWNG++ 
Sbjct  334  NTIDLIPHYPGRLLGYRDIGTELVIDTRKSKFLKESNNPSDWHNLQGMLHVVAGWNGKEG  393

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESVLASPNDEDLPVP  143
            EFEL+VKR VALVNKS +FL+ E  +P SWWVEKNK +VLDE +GE +LA P+DEDLPVP
Sbjct  394  EFELRVKRSVALVNKSSDFLKTEFYVPASWWVEKNKGVVLDESSGEWLLAPPSDEDLPVP  453

Query  142  EY  137
            E+
Sbjct  454  EF  455



>gb|KJB71435.1| hypothetical protein B456_011G123300 [Gossypium raimondii]
Length=416

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 136/181 (75%), Gaps = 1/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            +  GHSLGA+LA L++FD+ ENG+ D IPV A  FG PQ+GN+ F+  M    NL +LH 
Sbjct  235  VFTGHSLGASLAVLSAFDVVENGLVDNIPVAAFAFGCPQVGNKAFNDRMKRYPNLTVLHT  294

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            +N ID+IP YP  LLGYV +G E VID RKS  LK S N  DWHNLQAMLH+VAGWNG++
Sbjct  295  KNIIDVIPHYPSLLLGYVYTGTELVIDTRKSPSLKDSKNPSDWHNLQAMLHIVAGWNGQE  354

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EFELKVKR +ALVNKSC FL++E L+PGSWWVEKNK +V +E+GE V+    DEDLP P
Sbjct  355  GEFELKVKRSLALVNKSCAFLKDECLVPGSWWVEKNKGLVRNEDGEWVMVPATDEDLPTP  414

Query  142  E  140
            E
Sbjct  415  E  415



>ref|XP_010104406.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00251.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=400

 Score =   238 bits (608),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD--IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            ++ GHSLGA LA L++FDL ENGV     PVTA VFG PQ+GN+ F ++  +  NLKILH
Sbjct  217  VISGHSLGAALAVLSAFDLVENGVVSESFPVTAFVFGCPQVGNEEFKEIAEKHRNLKILH  276

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGE  326
             +N ID+IP YPG L G+V  G E VID RKS  L +S+  GDWHNLQ MLHVVAGWNG 
Sbjct  277  TKNTIDLIPHYPGMLFGFVDMGEELVIDSRKSPHLNESLFPGDWHNLQGMLHVVAGWNGG  336

Query  325  DREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESVLASPNDEDLP  149
            D+EFE+KVKR  ALVNKS  FL+++ L+P SWW EKNK MVLDE +GE +LA P+DEDLP
Sbjct  337  DKEFEMKVKRSFALVNKSSGFLKDDYLVPESWWAEKNKGMVLDESSGEWILAPPDDEDLP  396

Query  148  VPEY  137
            VPE+
Sbjct  397  VPEF  400



>ref|XP_006411537.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
 gb|ESQ52990.1| hypothetical protein EUTSA_v10016724mg [Eutrema salsugineum]
Length=416

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A +A++D+ ENG  D +PVTAIVFG PQ+GN+ F   +    NLKILH+
Sbjct  237  VLTGHSLGATEAVIAAYDIAENGSNDDVPVTAIVFGCPQVGNKEFKDEVTRHKNLKILHV  296

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RNKID++  YPG LLGYV  G  FVID +KS  LK S + GDWHNLQAMLH+VAGWNG+ 
Sbjct  297  RNKIDLLTRYPGGLLGYVDIGTNFVIDTKKSPYLKDSKSPGDWHNLQAMLHIVAGWNGKK  356

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK M+ DENGE V+ SP +E+ PVP
Sbjct  357  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVI-SPVEEE-PVP  414

Query  142  EY  137
            E+
Sbjct  415  EF  416



>ref|XP_010925002.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=440

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 141/185 (76%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            I  GHSLGA+LATL++FD+ ENG++ I       V A+VFGSPQIGN+ F   +    NL
Sbjct  223  ICVGHSLGASLATLSAFDIVENGLSKIGENNHAQVCAMVFGSPQIGNKAFKDRLERLPNL  282

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++LH +NKID+IP+YP  LLGYV +G+E V+D RKS  LK S NTGDWHNLQ +L  VAG
Sbjct  283  RVLHTKNKIDLIPQYPSGLLGYVFAGVELVVDTRKSPYLKDSTNTGDWHNLQGILQAVAG  342

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGED EF+ +V+R +ALVNKSC++L++E LIPG WWVEKNK MVL+E+GE  LA P  E
Sbjct  343  WNGEDGEFKFQVERSIALVNKSCDYLKDEYLIPGLWWVEKNKGMVLEEDGEWYLAPPAAE  402

Query  157  DLPVP  143
            DLP+P
Sbjct  403  DLPLP  407



>ref|XP_009401938.1| PREDICTED: phospholipase A1-II 5 [Musa acuminata subsp. malaccensis]
Length=449

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 141/185 (76%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLGA LA L++FD+ ENG++ +      PV A+VFGSPQIGN+ F+  + +  NL
Sbjct  223  VCVGHSLGAALAILSAFDIVENGLSKVGDKEEFPVCAMVFGSPQIGNKAFNDRLEKLPNL  282

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++LH+RNKID+IP YP  LLG+V +G    ID RKS  LK S   GDWHNLQ +LHVVAG
Sbjct  283  RVLHVRNKIDLIPLYPSGLLGFVNTGTVLEIDTRKSPYLKDSRFPGDWHNLQGILHVVAG  342

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG++ EFELKVKR V LVNKS E+L++E L+PGSWWVEKNK MVL+E+GE VLA+P DE
Sbjct  343  WNGDEGEFELKVKRSVGLVNKSSEYLKDEYLVPGSWWVEKNKGMVLEEDGEWVLAAPTDE  402

Query  157  DLPVP  143
            D PVP
Sbjct  403  DAPVP  407



>ref|XP_008343100.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   236 bits (603),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+L+ L++FDL ENGV+DIP+   VFG P IGN+   + +    NLKILHI+N
Sbjct  237  MTGHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIERHPNLKILHIKN  296

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP  ++GY K G E +ID RKS  LK+S N  DWHNL+ MLHVVAGWNGE+ +
Sbjct  297  TIDVIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGD  356

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDEN-GESVLASPNDEDLPVPE  140
            FEL+VKR VALVNKS +FL+EE  +P  WWVEKN+ MVLDE+ GE VL SP+DEDLPVPE
Sbjct  357  FELRVKRSVALVNKSSDFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPE  416

Query  139  Y  137
            +
Sbjct  417  F  417



>ref|XP_008353849.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=417

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+L+ L++FDL ENGV+DIP+   VFG P IGN+   + +    NLKILHI+N
Sbjct  237  MTGHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIERHPNLKILHIKN  296

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID IP YP  ++GY K G E +ID RKS  LK+S N  DWHNL+ MLHVVAGWNGE+ +
Sbjct  297  TIDXIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGD  356

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDEN-GESVLASPNDEDLPVPE  140
            FEL+VKR VALVNKS +FL+EE  +P  WWVEKN+ MVLDE+ GE VL SP+DEDLPVPE
Sbjct  357  FELRVKRSVALVNKSSDFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPE  416

Query  139  Y  137
            +
Sbjct  417  F  417



>ref|XP_008343102.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=438

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+L+ L++FDL ENGV+DIP+   VFG P IGN+   + +    NLKILHI+N
Sbjct  258  MTGHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIEXHPNLKILHIKN  317

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP  ++GY K G E +ID RKS  LK+S N  DWHNL+ MLHVVAGWNGE+ +
Sbjct  318  TIDVIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPFDWHNLEGMLHVVAGWNGEEGD  377

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDEN-GESVLASPNDEDLPVPE  140
            FEL+VKR VALVNKS +FL+EE  +P  WWVEKN+ MVLDE+ GE VL SP+DEDLPVPE
Sbjct  378  FELRVKRSVALVNKSSDFLKEECHVPAVWWVEKNRGMVLDESGGEWVLPSPSDEDLPVPE  437

Query  139  Y  137
            +
Sbjct  438  F  438



>ref|XP_008362525.1| PREDICTED: phospholipase A1-IIdelta-like [Malus domestica]
Length=441

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA+L+ L++FDL ENGV+DIP+   VFG P IGN+   + +    NLKILHI+N
Sbjct  261  MTGHSLGASLSVLSAFDLAENGVSDIPIAVFVFGCPHIGNKALKRRIETHPNLKILHIKN  320

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
             ID+IP YP  ++GY K G E +ID RKS  LK+S N  DWHNL+ +LHVVAGWNGE+ E
Sbjct  321  TIDVIPHYPVHVMGYRKVGTELLIDTRKSPFLKESKNPSDWHNLEGILHVVAGWNGEEGE  380

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESVLASPNDEDLPVPE  140
            F+L+VKR VALVNKSC+FL+EE  +P  WWVEKN+ MVLD+ +GE VL+ P+DEDLP PE
Sbjct  381  FDLRVKRSVALVNKSCDFLKEECHVPAVWWVEKNRXMVLDKSSGEWVLSPPSDEDLPAPE  440

Query  139  Y  137
            +
Sbjct  441  F  441



>ref|XP_002281095.2| PREDICTED: phospholipase A1-IIdelta [Vitis vinifera]
Length=470

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 139/181 (77%), Gaps = 2/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT--DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            IV GHSLGA+LA L+SFD+ EN +   D+ V+AIVFG P+IGN+ F+  + + +NL ILH
Sbjct  285  IVTGHSLGASLAVLSSFDIVENEIVPPDVIVSAIVFGCPEIGNRAFNNQIKQHSNLHILH  344

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGE  326
            +RN ID+IP YP  +LGYVK+G E VID RKS  LK S + GDWHNLQAM+HVV+GWNG 
Sbjct  345  VRNTIDLIPHYPSMILGYVKTGTELVIDTRKSPDLKDSKDPGDWHNLQAMVHVVSGWNGP  404

Query  325  DREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPV  146
            + EFELKVKR +ALVNKSC FL++E L+P SWWVEKNK M+   +GE V  SP +ED PV
Sbjct  405  NAEFELKVKRSLALVNKSCNFLKDECLVPASWWVEKNKGMMRKADGEWVTESPAEEDRPV  464

Query  145  P  143
            P
Sbjct  465  P  465



>ref|XP_002881867.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58126.1| hypothetical protein ARALYDRAFT_483364 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 141/182 (77%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ ENG +D +PVTAIVFG PQ+GN+ F   +    NLKILH+
Sbjct  232  VLTGHSLGATEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMRHKNLKILHV  291

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G  FVID +KS  LK+S N GDWHNLQA+LH+VAGWNG+ 
Sbjct  292  RNTIDLLTRYPGGLLGYVDMGTNFVIDTKKSPFLKESRNPGDWHNLQAILHIVAGWNGKK  351

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK ++ +E+GE VLA   +E  PVP
Sbjct  352  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGLIKNEDGEWVLAPVEEE--PVP  409

Query  142  EY  137
            E+
Sbjct  410  EF  411



>ref|XP_002522219.1| hypothetical protein RCOM_1733320 [Ricinus communis]
 gb|EEF40194.1| hypothetical protein RCOM_1733320 [Ricinus communis]
Length=176

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 130/171 (76%), Gaps = 0/171 (0%)
 Frame = -3

Query  649  LATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKIDMIPEYP  470
            L+ LA+FDL EN V DIPV A+VFGSPQ+GN+ F+    + +NLK+LHI+N+ID IP YP
Sbjct  6    LSILAAFDLVENVVADIPVAALVFGSPQVGNKAFNDRFKKHSNLKVLHIKNQIDAIPHYP  65

Query  469  GALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFELKVKRCV  290
            G LLGY  +G E  ID RKS  LK S N  DW NLQAMLH+VAGWNG+   FELKVKR +
Sbjct  66   GRLLGYEYTGTELEIDTRKSPSLKGSKNPSDWRNLQAMLHIVAGWNGDKEPFELKVKRSL  125

Query  289  ALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            ALVNKSC FL++E L+PGSWWVEKN+ MV  ++GE  LA  ++ED PVPEY
Sbjct  126  ALVNKSCAFLKDECLVPGSWWVEKNRGMVRGDDGEWTLAPADEEDQPVPEY  176



>ref|XP_008228927.1| PREDICTED: phospholipase A1-IIdelta [Prunus mume]
Length=455

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 137/182 (75%), Gaps = 2/182 (1%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA+L+ L++FDL EN V D IPV A VFG PQ+GN+     +    NLKILH +
Sbjct  274  ITGHSLGASLSILSAFDLVENEVADDIPVAAFVFGCPQVGNKALKIRIQSYPNLKILHTK  333

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY   G E VID RKS  LK+S N  DWHNLQ ML+VVAGWNG++ 
Sbjct  334  NTIDLIPHYPGHLLGYRDIGTELVIDTRKSKFLKESDNPSDWHNLQGMLNVVAGWNGKEG  393

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESVLASPNDEDLPVP  143
            EFEL+VKR VALVNKS +FL+ E  +P SWWVEKNK MVLDE +GE VLA P+DEDLPVP
Sbjct  394  EFELRVKRSVALVNKSSDFLKTEFYVPASWWVEKNKGMVLDESSGEWVLAPPSDEDLPVP  453

Query  142  EY  137
            E+
Sbjct  454  EF  455



>ref|NP_181797.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
 sp|Q9SJI7.1|PLA20_ARATH RecName: Full=Phospholipase A1-IIdelta [Arabidopsis thaliana]
 gb|AAD21737.1| putative lipase [Arabidopsis thaliana]
 gb|AAK93675.1| putative lipase [Arabidopsis thaliana]
 gb|AAL85087.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15382.1| putative lipase [Arabidopsis thaliana]
 gb|AEC10156.1| phospholipase A1-IIdelta [Arabidopsis thaliana]
Length=412

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 143/183 (78%), Gaps = 5/183 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVF-DKMMGEKTNLKILH  506
            ++ GHSLGAT A LA++D+ ENG +D +PVTAIVFG PQ+GN+ F D++M  K NLKILH
Sbjct  233  VLTGHSLGATEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHK-NLKILH  291

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGE  326
            +RN ID++  YPG LLGYV  G+ FVID +KS  L  S N GDWHNLQAMLHVVAGWNG+
Sbjct  292  VRNTIDLLTRYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQAMLHVVAGWNGK  351

Query  325  DREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPV  146
              EF+L VKR +ALVNKSCEFL+ E L+PGSWWVEKNK ++ +E+GE VLA   +E  PV
Sbjct  352  KGEFKLMVKRSIALVNKSCEFLKAECLVPGSWWVEKNKGLIKNEDGEWVLAPVEEE--PV  409

Query  145  PEY  137
            PE+
Sbjct  410  PEF  412



>gb|EPS65213.1| hypothetical protein M569_09566 [Genlisea aurea]
Length=410

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 136/181 (75%), Gaps = 0/181 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I+ GHSLG +LA L++FDL ENGV+ IPV A+ FG P++GN+ F   +G   NLKIL +R
Sbjct  227  ILTGHSLGGSLAVLSAFDLVENGVSGIPVAAVTFGCPRVGNRAFKDRIGHYPNLKILQVR  286

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D IP YP AL+GY  SG++F +D+RKS  LK S +  D HNLQAMLH VAGW G D 
Sbjct  287  NTTDRIPLYPTALMGYHHSGVDFEVDNRKSPFLKSSGSFLDRHNLQAMLHAVAGWQGRDG  346

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
             FEL+VKR +ALVNKS E LR+E +IPGSWWVEKNK MVLD++GE VLA P +ED PVPE
Sbjct  347  GFELRVKRSLALVNKSAEILRDEYMIPGSWWVEKNKGMVLDDSGEWVLAPPAEEDRPVPE  406

Query  139  Y  137
            +
Sbjct  407  F  407



>emb|CBI21996.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 139/181 (77%), Gaps = 2/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT--DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            IV GHSLGA+LA L+SFD+ EN +   D+ V+AIVFG P+IGN+ F+  + + +NL ILH
Sbjct  298  IVTGHSLGASLAVLSSFDIVENEIVPPDVIVSAIVFGCPEIGNRAFNNQIKQHSNLHILH  357

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGE  326
            +RN ID+IP YP  +LGYVK+G E VID RKS  LK S + GDWHNLQAM+HVV+GWNG 
Sbjct  358  VRNTIDLIPHYPSMILGYVKTGTELVIDTRKSPDLKDSKDPGDWHNLQAMVHVVSGWNGP  417

Query  325  DREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPV  146
            + EFELKVKR +ALVNKSC FL++E L+P SWWVEKNK M+   +GE V  SP +ED PV
Sbjct  418  NAEFELKVKRSLALVNKSCNFLKDECLVPASWWVEKNKGMMRKADGEWVTESPAEEDRPV  477

Query  145  P  143
            P
Sbjct  478  P  478



>ref|XP_010517807.1| PREDICTED: phospholipase A1-IIdelta-like isoform X2 [Camelina 
sativa]
Length=410

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN   D +PVTAIVFG PQ+GN+ F        NLKILH+
Sbjct  231  VLTGHSLGATEAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHV  290

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G+ FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  291  RNTIDLLTRYPGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKK  350

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK ++ +E+GE ++A   +E  PVP
Sbjct  351  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVP  408

Query  142  EY  137
            E+
Sbjct  409  EF  410



>ref|XP_010517806.1| PREDICTED: phospholipase A1-IIdelta-like isoform X1 [Camelina 
sativa]
Length=410

 Score =   233 bits (595),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN   D +PVTAIVFG PQ+GN+ F        NLKILH+
Sbjct  231  VLTGHSLGATEAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHV  290

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G+ FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  291  RNTIDLLTRYPGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKK  350

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK ++ +E+GE ++A   +E  PVP
Sbjct  351  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVP  408

Query  142  EY  137
            E+
Sbjct  409  EF  410



>ref|XP_010506105.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=410

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN   D +PVTAIVFG PQ+GN+ F        NLKILH+
Sbjct  231  VLTGHSLGATEAVLAAYDIAENASKDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHV  290

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G+ FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  291  RNTIDLLTRYPGGLLGYVDMGINFVIDTKKSPFLKNSRNPGDWHNLQAMLHVVAGWNGKK  350

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK ++ +E+GE ++A   +E  PVP
Sbjct  351  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWIIAPVEEE--PVP  408

Query  142  EY  137
            E+
Sbjct  409  EF  410



>ref|XP_010508539.1| PREDICTED: phospholipase A1-IIdelta isoform X1 [Camelina sativa]
 ref|XP_010508540.1| PREDICTED: phospholipase A1-IIdelta isoform X2 [Camelina sativa]
 ref|XP_010508541.1| PREDICTED: phospholipase A1-IIdelta isoform X3 [Camelina sativa]
Length=410

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN   D +PVTAIVFG PQ+GN+ F        NLKILH+
Sbjct  231  VLTGHSLGATEAVLAAYDIAENASNDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLKILHV  290

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G+ FVID +KS  LK S N GDWHNLQAMLH+VAGWNG+ 
Sbjct  291  RNTIDLLTRYPGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHIVAGWNGKK  350

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK ++ +E+GE V+A   +E  PVP
Sbjct  351  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGLIRNEDGEWVIAPVEEE--PVP  408

Query  142  EY  137
            E+
Sbjct  409  EF  410



>ref|XP_010525149.1| PREDICTED: phospholipase A1-IIdelta-like [Tarenaya hassleriana]
Length=414

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKIL  509
            ++ GHSLG TLATL +FDL EN   G  ++PVTAIVFGSP++GN+     +    NL+IL
Sbjct  229  VLTGHSLGGTLATLGAFDLAENVTGGDDNVPVTAIVFGSPKVGNKELADRIKLNKNLRIL  288

Query  508  HIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNG  329
            H++N+ID+I  YPG +LGYV  G +  ID RKS  LK+S + GDWHNLQAMLHV AGWNG
Sbjct  289  HVKNQIDLITRYPGRILGYVSVGTKLKIDTRKSPFLKESHHPGDWHNLQAMLHVAAGWNG  348

Query  328  EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLP  149
            E  EFE++VKR +ALVNKSC+ L+EE L+P  WWVEKNK ++  E+GE V+A+P+DEDLP
Sbjct  349  EREEFEMRVKRSIALVNKSCDLLKEECLVPPCWWVEKNKGLLKAEDGEWVMATPHDEDLP  408

Query  148  VPEY  137
            V E+
Sbjct  409  VAEF  412



>ref|XP_006294314.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
 gb|EOA27212.1| hypothetical protein CARUB_v10023322mg [Capsella rubella]
Length=410

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 138/182 (76%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN   D +PVTAIVFG PQ+GN+ F        NL+ILH+
Sbjct  231  VLTGHSLGATEAVLAAYDIAENASNDDVPVTAIVFGCPQVGNKEFRDEAMRHKNLRILHV  290

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  +PG LLGYV  G+ FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  291  RNTIDLLTRFPGGLLGYVDMGINFVIDTKKSPFLKDSRNPGDWHNLQAMLHVVAGWNGKK  350

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK M+ +E+GE V+A   +E  PVP
Sbjct  351  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIRNEDGEWVIAPVEEE--PVP  408

Query  142  EY  137
            E+
Sbjct  409  EF  410



>gb|ACJ85535.1| unknown [Medicago truncatula]
Length=435

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 132/169 (78%), Gaps = 0/169 (0%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            ++ GHSLGA+L+ +++FDL ENGVTDIPVTA VFGSPQ+GN+ F+    +  NLK+LH+R
Sbjct  262  VLVGHSLGASLSIVSAFDLVENGVTDIPVTAFVFGSPQVGNKAFNDRFKKFQNLKVLHVR  321

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID+IP YPG LLGY  +G E VID RKST LK S N  DWHNLQAMLH+VAGWNG D 
Sbjct  322  NVIDLIPHYPGKLLGYEYTGTELVIDTRKSTSLKDSKNPSDWHNLQAMLHIVAGWNGSDG  381

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLA  173
            EFE+KVKR +ALVNKSC++L+EE  +PGSWWV KNK MV   + E V A
Sbjct  382  EFEVKVKRSLALVNKSCDYLKEECHVPGSWWVAKNKGMVGRGDAEWVDA  430



>ref|XP_010925003.1| PREDICTED: phospholipase A1-II 5-like [Elaeis guineensis]
Length=449

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 136/184 (74%), Gaps = 6/184 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            I  GHSLGA+LA L++FD+ ENG++ I       V A+VFGSPQIGN+ F+  + +  NL
Sbjct  223  ICVGHSLGASLAILSAFDIVENGLSKIGENSYVQVCAMVFGSPQIGNKAFNGRLEKLPNL  282

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++LH +NKID+IP+YP  LLGY  +G+E V+D RKS  LK S N  DWHNLQ +L  VAG
Sbjct  283  RVLHTKNKIDLIPKYPSGLLGYAYTGVELVVDARKSPYLKDSKNPSDWHNLQGILQAVAG  342

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGED EFE KVKR VALVNKS E+L++E LIPGSWWVEKNK MVL  +GE  LASP  E
Sbjct  343  WNGEDGEFEFKVKRSVALVNKSSEYLKDEYLIPGSWWVEKNKGMVLGADGEWYLASPAPE  402

Query  157  DLPV  146
            D PV
Sbjct  403  DFPV  406



>emb|CDY14851.1| BnaC04g48480D [Brassica napus]
Length=378

 Score =   231 bits (588),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 131/170 (77%), Gaps = 1/170 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN  +D +PVT IVFG PQ+GN+ F   +    NLKILH+
Sbjct  199  VLTGHSLGATEAVLAAYDIAENASSDDVPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHV  258

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G  FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  259  RNTIDLLTRYPGGLLGYVDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKK  318

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLA  173
             EF+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK M+ DENGE V+A
Sbjct  319  GEFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  368



>ref|XP_010689863.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=423

 Score =   231 bits (589),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I  GHSLGATL+TL++FD+ EN  T+IPVTAIVFG P++GN+ F +      NLK+LH+R
Sbjct  244  IFTGHSLGATLSTLSAFDIVENLTTEIPVTAIVFGCPKVGNKHFKERFDSYPNLKVLHVR  303

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N +DMIP YP  L+ YV  G E  ID RKS  LK S + GDWHNLQAMLHVV GW+G  R
Sbjct  304  NTLDMIPHYPPRLMHYVHLGTELNIDTRKSHYLKHSKHPGDWHNLQAMLHVVNGWHGIKR  363

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            +FEL ++R +ALVNKSC++L+EE LIP SWWVEKNK MVL+E GE VLA P  E+ P+PE
Sbjct  364  QFELIIQRSIALVNKSCDYLKEECLIPPSWWVEKNKGMVLNEEGEWVLACP--EEAPIPE  421

Query  139  Y  137
            +
Sbjct  422  F  422



>emb|CDY47985.1| BnaA04g24630D [Brassica napus]
Length=378

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN  +D  PVT IVFG PQ+GN+ F   +    NLKILH+
Sbjct  199  VLTGHSLGATEAVLAAYDIAENASSDDYPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHV  258

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G  FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  259  RNTIDLLTRYPGGLLGYVDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKK  318

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLA  173
             +F+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK M+ DENGE V+A
Sbjct  319  GDFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  368



>ref|XP_009142078.1| PREDICTED: phospholipase A1-IIdelta [Brassica rapa]
Length=413

 Score =   228 bits (581),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 130/170 (76%), Gaps = 1/170 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A LA++D+ EN  +D  PVT IVFG PQ+GN+ F   +    NLKILH+
Sbjct  234  VLTGHSLGATEAVLAAYDIAENASSDDYPVTGIVFGCPQVGNKEFKDEVTRHKNLKILHV  293

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN ID++  YPG LLGYV  G  FVID +KS  LK S N GDWHNLQAMLHVVAGWNG+ 
Sbjct  294  RNTIDLLTRYPGGLLGYVDIGTNFVIDTKKSPYLKDSRNPGDWHNLQAMLHVVAGWNGKK  353

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLA  173
             +F+L VKR +ALVNKSCEFL++E L+PGSWWVEKNK M+ DENGE V+A
Sbjct  354  GDFKLMVKRSIALVNKSCEFLKDECLVPGSWWVEKNKGMIKDENGEWVIA  403



>gb|KFK37117.1| hypothetical protein AALP_AA4G215100 [Arabis alpina]
Length=414

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 139/182 (76%), Gaps = 4/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A +A +D+ EN   D +P++AIVFGSPQ+GN+ F   + +  NLKILH+
Sbjct  236  VLTGHSLGATEAVIAGYDIAENASKDDVPISAIVFGSPQVGNREFRNEVTKHKNLKILHV  295

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RNKID +  YPG LLGYV  G+ FVID +KS  LK SMN GDWHNLQAMLHVVAGWNG+ 
Sbjct  296  RNKIDFLTRYPGGLLGYVDIGVNFVIDTKKSPYLKDSMNPGDWHNLQAMLHVVAGWNGK-  354

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVP  143
            REF+L V R +ALVNKSCE+L++E L+PG+WWV+KN  M+ +E+GE V+ S  +E  P P
Sbjct  355  REFKLMVNRSIALVNKSCEYLKDEFLVPGTWWVDKNNGMIKNEDGEWVIGSVEEE--PEP  412

Query  142  EY  137
            E+
Sbjct  413  EF  414



>ref|XP_008807980.1| PREDICTED: phospholipase A1-II 5 [Phoenix dactylifera]
Length=450

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 135/185 (73%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            I  GHSLGA+LA L++FD+ ENG++ I       V A+VFGSPQIGN+ F+  + +  NL
Sbjct  223  ICVGHSLGASLAILSAFDMVENGLSKIGENSHVQVCAMVFGSPQIGNKAFNDRLEKLPNL  282

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++L ++NKID+IP YP  LLGY  +G E V+D RKS  LK S N  DWHNLQ +L  VAG
Sbjct  283  RVLRVKNKIDLIPLYPSGLLGYAYTGEELVVDARKSPYLKDSKNPSDWHNLQGILQAVAG  342

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGED EFE KVKR +ALVNKS E+L++E LIPGSWWVE+NK MV  E+G+  LA P  E
Sbjct  343  WNGEDGEFEFKVKRSIALVNKSSEYLKDEYLIPGSWWVEQNKGMVPGEDGDWYLAPPAAE  402

Query  157  DLPVP  143
            DLPVP
Sbjct  403  DLPVP  407



>gb|KFK37118.1| hypothetical protein AALP_AA4G215200 [Arabis alpina]
Length=329

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIP-VTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            ++ GHSLGAT+ATLA+FDL EN     +D+P VTAIVFGSP++GN+ F   +    N++I
Sbjct  144  VLTGHSLGATIATLAAFDLAENVTNSYSDVPPVTAIVFGSPRLGNKKFSDRINGHNNVRI  203

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R +  LK++ + GDWHNLQAMLHVVAGWN
Sbjct  204  LHVKNEIDLITRYPAKIMGYVNIGTKLKIDTRVTPFLKETHHPGDWHNLQAMLHVVAGWN  263

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++ +FELKV R +ALVNKSC  L+EE L+P  WWVEKNK M+ +ENG+ V+A+P+DED 
Sbjct  264  GKNGKFELKVNRNIALVNKSCALLKEECLVPECWWVEKNKGMLKNENGDWVMATPDDEDK  323

Query  151  PVPEY  137
            PV E+
Sbjct  324  PVVEF  328



>ref|XP_010507708.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 141/185 (76%), Gaps = 4/185 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIP-VTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            +  GHSLGAT+ATLA+FD+ EN   G +D+P VTAIVFGSP++GN+ F + +    N+++
Sbjct  211  VFTGHSLGATVATLAAFDIAENVTSGYSDVPPVTAIVFGSPRVGNREFSERIKRHNNVRV  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQAMLHVVAGWN
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWN  330

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++ +FE+KV R +ALVNKSC  L+EE L+P  WWVEKNK M+  E+G+ V+A+P+DED 
Sbjct  331  GKNGKFEMKVNRNIALVNKSCSLLKEECLVPECWWVEKNKGMLKTEDGDWVIATPDDEDK  390

Query  151  PVPEY  137
            PV E+
Sbjct  391  PVVEF  395



>ref|XP_010689845.1| PREDICTED: phospholipase A1-IIdelta-like [Beta vulgaris subsp. 
vulgaris]
Length=426

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 133/181 (73%), Gaps = 2/181 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            I+ GHSLGATL+ +++FD+ EN   +IPV+AIVFG P++GN+ F   +    NLKILH+R
Sbjct  247  ILTGHSLGATLSVISAFDIVENITREIPVSAIVFGCPKVGNKSFKNRVNLHPNLKILHVR  306

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N ID IP YP  L+GYV  G E  ID RKS  LK S + GDWHNLQAMLH+V GW G   
Sbjct  307  NVIDTIPLYPARLMGYVHIGTELEIDSRKSPYLKHSRHVGDWHNLQAMLHIVNGWQGIKE  366

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPE  140
            EF L ++R +ALVNKSC++L+EE L+P SWWVEKNK MVL+E GE VLA P  E+ PVPE
Sbjct  367  EFRLVIERSIALVNKSCDYLKEECLVPPSWWVEKNKGMVLNERGEWVLAGP--EEGPVPE  424

Query  139  Y  137
            +
Sbjct  425  F  425



>ref|XP_010413021.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIP-VTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            +  GHSLGAT+ATLA+FD+ EN   G +D+P VTAIVFGSP++GN+ F   +    N ++
Sbjct  211  VFTGHSLGATVATLAAFDIAENVTSGYSDVPPVTAIVFGSPRVGNREFSDRIKRHNNARV  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQAMLHVVAGWN
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWN  330

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++ +FE+KV R +ALVNKSC  LREE L+P  WWVEKNK M+  E+G+ V+A+P+DED 
Sbjct  331  GKNGKFEMKVNRNIALVNKSCSLLREECLVPECWWVEKNKGMLKTEDGDWVIATPDDEDK  390

Query  151  PVPEY  137
            P+ E+
Sbjct  391  PIIEF  395



>ref|XP_006411539.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
 gb|ESQ52992.1| hypothetical protein EUTSA_v10017651mg [Eutrema salsugineum]
Length=396

 Score =   221 bits (562),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            ++ GHSLGAT+ATLA+FD+ EN     +D+ PVTAIVFGSP++GN+ F   +    N++I
Sbjct  211  VLTGHSLGATIATLAAFDMAENITSSYSDVRPVTAIVFGSPRVGNKEFSNRINRHNNVRI  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQAMLHVVAGWN
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLKIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWN  330

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++ ++E+KV R +ALVNKSC  L+EE L+P  WW+EKNK M   E+G+ V+A+P+DED+
Sbjct  331  GKNGKYEMKVNRNIALVNKSCALLKEECLVPECWWIEKNKGMFKTEDGDWVMATPDDEDM  390

Query  151  PVPEY  137
            PV E+
Sbjct  391  PVVEF  395



>ref|XP_010512889.1| PREDICTED: phospholipase A1-IIdelta-like [Camelina sativa]
Length=396

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 139/185 (75%), Gaps = 4/185 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIP-VTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            +  GHSLGAT+ATLA+FD+ EN   G +D+P VTAIVFGSP++GN+ F   +    N+++
Sbjct  211  VFTGHSLGATVATLAAFDIAENVTSGYSDVPPVTAIVFGSPRVGNREFSDRVKRHNNVRV  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQAMLHVVAGWN
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLEIDTRVSPFLKETHHPGDWHNLQAMLHVVAGWN  330

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++ +FE+KV R +ALVNKSC  L+EE L+P  WWVEKNK M+  E+G+ V+A+ +DED 
Sbjct  331  GKNGKFEMKVNRNIALVNKSCSLLKEECLVPKCWWVEKNKGMLKTEDGDWVMATLDDEDK  390

Query  151  PVPEY  137
            PV E+
Sbjct  391  PVVEF  395



>gb|AAD01804.1| lipase [Dianthus caryophyllus]
Length=447

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRNKI  491
            GHSLGATL+ +++FD+ EN  T+IPVTA+VFG P++GN+ F ++     NL +LH+RN I
Sbjct  271  GHSLGATLSVVSAFDIVENLTTEIPVTAVVFGCPKVGNKKFQQLFDSYPNLNVLHVRNVI  330

Query  490  DMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDREFE  311
            D+IP YP  L+GYV  G+E  ID RKST LK S N  DWHNLQA+LHVV+GW+G   EF+
Sbjct  331  DLIPLYPVKLMGYVNIGIELEIDSRKSTFLKDSKNPSDWHNLQAILHVVSGWHGVKGEFK  390

Query  310  LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPVPEY  137
            +  KR VALVNKSC+FL+EE L+P +WWV +NK MVL+++GE VLA P  E+ P PE+
Sbjct  391  VVNKRSVALVNKSCDFLKEECLVPPAWWVVQNKGMVLNKDGEWVLAPP--EEDPTPEF  446



>ref|XP_004969721.1| PREDICTED: phospholipase A1-II 5-like [Setaria italica]
Length=459

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 3/182 (2%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGV--TDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            +  GHSLGA+LATLA+FD+  NGV   D+PVTAIVFGSPQIGN  F +   E  NL+ LH
Sbjct  230  VCTGHSLGASLATLAAFDIAANGVCGADVPVTAIVFGSPQIGNPEFKERFDELPNLRALH  289

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAGWNG  329
            +RNK D+IP YP  LLGY   G    +D +KS  LK+ + N GD+HNLQA+LH VAGWNG
Sbjct  290  VRNKPDLIPLYPSGLLGYANVGDVLPVDSKKSPYLKENTTNVGDYHNLQAILHTVAGWNG  349

Query  328  EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLP  149
            +D EF+L+V R VALVNKSC FL+++ L+P SWWVE+NK MV+ E G   L  P +E+LP
Sbjct  350  KDGEFKLQVHRSVALVNKSCAFLKDDNLVPESWWVERNKGMVIGETGLWQLEPPAEENLP  409

Query  148  VP  143
            VP
Sbjct  410  VP  411



>ref|XP_006858341.1| hypothetical protein AMTR_s00064p00160550 [Amborella trichopoda]
 gb|ERN19808.1| hypothetical protein AMTR_s00064p00160550 [Amborella trichopoda]
Length=184

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 132/183 (72%), Gaps = 7/183 (4%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNLKIL  509
            GHSLGA LA L+SFD+  NG+  +      PVTA VFGSP +GN+ F+  +    +L++L
Sbjct  3    GHSLGACLAILSSFDVVANGLNMVGSKPPFPVTAFVFGSPGVGNKEFNDRVKSLPSLRVL  62

Query  508  HIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNG  329
            H++N ID+IP YPG  L Y K+G++ V+D R S  LK S+N  DWHNLQA++HVVAGW G
Sbjct  63   HVKNAIDLIPLYPGKFLDYEKTGVDLVVDTRASPYLKDSLNPSDWHNLQALIHVVAGWEG  122

Query  328  EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLP  149
            + + F LKV R VALVNKSC+FL++E L+P SWW+EKNK MV  E G+  L+ P D+D+P
Sbjct  123  K-KGFSLKVPRSVALVNKSCDFLKDECLVPASWWMEKNKGMVRGEGGDWYLSPPIDDDIP  181

Query  148  VPE  140
            +PE
Sbjct  182  LPE  184



>ref|NP_001044041.1| Os01g0710700 [Oryza sativa Japonica Group]
 sp|Q5NAI4.1|PLA5_ORYSJ RecName: Full=Phospholipase A1-II 5 [Oryza sativa Japonica Group]
 dbj|BAD81525.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05955.1| Os01g0710700 [Oryza sativa Japonica Group]
 dbj|BAG91498.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96630.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97590.1| unnamed protein product [Oryza sativa Japonica Group]
Length=465

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLGA+LATL +FD+  NGV+       IPVTA+VFGSPQIGN  F K   E+ NL
Sbjct  228  VCTGHSLGASLATLCAFDIVVNGVSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNL  287

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            + LH+RN  D+IP YP  LLGY   G    +D +KS  +K+  + GD+HNLQ +LH VAG
Sbjct  288  RALHVRNMPDLIPLYPSGLLGYANVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAG  347

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG+D EF+L+VKR VALVNKS  FL++  L+P SWWVE+NK MVL +NGE  L  P +E
Sbjct  348  WNGKDGEFKLQVKRSVALVNKSSGFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEE  407

Query  157  DLPVP  143
            +LPVP
Sbjct  408  NLPVP  412



>sp|B8A8C9.1|PLA5_ORYSI RecName: Full=Phospholipase A1-II 5 [Oryza sativa Indica Group]
 gb|EEC71366.1| hypothetical protein OsI_03470 [Oryza sativa Indica Group]
Length=465

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLGA+LATL +FD+  NGV+       IPVTA+VFGSPQIGN  F K   E+ NL
Sbjct  228  VCTGHSLGASLATLCAFDIVVNGVSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNL  287

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            + LH+RN  D+IP YP  LLGY   G    +D +KS  +K+  + GD+HNLQ +LH VAG
Sbjct  288  RALHVRNTPDLIPLYPSGLLGYANVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAG  347

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            W+G+D EF+L+VKR VALVNKS  FL++  L+P SWWVE+NK MVL +NGE  L  P +E
Sbjct  348  WDGKDGEFKLQVKRSVALVNKSSGFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEE  407

Query  157  DLPVP  143
            +LPVP
Sbjct  408  NLPVP  412



>gb|EEE55280.1| hypothetical protein OsJ_03214 [Oryza sativa Japonica Group]
Length=647

 Score =   215 bits (548),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLGA+LATL +FD+  NGV+       IPVTA+VFGSPQIGN  F K   E+ NL
Sbjct  410  VCTGHSLGASLATLCAFDIVVNGVSKVGDGAHIPVTAVVFGSPQIGNPEFKKQFEEQPNL  469

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            + LH+RN  D+IP YP  LLGY   G    +D +KS  +K+  + GD+HNLQ +LH VAG
Sbjct  470  RALHVRNMPDLIPLYPSGLLGYANVGKTLQVDSKKSPYVKRDTSPGDYHNLQGILHTVAG  529

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG+D EF+L+VKR VALVNKS  FL++  L+P SWWVE+NK MVL +NGE  L  P +E
Sbjct  530  WNGKDGEFKLQVKRSVALVNKSSGFLKDSNLVPESWWVERNKGMVLGQNGEWQLEGPAEE  589

Query  157  DLPVP  143
            +LPVP
Sbjct  590  NLPVP  594



>ref|XP_002458388.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
 gb|EES03508.1| hypothetical protein SORBIDRAFT_03g032660 [Sorghum bicolor]
Length=473

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 131/185 (71%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-----DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+     DIPVTAIVFGSPQIGN  F K   E  NL+
Sbjct  233  VCTGHSLGASLATLCAFDIAVNGVSRVGGADIPVTAIVFGSPQIGNPEFKKRFEELPNLR  292

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
             LH+RN  D+IP YP  LLGY  +G    +D +KS  +K  S N GD+HNLQ +LH VAG
Sbjct  293  ALHVRNTPDLIPLYPSGLLGYANAGDVLAVDSKKSPYVKDDSTNLGDYHNLQGILHTVAG  352

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG+D EF+L+V+R VALVNKS  FL+++ L+P SWWVE+NK MV+ E G   L  P +E
Sbjct  353  WNGKDGEFKLQVQRSVALVNKSSAFLKDDNLVPESWWVERNKGMVIGETGLWELEPPAEE  412

Query  157  DLPVP  143
            +LPVP
Sbjct  413  NLPVP  417



>ref|XP_002881868.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58127.1| hypothetical protein ARALYDRAFT_903642 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDIP-VTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            +  GHSLGAT+ATLA+FD+ EN   G  ++P VTAIVFGSP++GN+ F   +    N++I
Sbjct  211  VFTGHSLGATIATLAAFDIGENVTSGYGNVPPVTAIVFGSPRVGNREFWDRIKGHNNVRI  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQA-----MLHV  347
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQA     MLHV
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLKIDSRVSPFLKETHHPGDWHNLQASHSIAMLHV  330

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASP  167
            VAGWNG++ +FE+KV R +ALVNKSC  L+EE L+P  WWVEKNK M+  E G+ V+A+P
Sbjct  331  VAGWNGKNGKFEMKVNRNIALVNKSCALLKEECLVPECWWVEKNKGMLKTEGGDWVMATP  390

Query  166  NDEDLPVPEY  137
            +DED PV E+
Sbjct  391  DDEDKPVVEF  400



>ref|XP_006644603.1| PREDICTED: phospholipase A1-II 5-like [Oryza brachyantha]
Length=455

 Score =   210 bits (534),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLGA+LATL +FD+  NGV+       +PV A+VFGSPQIGN  F K   ++ NL
Sbjct  225  VCTGHSLGASLATLCAFDIVVNGVSKLRDGAHVPVAAVVFGSPQIGNPEFKKQFEQQPNL  284

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            + LH+RN  D+IP YP  LLGY   G    +D +KS  +K   + GD+HNLQ +LH VAG
Sbjct  285  RALHVRNMPDLIPLYPSGLLGYANVGQVLEVDSKKSPYVKHDTSPGDYHNLQGILHTVAG  344

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG++REF+L+V R VALVNKS  FL++  L+P SWWVE+NK MVL +NGE  L +P +E
Sbjct  345  WNGKNREFKLQVNRSVALVNKSSGFLKDSNLVPESWWVERNKGMVLGQNGEWQLEAPAEE  404

Query  157  DLPVP  143
            +LPVP
Sbjct  405  NLPVP  409



>emb|CDY50817.1| BnaC04g52540D [Brassica napus]
Length=392

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 139/185 (75%), Gaps = 8/185 (4%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCEN---GVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            ++ GHSLGAT+ATLA+ DL EN   G +D+ PVTAIVFGSP++GN+ F   +    N++I
Sbjct  211  VLTGHSLGATIATLAALDLAENVTSGSSDVTPVTAIVFGSPRVGNREFLNRINRHDNVRI  270

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            LH++N+ID+I  YP  ++GYV  G +  ID R S  LK++ + GDWHNLQA    +AGWN
Sbjct  271  LHVKNEIDLITRYPAKIMGYVNIGTKLKIDTRVSPYLKETHHPGDWHNLQA----IAGWN  326

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G+++++E+KV R +ALVNKSC  L+EE L+P  WWVEKNK M+ +E+G+ V+A+P+DED+
Sbjct  327  GKNQKYEMKVNRSIALVNKSCALLKEECLVPECWWVEKNKGMLKNEDGDWVMATPHDEDM  386

Query  151  PVPEY  137
            PV E+
Sbjct  387  PVVEF  391



>ref|XP_003569665.1| PREDICTED: phospholipase A1-II 5 [Brachypodium distachyon]
Length=471

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 128/185 (69%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-----PVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+ +     PV AIVFGSPQ+GN  F K   E  NL+
Sbjct  236  VCTGHSLGASLATLCAFDMVVNGVSKVGDAHVPVAAIVFGSPQVGNPEFKKRFDELPNLR  295

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILK-KSMNTGDWHNLQAMLHVVAG  338
             LH+RNK D+IP YP  LLGY   G    +D +KS  LK  + N GD+HNLQ +LH VAG
Sbjct  296  ALHVRNKPDLIPLYPSNLLGYANVGDVLSVDSKKSPHLKPDTTNVGDYHNLQGILHTVAG  355

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNG+D EF+L+V R VALVNKS  FL++E L+P SWWVEKNK MVL   GE  L  P +E
Sbjct  356  WNGKDGEFKLQVNRSVALVNKSSAFLKDENLVPESWWVEKNKGMVLGVTGEWQLEQPAEE  415

Query  157  DLPVP  143
            +LPVP
Sbjct  416  NLPVP  420



>emb|CDM83808.1| unnamed protein product [Triticum aestivum]
Length=462

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 128/185 (69%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-----PVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+ +     PVTAIVFGSPQ+GN  F K   E   L+
Sbjct  232  LCTGHSLGASLATLCAFDMVANGVSKVGDAHFPVTAIVFGSPQVGNPEFKKRFDELPGLR  291

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
             LH+RNK D+IP YP  LLGY   G E  ++ +KS  ++  + N GD+HNLQ +LH VAG
Sbjct  292  ALHVRNKPDLIPLYPSNLLGYANVGDELSVNSKKSPHVRPDTTNVGDYHNLQGILHTVAG  351

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGE  EF+L+V R VALVNKS  FL+++ L+P SWWVE+NK MVL   GE  L  P +E
Sbjct  352  WNGEKGEFKLQVNRSVALVNKSSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEQPAEE  411

Query  157  DLPVP  143
            +LPVP
Sbjct  412  NLPVP  416



>gb|EMS63050.1| Phospholipase A1-II 5 [Triticum urartu]
Length=510

 Score =   204 bits (518),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 128/185 (69%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-----PVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+ +     PVTAIVFGSPQ+GN  F K   E   L+
Sbjct  280  VCTGHSLGASLATLCAFDMVANGVSKVGDAHFPVTAIVFGSPQVGNPEFRKRFDELPGLR  339

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
             LH+RNK D+IP YP  LLGY   G E  ++ +KS  ++  + N GD+HNLQ +LH VAG
Sbjct  340  ALHVRNKPDLIPLYPSNLLGYANVGDELSVNSKKSPHVRPDTTNVGDYHNLQGILHTVAG  399

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGE  EF+L+V R VALVNKS  FL+++ L+P SWWVE+NK MVL   GE  L  P +E
Sbjct  400  WNGEKGEFKLQVNRSVALVNKSSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEQPAEE  459

Query  157  DLPVP  143
            +LPVP
Sbjct  460  NLPVP  464



>gb|EMT00730.1| Lipase [Aegilops tauschii]
Length=323

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-----IPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +  +  +GV+       PVTAIVFGSPQ+GN  F K   E   L+
Sbjct  93   VCTGHSLGASLATLCASAMVASGVSKGGDAHFPVTAIVFGSPQVGNPEFKKRFDELPGLR  152

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
             LH+RNK D+IP YP  LLGY   G E  ++ +KS  ++  + N GD+HNLQ +LH VAG
Sbjct  153  ALHVRNKPDLIPLYPSNLLGYANVGDELSVNSKKSPHVRPDTTNVGDYHNLQGILHTVAG  212

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGE  EF+L+V R VALVNKS  FL+++ L+P SWWVE+NK MVL   GE  L  P +E
Sbjct  213  WNGEKGEFKLQVNRSVALVNKSSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEQPAEE  272

Query  157  DLPVP  143
            +LPVP
Sbjct  273  NLPVP  277



>ref|XP_008675114.1| PREDICTED: phospholipase A1-II 5 [Zea mays]
 tpg|DAA57900.1| TPA: hypothetical protein ZEAMMB73_499727 [Zea mays]
Length=469

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 6/170 (4%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-----DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL++FD   NGV+     DIPVTAIVFGSPQIGN  F K   E  NL+
Sbjct  231  VCTGHSLGASLATLSAFDFAVNGVSRVGGADIPVTAIVFGSPQIGNPEFKKRFEELPNLR  290

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
             LH+RN  D+IP YP  LLGY  +G    +D +KS  +K  S N GD+HNLQ +LH VAG
Sbjct  291  ALHVRNMPDVIPLYPSGLLGYANAGDLLAVDSKKSPYVKHDSTNVGDYHNLQGILHTVAG  350

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            WNG+D EF+L+V R VALVNKS  FL ++ L+P SWWVE+NK MV+ E G
Sbjct  351  WNGKDGEFKLQVHRSVALVNKSSAFLTDDNLVPESWWVERNKGMVIGETG  400



>dbj|BAJ88202.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   195 bits (496),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 130/185 (70%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-----PVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+ +     PVTAIVFGSPQ+GN  F K   E  NL+
Sbjct  232  VCTGHSLGASLATLCAFDMVVNGVSKVRDAHFPVTAIVFGSPQVGNPEFKKRFDELPNLR  291

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
            +LH+RNK D+IP YP  LLGY   G    ++ +KS  ++  + N GD+HNLQ +LH VAG
Sbjct  292  VLHVRNKPDLIPLYPSNLLGYANVGDVLSVNSKKSPHVRSDTTNVGDYHNLQGILHTVAG  351

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGE  EF+L+V R VALVNKS  FL+++ L+P SWWVE+NK MVL   GE  L  P++E
Sbjct  352  WNGEKGEFKLQVNRSVALVNKSSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEEPSEE  411

Query  157  DLPVP  143
            +LPVP
Sbjct  412  NLPVP  416



>dbj|BAJ85876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 130/185 (70%), Gaps = 6/185 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-----PVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            +  GHSLGA+LATL +FD+  NGV+ +     PVTAIVFGSPQ+GN  F K   E  NL+
Sbjct  232  VCTGHSLGASLATLCAFDMVVNGVSKVRDAHFPVTAIVFGSPQVGNPEFKKRFDELPNLR  291

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVVAG  338
            +LH+RNK D+IP YP  LLGY   G    ++ +KS  ++  + N GD+HNLQ +LH VAG
Sbjct  292  VLHVRNKPDLIPLYPSNLLGYANVGDVLSVNSKKSPHVRSDTTNVGDYHNLQGILHTVAG  351

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDE  158
            WNGE  EF+L+V R VALVNKS  FL+++ L+P SWWVE+NK MVL   GE  L  P++E
Sbjct  352  WNGEKGEFKLQVNRSVALVNKSSAFLKDDNLVPESWWVERNKGMVLGPTGEWELEEPSEE  411

Query  157  DLPVP  143
            +LPVP
Sbjct  412  NLPVP  416



>ref|XP_010274489.1| PREDICTED: phospholipase A1-IIdelta-like [Nelumbo nucifera]
Length=200

 Score =   184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 117/181 (65%), Gaps = 29/181 (16%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIRN  497
            + GHSLGA L  L++FD+ ENG+  IPV AI+                            
Sbjct  48   ITGHSLGACLPILSAFDVVENGLWMIPVAAIIM---------------------------  80

Query  496  KIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDRE  317
              D+IP+YP  +LGY  +G E VID+RKS  L+ S N  DWHNLQ +LHVVA WNG DR+
Sbjct  81   -FDLIPQYPTQILGYQYTGTEVVIDNRKSPSLRDSKNPSDWHNLQGILHVVARWNGADRD  139

Query  316  FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED-LPVPE  140
            FELKVKR +ALVNKS ++L+EELL+P SWWVEKNK M LDE GE VL  P D+D +PVPE
Sbjct  140  FELKVKRSIALVNKSGDYLKEELLVPPSWWVEKNKGMELDEXGEWVLTPPFDDDNIPVPE  199

Query  139  Y  137
            +
Sbjct  200  F  200



>gb|ABK24664.1| unknown [Picea sitchensis]
Length=426

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 114/183 (62%), Gaps = 6/183 (3%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKIL  509
            GHSLGA LA L+ FD+ ++G+T      +IPVTA V G P +GN  F K       L++L
Sbjct  242  GHSLGAALAILSGFDIVQSGLTSVPGKPNIPVTAFVVGCPGVGNAAFKKRFEALPGLRVL  301

Query  508  HIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNG  329
             I N  D+IP YPG LL     G    ID RKS  LK S N  DWHNLQA LH+VAGW G
Sbjct  302  RIVNLPDLIPHYPGKLLMSEHVGSHLEIDTRKSPFLKDSKNPSDWHNLQAQLHIVAGWQG  361

Query  328  EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLP  149
                 + +  R VALVNKSC+FL+EE LIP SWWVEKNK M+ D  G   LA P ++DLP
Sbjct  362  PKNPLKFEGNRSVALVNKSCDFLKEECLIPASWWVEKNKGMIQDLKGMWALADPPEDDLP  421

Query  148  VPE  140
             PE
Sbjct  422  KPE  424



>gb|ABR18391.1| unknown [Picea sitchensis]
Length=412

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 121/180 (67%), Gaps = 9/180 (5%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTD-------IPVTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            GHSLGATLATL +FD+  NG+         IPVTAIVF SP++GN  F K++ +  +L++
Sbjct  233  GHSLGATLATLCAFDIVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRV  292

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            L + N  D++P +P   LGYV+ G+E  +D  KS  LK   +   WHNL+A LH VAG  
Sbjct  293  LRVTNNPDLVPLHP--FLGYVEVGVELPVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++  F+L+V R +ALVNKS ++L++E L+P SWWVEKNK MV   +G  ++A P DEDL
Sbjct  351  GKNGAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHWLMAKPPDEDL  410



>gb|ABK23399.1| unknown [Picea sitchensis]
Length=412

 Score =   173 bits (439),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 120/180 (67%), Gaps = 9/180 (5%)
 Frame = -3

Query  670  GHSLGATLATLASFDLCENGVTD-------IPVTAIVFGSPQIGNQVFDKMMGEKTNLKI  512
            GHSLGATLATL +FD+  NG+         IPVTAIVF SP++GN  F K++ +  +L++
Sbjct  233  GHSLGATLATLCAFDIVINGLNKPSGRAIPIPVTAIVFASPRVGNDAFKKVVDKLPDLRV  292

Query  511  LHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWN  332
            L + N  D++P +P   LGYV+ G+E  +D  KS  LK   +   WHNL+A LH VAG  
Sbjct  293  LRVTNNPDLVPLHP--FLGYVEVGVELRVDTVKSPYLKNPGDASRWHNLEAYLHTVAGTQ  350

Query  331  GEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
            G++  F+L+V R +ALVNKS ++L++E L+P SWWVEKNK MV   +G   +A P DEDL
Sbjct  351  GKNGAFKLEVDRDIALVNKSTDWLKDEYLVPVSWWVEKNKGMVQGNDGHWFMAKPPDEDL  410



>ref|XP_010107463.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC16094.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=399

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 120/184 (65%), Gaps = 13/184 (7%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT--DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            +V GHSLG  L TL++FDL E+ V   D+ V+A VFG PQ+G + F K++ + +NLKILH
Sbjct  208  VVTGHSLGGALVTLSAFDLAEHKVAGEDVLVSAFVFGCPQVGKEDFKKLVDDHSNLKILH  267

Query  505  IRNKIDMIPEYP-GALLGYVKSGL-EFVIDHRKSTILK-KSMNT-----GDWHNLQAMLH  350
            IRNK D+IP  P G    YV +   E V+D  KS   K KS  +     G+WHNL+A +H
Sbjct  268  IRNKKDIIPGLPDGDQSIYVPTQTAELVVDSDKSQYSKLKSYFSLTQMKGNWHNLEATMH  327

Query  349  VVAGWNGEDREFE--LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE-NGESV  179
            +VA WNG+D EF+   K  R +ALVNK C +L ++  IP SWW+EKNK M+ D+ +G+ +
Sbjct  328  LVAWWNGKDNEFDSAPKADRSLALVNKWCNYLNDDYKIPESWWIEKNKGMMFDQISGDWI  387

Query  178  LASP  167
            L  P
Sbjct  388  LDPP  391



>ref|XP_009353256.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=439

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 108/182 (59%), Gaps = 9/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL++ D+  NG+           PVTAI+F SP++GN  F+K+     +
Sbjct  256  ITGHSLGAAIATLSAIDIVANGLNRPKDLPNKACPVTAILFASPRVGNSNFEKVFSGYKD  315

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN +D++P YP    GY   G E  ID +KS  LK       WHN++  LH VA
Sbjct  316  LRALRVRNALDVVPNYP-IFFGYSDVGEELTIDTQKSKYLKSPGGVASWHNMEGYLHGVA  374

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G  R F+L+VKR +ALVNKS + L+EE LIP SW  EKNK M   E+G  VL    D
Sbjct  375  GTQGSKRGFKLEVKRDIALVNKSTDALKEEYLIPASWRCEKNKCMTQLEDGSWVLMDHED  434

Query  160  ED  155
             D
Sbjct  435  GD  436



>ref|XP_010279083.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=396

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 111/171 (65%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---DIP-----VTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA L TL + D+  NGV    D P     VTA +FG P++G+  F K++    N
Sbjct  216  VTGHSLGAALGTLNAVDIVANGVNKPKDHPEKACLVTAFLFGCPRVGDANFQKVVSSLEN  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN +D++P YP  L+GY   G E VID R+S+ LK S++ G+WHN++  LH VA
Sbjct  276  LRLLRVRNSLDLVPNYP--LVGYSDVGQELVIDTRQSSFLKSSVDPGNWHNMEGYLHGVA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G    F+L+V R ++LVNKS + L++E L+P  WW EKNK M+  E+G
Sbjct  334  GTQGTKGGFKLEVGRDISLVNKSTDALKDEYLVPMMWWCEKNKGMIQGEDG  384



>ref|XP_008812184.1| PREDICTED: phospholipase A1-II 1 [Phoenix dactylifera]
Length=401

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 103/171 (60%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG+           PV A VF SP++G+  F +       
Sbjct  218  VTGHSLGAALATLNAADIASNGLNKSNARPNKSSPVAAFVFASPRVGDSDFREAFSNIPE  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L IRN  D++P YP  LLGY   G+E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  278  LRLLRIRNVPDLVPNYP--LLGYDDIGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVA  335

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G NG    F+L+V R VALVNK  + L++E L+P SWWVEKNK MV   +G
Sbjct  336  GTNGGKGRFKLEVDRDVALVNKGLDALKDEYLVPASWWVEKNKGMVKGADG  386



>ref|XP_009352805.1| PREDICTED: phospholipase A1-IIgamma-like [Pyrus x bretschneideri]
Length=430

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 110/182 (60%), Gaps = 9/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL++ D+  NG+           PVTAIVF SP++GN  F+K+     +
Sbjct  247  ITGHSLGAAVATLSAIDIVANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKD  306

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRN +D++P YP  LLGY   G E  ID +KS  LK       WHN++  LH VA
Sbjct  307  LRALRIRNALDVVPNYP-ILLGYSDVGEELKIDTQKSKYLKSPGGVASWHNMEGYLHGVA  365

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+VKR +ALVNKS + L+EE LIP SW  E+NK M   E+G  VL    D
Sbjct  366  GTQGSKGGFKLEVKRDIALVNKSVDALKEEYLIPASWRCEENKCMTQLEDGSWVLKDHED  425

Query  160  ED  155
            +D
Sbjct  426  DD  427



>ref|XP_010912683.1| PREDICTED: phospholipase A1-II 1 [Elaeis guineensis]
Length=401

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 106/171 (62%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG+         + PVTA VF SP++G+  F +   +   
Sbjct  218  ITGHSLGAALATLNAADIASNGLNKSNAHPNKNSPVTAFVFASPRVGDSDFREAFSKIPE  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L IRN  D++P YP  LLGY   G+E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  278  LRLLRIRNVPDLVPNYP--LLGYDDVGVELTIDTRKSQYLKSPGNLSSWHNLEAYLHGVA  335

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  + F+L+V R VALVNKS + L++E L+P SW VEKNK MV   +G
Sbjct  336  GTRGGKKGFKLEVDRDVALVNKSMDALKDEYLVPASWRVEKNKGMVKGADG  386



>ref|XP_008383647.1| PREDICTED: phospholipase A1-IIgamma [Malus domestica]
Length=430

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 110/182 (60%), Gaps = 9/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL++ D+  NG+           PVTAIVF SP++GN  F+K+     +
Sbjct  247  ITGHSLGAAVATLSAIDIVANGLNRPKDMPNKACPVTAIVFASPRVGNSNFEKVFSGYKD  306

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRN +D++P YP  LLGY   G E  ID +KS  LK       WHN++  LH VA
Sbjct  307  LRALRIRNALDVVPNYP-ILLGYSDVGEELKIDTQKSKYLKSPGGVVSWHNMEGYLHGVA  365

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+VKR +ALVNKS + L+EE LIP SW  EKNK M   E+G  VL    +
Sbjct  366  GTQGSKGGFKLEVKRDIALVNKSVDALKEEYLIPASWRCEKNKCMTQLEDGSWVLKDHEE  425

Query  160  ED  155
            +D
Sbjct  426  DD  427



>ref|XP_010655496.1| PREDICTED: phospholipase A1-IIgamma isoform X2 [Vitis vinifera]
Length=321

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA +ATL + D+  NG+    PVTA+VF SP++G+  F K+     NL++L +R
Sbjct  146  LTGHSLGAAVATLNAVDIVANGLNQGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVR  205

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D+IP YP  LLGY   G E  +D RKS  LK   N   WHNL+A LH VAG  G   
Sbjct  206  NASDIIPNYP--LLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRG  263

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F L+V R +ALVNKS + L +E L+P SW  EKNK MV   +G   L    ++DL
Sbjct  264  GFRLEVNRDIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  319



>ref|XP_006362440.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=431

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 108/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            V GHS+GA +ATL + D+  NG+    PVTA +F SP++G++ F K   +  NL+ L IR
Sbjct  258  VTGHSMGAAMATLNAGDIVFNGINKGFPVTAFLFASPRVGDENFKKTFSKLENLRALRIR  317

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P YP  L GY   G+E VID RKS  LK   +   +HN    LH +AG  G   
Sbjct  318  NDPDIVPNYP--LFGYSDVGVELVIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKG  375

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F+L+V+R ++L+NK  + L++E  +P SWWVEKNK MV  +NG  +L    D+D 
Sbjct  376  GFKLEVERDISLINKYLDALKDEYGVPTSWWVEKNKGMVQQQNGSWILVDHEDDDF  431



>emb|CBI30665.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA +ATL + D+  NG+    PVTA+VF SP++G+  F K+     NL++L +R
Sbjct  193  LTGHSLGAAVATLNAVDIVANGLNQGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVR  252

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D+IP YP  LLGY   G E  +D RKS  LK   N   WHNL+A LH VAG  G   
Sbjct  253  NASDIIPNYP--LLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRG  310

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F L+V R +ALVNKS + L +E L+P SW  EKNK MV   +G   L    ++DL
Sbjct  311  GFRLEVNRDIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  366



>ref|XP_002266982.2| PREDICTED: phospholipase A1-IIgamma isoform X1 [Vitis vinifera]
Length=406

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/176 (47%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA +ATL + D+  NG+    PVTA+VF SP++G+  F K+     NL++L +R
Sbjct  231  LTGHSLGAAVATLNAVDIVANGLNQGCPVTAVVFASPRVGDSNFLKLFSALKNLRVLRVR  290

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D+IP YP  LLGY   G E  +D RKS  LK   N   WHNL+A LH VAG  G   
Sbjct  291  NASDIIPNYP--LLGYSDVGEELGVDTRKSKYLKSPGNLSTWHNLEAHLHGVAGTQGSRG  348

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F L+V R +ALVNKS + L +E L+P SW  EKNK MV   +G   L    ++DL
Sbjct  349  GFRLEVNRDIALVNKSIDALNDEYLVPVSWRCEKNKGMVQQVDGSWKLMDHEEDDL  404



>ref|XP_004485882.1| PREDICTED: phospholipase A1-IIgamma-like [Cicer arietinum]
Length=415

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENG--------VTDIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG        +   PVTAIVF SP++G+  F K+  ++ +
Sbjct  235  ITGHSLGAAIATLNAVDIVTNGYNKPNDSSIKASPVTAIVFASPRVGDTNFQKVFSDQKD  294

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  L IRN++D++P YP   +GY   G E  ID  KS  LK   N   WHNL+A LH VA
Sbjct  295  LSTLRIRNELDIVPNYP--FIGYSDVGEELKIDTTKSMYLKSPGNPLSWHNLEAYLHGVA  352

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G  R F+L+V R ++LVNK+ + L++E L+P SW V +NK MV   +G   L  P D
Sbjct  353  GTQGSKRGFKLEVNRDISLVNKTLDVLKDEYLVPISWRVVENKGMVQQPDGSWKLVDPED  412

Query  160  EDL  152
             D 
Sbjct  413  GDF  415



>ref|XP_010054330.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76146.1| hypothetical protein EUGRSUZ_D00522 [Eucalyptus grandis]
Length=410

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 102/183 (56%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  N             PVTA  F SP++G+  F K+  E  +
Sbjct  228  VTGHSLGAAIATLNAVDIVANAFNKPIGHQTNGCPVTAFAFASPRVGDSNFRKLFSELAD  287

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN +D++P YP  LLGY   G E  +D RKS  LK   N   WH L+  LH  A
Sbjct  288  LRVLRVRNALDIVPNYP--LLGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCAA  345

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G +  FEL V R VAL+NKS + L+ E L+P SWW  KNK MV   +G   L     
Sbjct  346  GTQGTNGGFELMVDRDVALINKSLDALKVEYLVPASWWCPKNKGMVQQADGSWKLMDHEA  405

Query  160  EDL  152
            +DL
Sbjct  406  DDL  408



>ref|XP_004233849.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 111/176 (63%), Gaps = 4/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTN-LKILHI  503
            V GHS+GA++ATL + D+  NG+    PVTA +F SP++G++ F+K   E  N L+ L +
Sbjct  219  VTGHSMGASIATLNAVDMVFNGINKGFPVTAFLFASPRVGDENFNKTFSELENQLRALRV  278

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN  D+IP YP   +GY   G+E ++D RKS  LK   +   WHNL+  LH VAG  G  
Sbjct  279  RNIPDIIPHYP--FIGYSDVGVELIMDTRKSDYLKSGGDYWTWHNLECYLHGVAGTQGSK  336

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
              F+L+V+R ++LVNK  + L++E  +P SWWV +NK MV  +NG  +L    DED
Sbjct  337  EGFKLEVERDISLVNKHMDTLKDEYGVPVSWWVVENKGMVQQQNGSWILMDHEDED  392



>ref|XP_010104409.1| Phospholipase A1-IIdelta [Morus notabilis]
 gb|EXC00254.1| Phospholipase A1-IIdelta [Morus notabilis]
Length=432

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 117/186 (63%), Gaps = 11/186 (6%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT--DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            +V GHSLG ++ATL++FD+ EN +   D+ V+A+VFG PQ+GN  F +++     LKILH
Sbjct  240  VVTGHSLGGSMATLSAFDIAENKIAGDDVLVSAVVFGCPQVGNVEFKELVDSNPKLKILH  299

Query  505  IRNKIDMIPEYPGALLG-YVK-SGLEFVIDHRKSTILK-KSM----NTGDWHNLQAMLHV  347
            I N  D +P+ P  +   Y+     +  ID  +S  LK KS+      GD HNL+A LHV
Sbjct  300  IHNIRDKVPDTPDWIFPVYIPIQTADLEIDTNRSPYLKSKSILPLETAGDAHNLEANLHV  359

Query  346  VAGWNGEDREFEL-KVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDEN-GESVLA  173
            VA WNG+ ++F+  KVKR +ALVNKSC FL E L +P  WWVEKNK M  DE+ GE V  
Sbjct  360  VAWWNGQFKKFDTPKVKRSLALVNKSCRFLVESLKVPEFWWVEKNKGMEYDESTGEWVFD  419

Query  172  SPNDED  155
             P   D
Sbjct  420  KPPPAD  425



>ref|XP_004293927.1| PREDICTED: phospholipase A1-IIgamma-like [Fragaria vesca subsp. 
vesca]
Length=438

 Score =   150 bits (380),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 111/186 (60%), Gaps = 12/186 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-----------TDIPVTAIVFGSPQIGNQVFDKMMGE  530
            + GHSLGA +ATL++ D+  NG+           +  PVTA VF  P++G+  F K+   
Sbjct  252  ITGHSLGAAIATLSAVDIVANGINKPKDQTANKLSSCPVTAFVFACPRVGDSNFKKLFSS  311

Query  529  KTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLH  350
              NL++L + N +D++P YP  L+GY + G E  ID RKS+ LK   +   WHNL+  LH
Sbjct  312  YNNLRVLRVSNALDIVPNYP-FLVGYSEVGEELGIDSRKSSYLKSPGSVLSWHNLEGYLH  370

Query  349  VVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             VAG  G    F+L+VKR +ALVNKS + L+EE L+P SW  EK+K MV  E+G   L  
Sbjct  371  GVAGTQGSKGGFKLEVKRDIALVNKSHDALKEEYLVPVSWRCEKDKGMVQMEDGSWQLMD  430

Query  169  PNDEDL  152
              +ED 
Sbjct  431  HEEEDF  436



>ref|XP_008225210.1| PREDICTED: phospholipase A1-IIgamma [Prunus mume]
Length=431

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 9/175 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NGV           PVTAIVF SP++G+  F+K+     +
Sbjct  247  ITGHSLGAAIATLNAVDIVANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKD  306

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            ++ L +RN +D++P YP   LGY   G E  ID RKS  LK       WHNL+  LH VA
Sbjct  307  VRALRVRNALDVVPNYP-IPLGYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVA  365

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G    F+L+VKR +ALVNKS + L+EE LIP SW  EKNK M   ++G  VL
Sbjct  366  GTQGSKGGFKLEVKRDIALVNKSADDLKEEYLIPASWRCEKNKCMTQLDDGSWVL  420



>ref|XP_007213350.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
 gb|EMJ14549.1| hypothetical protein PRUPE_ppa1027164mg [Prunus persica]
Length=402

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 104/175 (59%), Gaps = 9/175 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NGV           PVTAIVF SP++G+  F+K+     +
Sbjct  218  ITGHSLGAAIATLNAVDIVANGVNRPKEQPNKACPVTAIVFASPRVGDSNFEKVFSGHKD  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            ++ L +RN +D++P YP   LGY   G E  ID RKS  LK       WHNL+  LH VA
Sbjct  278  VRTLRVRNALDVVPNYP-IPLGYSNVGEELAIDTRKSKYLKSPGGLASWHNLEGYLHGVA  336

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G    F+L+VKR +ALVNKS + L EE LIP SW  EKNK M   ++G  VL
Sbjct  337  GTQGSKGGFKLEVKRDIALVNKSADDLEEEYLIPASWRCEKNKCMTQLDDGSWVL  391



>ref|XP_004232957.2| PREDICTED: phospholipase A1-II 1-like [Solanum lycopersicum]
Length=429

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            V GHS+GA++ATL + D+  NG+    PVTA +F SP++G++ F +   +  NL+ L IR
Sbjct  256  VTGHSMGASMATLNAGDIVFNGINKGFPVTAFLFASPRVGDENFKRTFSKLENLRALRIR  315

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P YP  L GY   G+E  ID RKS  LK   +   +HN    LH +AG  G   
Sbjct  316  NAPDLVPSYP--LFGYSDVGVELAIDTRKSGYLKSPGDQSSFHNTDCYLHGIAGTQGSKG  373

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F+L+V+R ++L+NK  + L++E  +P SWWVEKN  MV  +NG  +L    D+D 
Sbjct  374  GFKLEVERDISLINKYLDALKDEYGVPTSWWVEKNNGMVQQQNGTWILVDHEDDDF  429



>ref|XP_007148062.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
 gb|ESW20056.1| hypothetical protein PHAVU_006G177300g [Phaseolus vulgaris]
Length=424

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 109/183 (60%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL++ D+  NG            PVTAIVF  P++G+  F K+     +
Sbjct  244  ITGHSLGAAIATLSAVDIVANGYNKPSDPSLKASPVTAIVFACPRVGDTNFRKVFSGYKD  303

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            LK + IRN++D++P YP  L+GY   G E  ID RKS  LK   N   WHNL+  LH VA
Sbjct  304  LKTIRIRNELDIVPNYP--LVGYSDVGEELKIDTRKSMYLKSPGNPLSWHNLEGYLHGVA  361

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V R +AL+NK+ + L++ELL+P SW +EKNK MV   +G   L    D
Sbjct  362  GTQGSKGGFKLEVNRDIALLNKTLDALKDELLVPVSWRIEKNKGMVQQNDGSWKLMDHED  421

Query  160  EDL  152
            +D 
Sbjct  422  DDF  424



>gb|EYU17473.1| hypothetical protein MIMGU_mgv1a008748mg [Erythranthe guttata]
Length=363

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHS+GA ++TL + D+   G            PVTA VF SP++GN  F K      N
Sbjct  183  ITGHSMGAAVSTLNAVDIVAQGYNKPKDMPNKACPVTAFVFASPRVGNGSFQKFFSSLQN  242

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+IL +RN  D++P YP  L+GY + G E VID  +S+ LKK  N   WH L+  LH VA
Sbjct  243  LRILRVRNARDVVPLYP--LIGYSEVGEELVIDTEESSYLKKPGNFSSWHTLEGYLHGVA  300

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V R +ALVNK    L++E  +P SWW E+NK MV  E+G  +L     
Sbjct  301  GTQGSKGGFKLEVDRDIALVNKHMNLLKDEYCVPESWWCERNKGMVQKEDGSWLLMDHEH  360

Query  160  EDL  152
            +D 
Sbjct  361  DDF  363



>ref|XP_011462291.1| PREDICTED: LOW QUALITY PROTEIN: phospholipase A1-IIgamma-like 
[Fragaria vesca subsp. vesca]
Length=410

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 109/186 (59%), Gaps = 12/186 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-----------TDIPVTAIVFGSPQIGNQVFDKMMGE  530
            + GHSLGA +ATL++ D   NG+           +  PVTA VF  P++G+  F K+   
Sbjct  224  ITGHSLGAAIATLSAVDTVANGINKPKDRTANKLSSCPVTAFVFACPRVGDSNFKKLFSS  283

Query  529  KTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLH  350
              NL++L +RN +D++P YP  L+GY + G E  ID RKS+ LK   +   WHNL+  LH
Sbjct  284  YQNLRVLRVRNALDIVPNYP-FLVGYAEVGEELGIDTRKSSYLKSPGSVASWHNLEGHLH  342

Query  349  VVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             VAG  G    F+L+VKR +ALVN S + L++E L+P SW  EK+K MV  ++G   L  
Sbjct  343  GVAGTQGSKGGFKLEVKRDIALVNTSNDALKDEYLVPVSWRCEKDKGMVQMDDGSWQLMD  402

Query  169  PNDEDL  152
               ED 
Sbjct  403  HEKEDF  408



>gb|KHN08451.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  216  ITGHSLGAAIATLNAVDIVTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKD  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  + IRN++D++P YP  L+GY   G E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  276  LTTIRIRNELDIVPNYP--LVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F L+V R +ALVNK+ + L++ELL+P SW +EKNK M    +G   L    +
Sbjct  334  GTQGSKGGFNLEVHRDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  393

Query  160  EDL  152
            +D 
Sbjct  394  DDF  396



>ref|XP_009765842.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=414

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 75/176 (43%), Positives = 107/176 (61%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            V GHS+GA +ATL + D+  N      PVTA +F SP++G++ F K   +  NL+ L +R
Sbjct  241  VTGHSMGAAVATLNAVDIVFNEFNKGFPVTAFLFASPRVGDENFKKTFSKLVNLRALRVR  300

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P YP  LLGY   G++  ID  KST LK   +   WHN+   LH VAG  G   
Sbjct  301  NAPDIVPNYP--LLGYSDVGVQLDIDTTKSTYLKSPGDESSWHNMDCYLHGVAGTQGSKG  358

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F+L+V+  +++VNK  + L++E  +P SWWVEKNK MV  ++G  +L    D+DL
Sbjct  359  GFKLEVQHDISVVNKYLDALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHEDDDL  414



>ref|XP_009389474.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=377

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 110/179 (61%), Gaps = 11/179 (6%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-------PVTAIVFGSPQIGNQVFDKMMGEKTN  521
            +  GHSLG  LA L+++D+ ++G++ I       PV A+VF SP++GNQ F     ++ N
Sbjct  200  VCVGHSLGGALAILSAYDIVKHGLSKIGETEEYFPVCAMVFESPRVGNQAFRDSWEQQPN  259

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L ++NK D +PE P    GYV  G    +   +S  LK   + GD HNLQ +LH VA
Sbjct  260  LRLLRVKNKGDGVPELPRLEWGYVDVGTVLEVASEQSRFLK---SEGDKHNLQVILHTVA  316

Query  340  GWNGEDREFE-LKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASP  167
            GW G    F+  +VKR +ALVNK  + L +E  IP SWWVEKNK MVLD++G  V A P
Sbjct  317  GWEGASGGFDPTRVKRSLALVNKQGDDLVDECKIPASWWVEKNKGMVLDKDGNWVEAPP  375



>emb|CDM83551.1| unnamed protein product [Triticum aestivum]
Length=394

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+A VFGSP++GN  F K      +L++L +R
Sbjct  221  ITGHSLGAALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  +K   N   WH+++  +H VAG  G + 
Sbjct  281  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL+V R +ALVNK  + L+EE  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  339  GFELEVDRDIALVNKHEDALKEEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>gb|KDP21073.1| hypothetical protein JCGZ_21544 [Jatropha curcas]
Length=401

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 102/171 (60%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTAIVF SP++G+  F K+      
Sbjct  218  VCGHSLGAALATLNAVDIIANGFNKSKTFPNKACPVTAIVFASPRVGDSGFKKVFSGYKE  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L I N +D++P YP  L+GY + G E VID  KS  LK   N   WHNL+  LH VA
Sbjct  278  LRALRIHNNLDIVPNYP--LIGYAEVGEELVIDTTKSNYLKSPGNVSSWHNLEGYLHGVA  335

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G    F+L++ R +ALVNKS + L++E L+P SW ++KNK MV   +G
Sbjct  336  GTQGSKGGFKLEINRDIALVNKSLDGLKDEYLVPPSWRIQKNKGMVQQSDG  386



>ref|XP_003541709.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=421

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  241  ITGHSLGAAIATLNAVDIVTNGYNKPNDPSLKASPVTAIVFASPRVGDINFQKVFSGYKD  300

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  + IRN++D++P YP  L+GY   G E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  301  LTTIRIRNELDIVPNYP--LVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVA  358

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F L+V R +ALVNK+ + L++ELL+P SW +EKNK M    +G   L    +
Sbjct  359  GTQGSKGGFNLEVHRDIALVNKTLDALKDELLVPVSWRIEKNKGMFQQNDGSWKLMDHEE  418

Query  160  EDL  152
            +D 
Sbjct  419  DDF  421



>gb|KHN18919.1| Phospholipase A1-IIgamma [Glycine soja]
Length=396

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  216  ITGHSLGAAIATLNAVDIVTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKD  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  + IRN++D++P YP  L+GY   G E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  276  LTTIRIRNELDIVPNYP--LVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G       F+L+V R +ALVNK+ + L++E L+P SW  EKNK MV   +G   L    D
Sbjct  334  GTQRSKGGFKLEVHRDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  393

Query  160  EDL  152
            +D 
Sbjct  394  DDF  396



>ref|XP_009393076.1| PREDICTED: phospholipase A1-II 1 [Musa acuminata subsp. malaccensis]
Length=396

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 103/175 (59%), Gaps = 10/175 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV--------TDIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  N          T  PVTA VF SP++G+  F K+     +
Sbjct  215  ITGHSLGAAVATLNAVDIVANSFNRSSNPSSTGCPVTAFVFASPRVGDFEFQKLFSGTPD  274

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN  D++P YP  ++ YV  G+E  ID RKS  LK   +   WHNL+  LH  A
Sbjct  275  LRLLRVRNAPDLVPNYP--IIPYVDVGVELAIDTRKSEYLKAPGDLTTWHNLECYLHGTA  332

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G    F+L + R VALVNKS + L++E L+P SWWVEKNK M+   +G   L
Sbjct  333  GAQGRRGGFKLAIDRDVALVNKSTDALKDEYLVPDSWWVEKNKGMMKGADGHYKL  387



>ref|XP_003593747.1| Lipase [Medicago truncatula]
 gb|AES63998.1| phospholipase A1 [Medicago truncatula]
Length=414

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  234  ITGHSLGAAIATLNAVDIVTNGFNKPSDPSLKASPVTAIVFASPRVGDTNFQKLFSSYKD  293

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  L IRN++D++P YP   +GY   G E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  294  LSTLRIRNELDIVPNYP--FIGYSDVGEELKIDTRKSMYLKSPGNILSWHNLEAYLHGVA  351

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G  R F+L+V R +ALVNK+ + L++E L+P SW V +NK MV   +G   L    D
Sbjct  352  GTQGSKRVFKLEVNRDIALVNKTLDGLKDEYLVPVSWRVVENKGMVQQLDGSWKLIDHED  411

Query  160  EDL  152
            ++ 
Sbjct  412  DEF  414



>ref|XP_003547164.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
Length=423

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  243  ITGHSLGAAIATLNAVDIVTNGYNKPSDPSLKASPVTAIVFASPRVGDINFQKVFSGYKD  302

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L  + IRN++D++P YP  L+GY   G E  ID RKS  LK   N   WHNL+A LH VA
Sbjct  303  LTTIRIRNELDIVPNYP--LVGYSDVGEELKIDTRKSMYLKSPGNPSSWHNLEAYLHGVA  360

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G       F+L+V R +ALVNK+ + L++E L+P SW  EKNK MV   +G   L    D
Sbjct  361  GTQRSKGGFKLEVHRDIALVNKTLDALKDEFLVPVSWRTEKNKGMVQQNDGSWKLMDHED  420

Query  160  EDL  152
            +D 
Sbjct  421  DDF  423



>dbj|BAJ96485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+A VFGSP++GN  F K      +L++L +R
Sbjct  221  ITGHSLGAALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  +K   N   WH+++  +H VAG  G + 
Sbjct  281  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL+V R +ALVNK  + L++E  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  339  GFELEVDRDIALVNKHEDALKKEYSIPSSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>gb|KCW74072.1| hypothetical protein EUGRSUZ_E02710 [Eucalyptus grandis]
Length=419

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 109/184 (59%), Gaps = 11/184 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  NG+           PVTAIVF SP++G+  F +   E  +
Sbjct  232  VTGHSLGAAIATLNAVDIVANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQD  291

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRN  D++P YP  +L Y + G+E  I+ RKS  LK   +T  WHNL+  LH VA
Sbjct  292  LRALRIRNAFDIVPSYP--ILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVA  349

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SVLASPN  164
            G  G    F+L++ R V+LVNK  + L++E L+P SW  EKNK MV  E+G   ++    
Sbjct  350  GTQGSKGGFKLEINRDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  409

Query  163  DEDL  152
            D DL
Sbjct  410  DNDL  413



>ref|XP_010277744.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 111/184 (60%), Gaps = 11/184 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA L TL + D+  +G+            VTAI+F SP++G+  F ++     N
Sbjct  216  ITGHSLGAALGTLNAADIVAHGLNKPRNHPHRACLVTAILFASPRVGDDNFQEVFSGLEN  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN +D++P YP  LLGY   G E  ID RKS  +K S N   WHNL+  LH VA
Sbjct  276  LRLLRVRNALDVVPNYP--LLGYSDVGEELAIDFRKSKFIKASANPSLWHNLECYLHGVA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V R +ALVNK+ + L++E L+P SWW EKNK MV  ++G   L   ++
Sbjct  334  GTQGAKGGFKLEVGRDIALVNKTTDALKDEHLVPVSWWCEKNKGMVQRDDGTWKLMD-HE  392

Query  160  EDLP  149
            ED P
Sbjct  393  EDYP  396



>gb|KJB57431.1| hypothetical protein B456_009G163800 [Gossypium raimondii]
Length=386

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 108/182 (59%), Gaps = 10/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDI--------PVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTA +F SP++G+  F K     ++
Sbjct  203  VTGHSLGAALATLNAIDIIANGYNKANNPSGEASPVTAFLFASPRVGDSNFKKKFTGYSD  262

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN ID +P+YP  ++GY   G E  ID RKS  L+ S N  +WH+L+A LH VA
Sbjct  263  LRALRVRNVIDAVPKYP--MVGYTDVGEELDIDTRKSKYLRSSGNWLNWHDLEAYLHGVA  320

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G +  F+L + R +ALVNKS   L++E L+P SW +EKNK MV  E+G   L     
Sbjct  321  GTQGCNGGFKLVISRDIALVNKSVNGLKDEYLVPVSWRIEKNKGMVQQEDGSWKLMDHQS  380

Query  160  ED  155
            +D
Sbjct  381  QD  382



>ref|XP_010054329.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
 gb|KCW76145.1| hypothetical protein EUGRSUZ_D00520 [Eucalyptus grandis]
Length=410

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/183 (42%), Positives = 101/183 (55%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  N             PVTAI F SP++G+  F K+  E  +
Sbjct  228  VTGHSLGAAIATLNAVDITANAFNKPIGHQTNGCPVTAITFASPRVGDSNFRKVFSELAD  287

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN +D++P YP  L+GY   G E  +D RKS  LK   N   WH L+  LH VA
Sbjct  288  LRALRVRNALDIVPNYP--LIGYSDVGEELAVDSRKSKYLKSPGNVSSWHGLEVYLHCVA  345

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G +  FEL V     L+NK+ + L++E L+P SWW  KNK MV   +G   L     
Sbjct  346  GTQGTNDGFELMVDHDATLINKALDALKDEYLVPASWWCPKNKGMVQQADGSWKLMDYEA  405

Query  160  EDL  152
            +DL
Sbjct  406  DDL  408



>gb|EAY75191.1| hypothetical protein OsI_03083 [Oryza sativa Indica Group]
 gb|EAZ12913.1| hypothetical protein OsJ_02836 [Oryza sativa Japonica Group]
Length=358

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+ + D+  NG     PV+A VFGSP++GN  F K      +L++L IR
Sbjct  186  ITGHSLGAALATINATDIVSNGYNKSCPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIR  245

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  KS  LK   N   WH+++  +H VAG  G + 
Sbjct  246  NSPDVVPNWPK--LGYSDAGTELMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNG  303

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             F+L++ R +ALVNK  + L+ E  IP SWWV +NK MV   +G   LA   D+D
Sbjct  304  GFKLEIDRDIALVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  358



>ref|XP_010057070.1| PREDICTED: phospholipase A1-IIgamma-like [Eucalyptus grandis]
Length=459

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 109/184 (59%), Gaps = 11/184 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  NG+           PVTAIVF SP++G+  F +   E  +
Sbjct  272  VTGHSLGAAIATLNAVDIVANGLNQPKDRRGRPCPVTAIVFASPKVGDSNFGEAFSEYQD  331

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRN  D++P YP  +L Y + G+E  I+ RKS  LK   +T  WHNL+  LH VA
Sbjct  332  LRALRIRNAFDIVPSYP--ILDYTEVGVELGINTRKSQYLKSPGSTSSWHNLECYLHGVA  389

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SVLASPN  164
            G  G    F+L++ R V+LVNK  + L++E L+P SW  EKNK MV  E+G   ++    
Sbjct  390  GTQGSKGGFKLEINRDVSLVNKRLDGLKDEYLVPVSWRCEKNKGMVQQEDGSWKLMDHEE  449

Query  163  DEDL  152
            D DL
Sbjct  450  DNDL  453



>ref|XP_008449390.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=479

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 100/171 (58%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA L TL + D+  N +           PVTA +FG P +G++ F K       
Sbjct  297  ITGHSLGAALGTLNATDIIANRINKGKKQPQKPCPVTAFLFGCPHVGDRNFRKTFNSMNE  356

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L +L  RNK D++P+YP  L GY K G E +ID RKS  LK       WH+L+A LH VA
Sbjct  357  LHLLRTRNKADIVPDYP--LTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVA  414

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G +  F L+VKR +A VNK+   L+EE L+PGSWW  +NK MV D +G
Sbjct  415  GTQGNEGGFMLEVKRDIARVNKALNALKEEYLVPGSWWCAQNKGMVQDADG  465



>ref|XP_009601720.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana tomentosiformis]
Length=426

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 105/176 (60%), Gaps = 3/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            V GHS+GA +ATL + D+  NG     PVTA +F SP++G++   K   +  NL+ L +R
Sbjct  253  VTGHSMGAAVATLNAVDMVFNGFNKGFPVTAFLFASPRVGDENLKKTFSKLENLRTLRVR  312

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P YP  LLGY   G++  ID  KS  LK   +   WHN+   LH VAG  G   
Sbjct  313  NAPDIVPNYP--LLGYSDVGVQLDIDTTKSAYLKSPGDESSWHNMDCYLHGVAGTQGSKG  370

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDL  152
             F+L+V+  +++VNK    L++E  +P SWWVEKNK MV  ++G  +L    D+DL
Sbjct  371  GFKLQVQHDISVVNKYLGALKDEYGVPASWWVEKNKGMVQQQDGSWILMDHEDDDL  426



>emb|CDO96758.1| unnamed protein product [Coffea canephora]
Length=396

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 105/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  NG            PVTA V+ SP++G+Q F+K+  ++ N
Sbjct  216  VTGHSLGAAVATLNAVDIVANGFNKSVQNPGKACPVTAFVYASPRVGDQGFEKVFSQQQN  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            LK+L IRN +D++P YP  LLGY   G +  ID  KS  LK   N   WH+L+  +H +A
Sbjct  276  LKVLRIRNSLDVVPNYP--LLGYADVGEQLGIDTTKSKYLKSPGNLSSWHSLECYMHGIA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L   R VALVNK  + L++E  +P SWW  +NK MV   +G   L    D
Sbjct  334  GTQGLQGGFKLVANRDVALVNKHMDALKDEHCVPVSWWCIQNKGMVQQSDGSWKLEDHED  393

Query  160  EDL  152
            +D 
Sbjct  394  DDF  396



>gb|EMT15519.1| Lipase [Aegilops tauschii]
Length=394

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+A VFGSP++GN  F K      +L++L +R
Sbjct  221  ITGHSLGAALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFRKAFDSAEDLRLLRVR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  +K   N   WH+++  +H VAG  G + 
Sbjct  281  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL+V R +ALVNK  + L++E  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  339  GFELEVDRDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>ref|XP_004140112.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004165194.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 gb|KGN47948.1| hypothetical protein Csa_6G419450 [Cucumis sativus]
Length=398

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA L TL + D+  N +           PVT  +FGSP +G++ F K       
Sbjct  216  ITGHSLGAALGTLNATDIIANQINRGKKQPQKPCPVTVFLFGSPHVGDRNFRKTFNSMNE  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L +L  RNK D++P+YP  L GY K G E +ID RKS  LK       WH+L+A LH VA
Sbjct  276  LHLLRTRNKADIVPDYP--LTGYAKVGEELIIDTRKSEYLKSPGGFKSWHSLEAYLHGVA  333

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G +  F L+VKR +A VNK+   L+EE L+P SWW  +NK MV D +G
Sbjct  334  GTQGNEGGFTLEVKRDIARVNKALNALKEEYLVPESWWCAQNKGMVQDADG  384



>sp|A2WT95.2|PLA1_ORYSI RecName: Full=Phospholipase A1-II 1 [Oryza sativa Indica Group]
 sp|A2ZW16.2|PLA1_ORYSJ RecName: Full=Phospholipase A1-II 1 [Oryza sativa Japonica Group]
Length=393

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+ + D+  NG     PV+A VFGSP++GN  F K      +L++L IR
Sbjct  221  ITGHSLGAALATINATDIVSNGYNKSCPVSAFVFGSPRVGNPDFQKAFDSAPDLRLLRIR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  KS  LK   N   WH+++  +H VAG  G + 
Sbjct  281  NSPDVVPNWPK--LGYSDAGTELMIDTGKSPYLKAPGNPLTWHDMECYMHGVAGTQGSNG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             F+L++ R +ALVNK  + L+ E  IP SWWV +NK MV   +G   LA   D+D
Sbjct  339  GFKLEIDRDIALVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  393



>ref|XP_002522554.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF39854.1| triacylglycerol lipase, putative [Ricinus communis]
Length=422

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 108/184 (59%), Gaps = 11/184 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  NG            PVTAIVF SP++G+  F K+     +
Sbjct  239  VCGHSLGAAVATLNAADIVANGFNKSKSWPNKPCPVTAIVFASPRVGDSDFKKVFSGYKD  298

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L + N +D++P YP  L+GY   G E  ID  KS  LK   N   WHNL+  LH VA
Sbjct  299  LRVLRVHNLLDVVPNYP--LIGYADVGEELTIDTTKSKYLKSPGNVSSWHNLEGYLHGVA  356

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V R +ALVNKS + L++E L+P SW ++KNK M+   +G   L   ++
Sbjct  357  GTQGSTGGFKLEVNRDIALVNKSLDGLKDEYLVPTSWRIQKNKGMIQQADGSWKLMD-HE  415

Query  160  EDLP  149
            ED P
Sbjct  416  EDAP  419



>emb|CDO96757.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA +ATL + D+  NG            PVTA V+ SP++G Q F K+  ++ N
Sbjct  192  VTGHSLGAAVATLNAVDIVANGFNKSLENPGKACPVTAFVYASPRVGGQGFKKVFSQQQN  251

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L I+N +D++P YP  LLGY   G E  ID  KS  LK   N   WH+L+  +H VA
Sbjct  252  LRVLRIQNSLDVVPNYP--LLGYADVGEELRIDTTKSKYLKNPGNLSSWHSLECYMHGVA  309

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L V R VAL+NK  + L++E  +P SWW  +NK MV   +G   L    D
Sbjct  310  GKQGLQEGFKLVVNRDVALLNKYMDVLKDEHCVPVSWWCIQNKGMVQQADGSWELEDHED  369

Query  160  EDL  152
            +D 
Sbjct  370  DDF  372



>ref|XP_011045903.1| PREDICTED: phospholipase A1-IIgamma [Populus euphratica]
Length=414

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 107/182 (59%), Gaps = 8/182 (4%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            + GHSLGA +ATL + D+  NG          PVTAI+F SP++G+  F K+     +L+
Sbjct  233  IVGHSLGAAVATLNAVDIVANGFNQSQKNKRCPVTAILFASPRVGDSNFKKVFSGYKDLR  292

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
             L I N +D++P YP  L+GY   G E VID  KS  LK   N   WHNL+  LH VAG 
Sbjct  293  ALRIHNVLDVVPSYP--LIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGT  350

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             G    F+L+V R +ALVNK+ + L++E L+P SW V++NK MV   +G   L    ++ 
Sbjct  351  QGPKGGFKLEVNRDIALVNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDVEEDF  410

Query  154  LP  149
            +P
Sbjct  411  IP  412



>ref|XP_002305750.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE86261.2| lipase class 3 family protein [Populus trichocarpa]
Length=395

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 101/169 (60%), Gaps = 8/169 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            + GHSLGA LATL + D+  NG          PVTA++F SP++G+  F K+     +LK
Sbjct  216  ITGHSLGAALATLNAVDIVANGFNKSHENKGCPVTAMLFASPRVGDSNFKKVFSRYMDLK  275

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
             L + N +D++P+YP   +GY   G E +ID  KS  LK   N   WHNL+A LH VAG 
Sbjct  276  ALRVHNVLDVVPKYP--FIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGT  333

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
             G    FEL   R +AL+NK+ + L++E L+P SW +++NK MV   +G
Sbjct  334  QGSKGGFELVANRDIALINKTTDGLKDEYLVPASWRIQENKGMVQQADG  382



>gb|EPS68355.1| hypothetical protein M569_06415, partial [Genlisea aurea]
Length=197

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            V GHSLGA ++T+ + D+  NG     PVTA +FGSP+IG+  F + +     L++L +R
Sbjct  22   VVGHSLGAAISTVNAVDIVANGRNKSSPVTAFLFGSPRIGDYRFSRAVAALDGLRVLRVR  81

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P YP  LL Y   G E  ID  +S  LK   N   WHNL+  LH VAG  G   
Sbjct  82   NARDVVPAYPPPLL-YFDVGQELAIDTDRSEYLKLPGNVLTWHNLEVYLHGVAGTQGGGG  140

Query  319  E--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
               F L+V R V LVNK  +FL++E  +P SWW EKNK MV  E+G  +L   +D++
Sbjct  141  GGGFRLEVDRFVGLVNKRYDFLKDEYCVPVSWWCEKNKGMVQMEDGSWMLVDHDDDE  197



>ref|XP_010686320.1| PREDICTED: phospholipase A1-IIgamma-like [Beta vulgaris subsp. 
vulgaris]
Length=411

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 111/187 (59%), Gaps = 14/187 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLC---ENGVTDIP-----VTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+    +N   D P     VTAI+F SP++G+  F K+  +  N
Sbjct  223  ITGHSLGAALATLNAIDIVVNNKNKPKDNPQKQCLVTAIIFASPRVGDSNFKKIFPKYDN  282

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            LK+L + N +D++P YP  LLGY   G E +ID  KS  LK      +WHN++A LH VA
Sbjct  283  LKLLRVHNTLDIVPNYP--LLGYSDVGQELLIDTTKSPYLKVPGTFSNWHNMEAYLHGVA  340

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL----A  173
            G  G    F+L V R +ALVNKS + L++E LIP +WW  KNK MV   +G  +L     
Sbjct  341  GTQGSKNGFKLVVDRDIALVNKSMDNLKDEYLIPVAWWSLKNKGMVQQSDGSWLLMDNEM  400

Query  172  SPNDEDL  152
            S +D+D 
Sbjct  401  SDDDKDF  407



>ref|XP_010279086.1| PREDICTED: phospholipase A1-IIgamma-like [Nelumbo nucifera]
Length=398

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 108/184 (59%), Gaps = 10/184 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---DIP-----VTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA L TL + D+  NG     D P     VTA +F SP++G+  F K++    N
Sbjct  215  ITGHSLGAALGTLNAVDIVANGFNRPKDRPDKACLVTAFLFASPRVGDDKFQKLLSSLEN  274

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN +D++P YP  L+GY   G E VID +KST LK   N    HNL+  LH VA
Sbjct  275  LRLLRVRNALDIVPNYP--LIGYSDVGQELVIDTQKSTFLKSPANLSVSHNLEGYLHGVA  332

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V+R +ALVNKS + LR+E L+  SW  EKNK MV   +G   L    +
Sbjct  333  GTQGSKGGFKLEVERDIALVNKSIDGLRDEYLVLASWRCEKNKGMVQGADGSWKLMDHEE  392

Query  160  EDLP  149
            +  P
Sbjct  393  DYYP  396



>ref|XP_006644442.1| PREDICTED: phospholipase A1-II 1-like isoform X1 [Oryza brachyantha]
Length=397

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+  VFGSP++GN  F K      +L++L IR
Sbjct  225  ITGHSLGAALATISATDIVSNGYNKSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIR  284

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  LK   N   WH+++  +H VAG  G + 
Sbjct  285  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNG  342

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             F+L++ R ++LVNK  + L+ E  IP SWWV +NK MV   +G   LA   D+D
Sbjct  343  GFKLEIDRDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  397



>ref|XP_006644443.1| PREDICTED: phospholipase A1-II 1-like isoform X2 [Oryza brachyantha]
Length=396

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 105/175 (60%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+  VFGSP++GN  F K      +L++L IR
Sbjct  224  ITGHSLGAALATISATDIVSNGYNKSCPVSTFVFGSPRVGNSDFQKAFDSAPDLRLLRIR  283

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  LK   N   WH+++  +H VAG  G + 
Sbjct  284  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSNG  341

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             F+L++ R ++LVNK  + L+ E  IP SWWV +NK MV   +G   LA   D+D
Sbjct  342  GFKLEIDRDISLVNKHEDALKNEYAIPSSWWVVQNKGMVKGTDGRWHLADHEDDD  396



>ref|XP_009415331.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=389

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 107/173 (62%), Gaps = 12/173 (7%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI--------PVTAIVFGSPQIGNQVFDKMMGEKT  524
            +  G+SLG  LA L+SFD+   G++ I        PV A+VF +P++GN+ F+K   E  
Sbjct  203  VCVGYSLGGALAILSSFDMVNKGLSKIEGKAEEYFPVCAVVFENPKVGNKAFNKRFEELP  262

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            NL+ L +RN  D++P +P +   YV +G    ID   S  L  S+N    H+LQ +LH +
Sbjct  263  NLRALRVRNTRDIVPLWPIST-DYVDTGSFLEIDANMSPYLNNSVNN---HDLQVVLHTL  318

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE  185
            AGW  +  EF L+VKR +ALVNK   +L++E  IP +WWVEKNK MVL E+GE
Sbjct  319  AGWTSKGGEFHLEVKRSLALVNKGGGYLKDESQIPEAWWVEKNKGMVLSEDGE  371



>ref|XP_002456057.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
 gb|EES01177.1| hypothetical protein SORBIDRAFT_03g029630 [Sorghum bicolor]
Length=393

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 103/175 (59%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+ + D+  NG     PV+A VFGSP++GN  F +      +L++L +R
Sbjct  221  ITGHSLGAALATINAIDIVSNGYNRSCPVSAFVFGSPRVGNPDFQEAFDSAADLRLLRVR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P++P   LGY   G E  ID  +S  LK   N   WH+++  +H VAG  G   
Sbjct  281  NSPDVVPKWPK--LGYSDVGTELRIDTGESPYLKSPGNPLTWHDMECYMHGVAGAQGSSG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL V R +ALVNK  + L+ E  +P SWWV +NK MV  ++G   LA   D+D
Sbjct  339  GFELAVDRDIALVNKHEDALKNEFAVPSSWWVVQNKDMVKGKDGRWHLADHEDDD  393



>ref|XP_007025426.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY28048.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=417

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 99/171 (58%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTA +F SP++G+  F K      +
Sbjct  234  VTGHSLGAALATLNAIDIVANGYNRPKSQSRKASPVTAFLFASPRVGDSDFKKAFTGFKD  293

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L + N +D++P YP  L+GY   G E  ID RKS  L    N   WHNL+A LH VA
Sbjct  294  LRALRVGNALDVVPNYP--LVGYSDVGEELAIDTRKSKYLNSPGNLSSWHNLEAYLHGVA  351

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G    F L V R +ALVNKS + L++E L+P SW +EKNK MV  E+G
Sbjct  352  GTQGSKGGFALVVNRDIALVNKSIDGLKDEYLVPVSWRIEKNKGMVQQEDG  402



>gb|EMS63185.1| Phospholipase A1-II 1 [Triticum urartu]
Length=797

 Score =   145 bits (365),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDI-PVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+A VFGSP++GN  F K      +L++L +R
Sbjct  624  ITGHSLGAALATISATDIVSNGYNKTCPVSAFVFGSPRVGNSDFQKAFDSAEDLRLLRVR  683

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P +P   LGY  +G E +ID  +S  +K   N   WH+++  +H VAG  G + 
Sbjct  684  NSPDVVPNWPK--LGYSDAGTELMIDTGESPYIKSPGNPLTWHDMECYMHGVAGTQGSNG  741

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL+V R +ALVNK  + L++E  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  742  GFELEVDRDIALVNKHEDALKKEYSIPPSWWVVQNKGMVKGKDGRWHLADHEDDD  796



>ref|XP_008675277.1| PREDICTED: phospholipase A1-II 1 [Zea mays]
 tpg|DAA58340.1| TPA: hypothetical protein ZEAMMB73_464828 [Zea mays]
Length=395

 Score =   141 bits (355),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 104/176 (59%), Gaps = 4/176 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            + GHSLGA LAT+ + D+  NG      PV+A VFGSP++GN  F K      +L++L +
Sbjct  221  ITGHSLGAALATINATDIVSNGYNRSCCPVSAFVFGSPRVGNLDFQKAFDSAADLRLLRV  280

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGED  323
            RN  D++P++P   LGY   G E +ID  +S  LK   N   WH+++  +H VAG  G  
Sbjct  281  RNSPDVVPKWPK--LGYSDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGAQGSS  338

Query  322  REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
              FEL V R VALVNK  + LR E  +P SWWV +NK MV  ++G   LA   ++D
Sbjct  339  GGFELLVDRDVALVNKHEDALRNEFAVPPSWWVVQNKGMVKGKDGRWHLADHEEDD  394



>ref|XP_011074749.1| PREDICTED: phospholipase A1-IIgamma [Sesamum indicum]
Length=419

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 102/183 (56%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA ++TL + D+  NG            PVTA +F SP++G+  F K +    N
Sbjct  239  VTGHSLGAAVSTLNAIDIVVNGYNRPRDMPDKACPVTAFLFASPRVGDYKFRKFLSTLQN  298

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L IL + N  D++P YP   + Y + G E  ID  KS  LK   N   WHNL+A LH VA
Sbjct  299  LHILRVTNARDIVPTYP--FVNYAEVGQELPIDTDKSNYLKSPGNLNSWHNLEAYLHGVA  356

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G    F+L+V R +ALVNK  + L++E  +P SWW EK+K MV  E+G   L    D
Sbjct  357  GTQGSRGGFKLEVNRDIALVNKHLDGLKDEYCVPVSWWCEKHKGMVQQEDGSWKLMDHED  416

Query  160  EDL  152
            +D 
Sbjct  417  DDF  419



>dbj|BAA89335.1| EEF53 [Solanum melongena]
Length=200

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 112/186 (60%), Gaps = 15/186 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  +L 
Sbjct  19   VTGHSLGASLATLNAVDIAYNGINKSSNGKEFPVTAFVFASPKVGDLNFQKAFSKLKHLH  78

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGD---WHNLQAMLHVV  344
            IL + N +D++P+YP   +GY   G E +ID  KS  LK  +N GD    HNL+  LH +
Sbjct  79   ILRVNNLLDIVPKYPP--IGYFDVGQEILIDTTKSPYLK--LNPGDPHTRHNLEGYLHGI  134

Query  343  AGWNGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             G  G      F+L+V R +ALVN+  + L++E L+PG+WWVEK+  MV  ENG+ +L  
Sbjct  135  DGTQGVGPLDGFKLEVNRDLALVNRIWDILKDEYLVPGAWWVEKHNGMVQQENGKWILMD  194

Query  169  PNDEDL  152
              D +L
Sbjct  195  REDYEL  200



>ref|XP_011027707.1| PREDICTED: phospholipase A1-IIgamma-like [Populus euphratica]
Length=395

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (61%), Gaps = 8/169 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            + GHSLGA LATL + D+  NG          PVTA++F SP++G+  F K+     +LK
Sbjct  216  ITGHSLGAALATLNAVDIVANGFNMSHENKGCPVTAMLFASPRVGDSNFKKVFSGYMDLK  275

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
             + I N +D++P+YP   +GY   G E +ID  KS  LK   N   WHNL+A LH VAG 
Sbjct  276  AIRIHNFLDVVPKYP--FIGYADVGEELIIDTTKSKYLKSPGNVSSWHNLEAYLHGVAGT  333

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
             G    FEL V R +AL+NK+ + L++E L+P SW +++NK MV + +G
Sbjct  334  QGFKGGFELVVNRDIALINKTIDGLKDEYLVPVSWRIQENKGMVQEADG  382



>ref|XP_006467671.1| PREDICTED: phospholipase A1-IIgamma-like [Citrus sinensis]
 gb|KDO77813.1| hypothetical protein CISIN_1g014663mg [Citrus sinensis]
Length=420

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTAI+F SP++G+  F K++    +
Sbjct  236  VTGHSLGAALATLNAVDIAANGFNKPGGQPNKACPVTAIIFASPRVGDSTFKKVLSGYQD  295

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVV  344
            L++L IRN++D++P+YP  L+GY   G E  ID   S  LK  + N   WHNL+  LH V
Sbjct  296  LRVLRIRNELDVVPKYP--LIGYEDVGKELTIDTTNSKYLKNGAANFSGWHNLEVYLHGV  353

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SVLASP  167
            AG  G    F+L+V R ++LVNK+ + L+++ L+P SW + KNK MV   +G   ++   
Sbjct  354  AGTQGRKGGFQLEVNRDISLVNKTMDSLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHE  413

Query  166  NDEDL  152
             D+D+
Sbjct  414  KDDDI  418



>ref|XP_004969327.1| PREDICTED: phospholipase A1-II 1-like [Setaria italica]
Length=394

 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 104/175 (59%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+ + D+  NG     PV+A VFGSP++GN  F K      +L++L +R
Sbjct  221  ITGHSLGAALATINAIDIVSNGYNKSCPVSAFVFGSPRVGNPDFQKAFDSAADLRLLRVR  280

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P++P   LGY   G E +ID  +S  LK   N   WH+++  +H VAG  G   
Sbjct  281  NSPDVVPKWPK--LGYNDVGTELMIDTGESPYLKAPGNPLTWHDMECYMHGVAGTQGSSG  338

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             F+L V R +ALVNK  + L+ E  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  339  GFKLLVDRDIALVNKHEDALKNEYSIPTSWWVVQNKGMVKGKDGRWHLADHEDDD  393



>gb|EAZ12914.1| hypothetical protein OsJ_02837 [Oryza sativa Japonica Group]
Length=373

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN----------GVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D+  N          G T  PVTA+VFGSP+ G++ F       
Sbjct  184  VIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRL  243

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
             +L++L +RN+ D IP YP   +GY   G+E +ID R S  L++  +    H+L+  LH 
Sbjct  244  RDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHG  301

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL
Sbjct  302  VAGWHGDHRGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  358



>ref|XP_006449477.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
 gb|ESR62717.1| hypothetical protein CICLE_v10015361mg [Citrus clementina]
Length=420

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 111/185 (60%), Gaps = 12/185 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTAI+  SP++G+  F K++    +
Sbjct  236  VTGHSLGAALATLNAVDIAANGFNKPGGQPNKACPVTAIILASPRVGDSTFKKVLSGYQD  295

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVV  344
            L++L IRN++D++P+YP  L+GY   G E  ID  KS  LK  + N   WHNL+  LH V
Sbjct  296  LRVLRIRNELDVVPKYP--LIGYEDVGKELTIDTTKSKYLKNGTANFSGWHNLEVYLHGV  353

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SVLASP  167
            AG  G    F+L+V R ++LVNK+ + L+++ L+P SW + KNK MV   +G   ++   
Sbjct  354  AGTQGRKGGFQLEVNRDISLVNKTMDNLKDQYLVPVSWRILKNKGMVQQADGSWKLMDHE  413

Query  166  NDEDL  152
             D+D+
Sbjct  414  KDDDI  418



>sp|A2WT96.2|PLA2_ORYSI RecName: Full=Phospholipase A1-II 2 [Oryza sativa Indica Group]
Length=403

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN----------GVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D+  N          G T  PVTA+VFGSP+ G++ F       
Sbjct  214  VIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRL  273

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
             +L++L +RN+ D IP YP   +GY   G+E +ID R S  L++  +    H+L+  LH 
Sbjct  274  RDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHG  331

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL
Sbjct  332  VAGWHGDHRGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  388



>ref|XP_008675278.1| PREDICTED: phospholipase A1-II 2-like [Zea mays]
 tpg|DAA58341.1| TPA: hypothetical protein ZEAMMB73_357723 [Zea mays]
Length=412

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 106/184 (58%), Gaps = 12/184 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIP--------VTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGAT+ATL + D+  N    IP        VTAIVFGSP+ G+Q F  +     +
Sbjct  224  VVGHSLGATMATLNAVDIAANAYNKIPGYDSRRAPVTAIVFGSPRTGDQDFRDVFHRTPD  283

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN+ D IP YP   +GY   G+E +ID R+S  LK   +    H+L+  LH +A
Sbjct  284  LRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRRSPFLKHHGSESQSHDLEVHLHGIA  341

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLA--SP  167
            GW G+   FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL    P
Sbjct  342  GWQGDRGGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGGDGRWVLEDHDP  401

Query  166  NDED  155
            + ED
Sbjct  402  DYED  405



>ref|NP_001043730.2| Os01g0651200 [Oryza sativa Japonica Group]
 sp|Q0JKT4.1|PLA2_ORYSJ RecName: Full=Phospholipase A1-II 2 [Oryza sativa Japonica Group]
 dbj|BAF05644.2| Os01g0651200 [Oryza sativa Japonica Group]
Length=408

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN----------GVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D+  N          G T  PVTA+VFGSP+ G++ F       
Sbjct  219  VIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRL  278

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
             +L++L +RN+ D IP YP   +GY   G+E +ID R S  L++  +    H+L+  LH 
Sbjct  279  RDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHG  336

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL
Sbjct  337  VAGWHGDHRGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  393



>ref|XP_003569462.2| PREDICTED: LOW QUALITY PROTEIN: putative pentatricopeptide repeat-containing 
protein At5g52630 [Brachypodium distachyon]
Length=990

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 108/175 (62%), Gaps = 3/175 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHSLGA LAT+++ D+  NG     PV+A VFGSP++GN  F K      +L++L + 
Sbjct  818  ITGHSLGAALATISATDIVSNGYNQSCPVSAFVFGSPRVGNSDFQKAFDSADDLRLLRVE  877

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N  D++P++P   LGY ++G E +ID  +S  +K   N   WH+++  +H +AG  G + 
Sbjct  878  NSPDVVPKWPK--LGYSEAGTELMIDTGESPYIKTPGNPLTWHDMECYMHGIAGTQGSNG  935

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             FEL+V R +ALVNK  + L+ E  IP SWWV +NK MV  ++G   LA   D+D
Sbjct  936  GFELEVDRDIALVNKHEDALKNEYSIPSSWWVMQNKGMVKGKDGRWHLADHEDDD  990



>dbj|BAD68802.1| lipase-like protein [Oryza sativa Japonica Group]
Length=418

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN----------GVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D+  N          G T  PVTA+VFGSP+ G++ F       
Sbjct  229  VIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRL  288

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
             +L++L +RN+ D IP YP   +GY   G+E +ID R S  L++  +    H+L+  LH 
Sbjct  289  RDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHG  346

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL
Sbjct  347  VAGWHGDHRGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  403



>gb|EAY75192.1| hypothetical protein OsI_03084 [Oryza sativa Indica Group]
Length=418

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 104/177 (59%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN----------GVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D+  N          G T  PVTA+VFGSP+ G++ F       
Sbjct  229  VIGHSLGATLATLNAADIAANSYNTSSLSPSGETRAPVTAVVFGSPRTGDRGFRDAFHRL  288

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
             +L++L +RN+ D IP YP   +GY   G+E +ID R S  L++  +    H+L+  LH 
Sbjct  289  RDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLRRHGSESQSHDLECHLHG  346

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  NKSMV   +G  VL
Sbjct  347  VAGWHGDHRGFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHNKSMVKGPDGRWVL  403



>ref|XP_009773996.1| PREDICTED: phospholipase A1-II 1-like [Nicotiana sylvestris]
Length=403

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 106/188 (56%), Gaps = 15/188 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA LATL + D+  NG+       + PVTA VF SP +G+  F     +  NL 
Sbjct  218  VTGHSLGAALATLNAVDIVYNGINKKSNGKEFPVTAFVFASPNVGDLNFRAAFSKLKNLH  277

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G   VID  KS  +K   N   WHNL+A +H VAG 
Sbjct  278  ILRIDNLLDIVPKYPP--IGYIDVGQVLVIDTAKSDYVKSPGNILTWHNLEAYMHGVAGT  335

Query  334  NGED-------REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             G          EF+L+V R +ALVNKS + L+EE  +P +WWVEKN  MV   +   VL
Sbjct  336  QGVGILPGELLGEFKLEVNRDIALVNKSMDALKEEYGVPANWWVEKNNGMVQRADRSWVL  395

Query  175  ASPNDEDL  152
                D +L
Sbjct  396  MDREDYEL  403



>ref|XP_009415339.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=404

 Score =   138 bits (348),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 113/185 (61%), Gaps = 24/185 (13%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI-------PVTAIVFGSPQIGNQVFDKMMGEKTN  521
            +  GHSLG  LA L+SFD+   G++ I       PV A+VF +P++GN+ F++   +  N
Sbjct  206  VCVGHSLGGALAILSSFDIVNKGLSKIEGKEEHFPVCAVVFENPKVGNKAFNERFEKLPN  265

Query  520  LKILHIRNKIDMIPEYP--------GALLGYVKSGLE-----FVIDHRKSTILKKSMNTG  380
            L+ L +RN  D++P +P        G++L  + S L        ID + STILK   +  
Sbjct  266  LRALRVRNTWDIVPYWPLPTDYVVTGSVLD-IDSKLSPYLKVLDIDFKTSTILKILASN-  323

Query  379  DWHNLQAMLHVVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVL  200
              H+LQ +LH VAGW  +D EF LKV+R +ALVNK   +L++EL IP +WWVEKNK MV 
Sbjct  324  --HDLQVVLHTVAGWTWKDVEFHLKVERSLALVNKQGGYLKDELQIPEAWWVEKNKGMVP  381

Query  199  DENGE  185
            D++GE
Sbjct  382  DKDGE  386



>ref|XP_010518795.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Tarenaya 
hassleriana]
Length=412

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIP--VTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG        D P  VTA VF SP++GN  F K+     +
Sbjct  218  VCGHSLGAALATLNAADIVANGYNATQNRPDKPCLVTAFVFASPRVGNPDFKKLFSGYKS  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN  D++P YP   LGY   G E  ID RKS  LK   +   +HNL+A LH VA
Sbjct  278  LRGLRVRNLPDIVPTYPP--LGYSDVGEELTIDTRKSPYLKTPGDLVSFHNLEANLHGVA  335

Query  340  GWNGED-REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G   +EF+L+VKR ++L+NKS + L++E ++PGSW V KNK MV  ++G
Sbjct  336  GTQGTTTKEFKLQVKRDISLINKSIDALKDEYMVPGSWRVLKNKGMVQQDDG  387



>ref|XP_009775805.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=401

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F     +   L 
Sbjct  217  VTGHSLGASLATLNAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQMAFSKLKTLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   LGY+  G E +ID  KS  LK   +   WHNL+  +H VAG 
Sbjct  277  ILRIHNLLDIVPKYPP--LGYIDVGEELIIDTTKSPYLKLPGDVLTWHNLECYMHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R +AL NKS   L++E  IP +WW EK+K M+  E+G  +L    D
Sbjct  335  QGLGLLTGFKLEVNRDLALANKSSGALKDEYCIPANWWTEKHKGMIQQEDGTWLLLDRED  394

Query  160  EDL  152
             DL
Sbjct  395  YDL  397



>ref|XP_002316835.2| lipase class 3 family protein [Populus trichocarpa]
 gb|EEE97447.2| lipase class 3 family protein [Populus trichocarpa]
Length=414

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/182 (41%), Positives = 106/182 (58%), Gaps = 8/182 (4%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD------IPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            + GHSLGA +ATL + D+  NG          PVTA++F SP++G+  F ++     +L+
Sbjct  233  IVGHSLGAAVATLNAVDIVANGFNQSQKNKRCPVTAMLFASPRVGDSNFKRVFSGYKDLR  292

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
             L I N  D++P YP  L+GY   G E VID  KS  LK   N   WHNL+  LH VAG 
Sbjct  293  ALRIHNVRDVVPNYP--LIGYADVGEELVIDTTKSKYLKSPGNLSSWHNLEGYLHGVAGT  350

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             G    F+L+V R +AL+NK+ + L++E L+P SW V++NK MV   +G   L    ++ 
Sbjct  351  QGPKGGFKLEVNRDIALLNKTIDSLKDEYLVPASWRVQENKGMVQQADGSWKLMDLEEDF  410

Query  154  LP  149
            +P
Sbjct  411  IP  412



>ref|XP_004232943.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=402

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 108/187 (58%), Gaps = 10/187 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL +FD+  N +       + PVTA VF SP++G+  F     +  +L 
Sbjct  217  VTGHSLGASLATLNAFDIAYNKINKTSEGKEFPVTAFVFASPKVGDINFVNAFNKLKHLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            ++ I N +D++P+YP   LGY   G E +ID  KS  L    +   WHNL+  LH VAG 
Sbjct  277  VMRIHNVLDIVPKYPP--LGYFDVGQEIIIDTTKSPYLNLPGDILTWHNLECYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R +ALVNKS   L+ E L+P +WW  KNK MV  E+G+ VL    +
Sbjct  335  QGIGLLAGFKLEVDRDIALVNKSSGALKSEYLVPANWWTAKNKGMVQQEDGKWVLNDREE  394

Query  160  EDLPVPE  140
             D+ V E
Sbjct  395  YDIVVAE  401



>ref|XP_006646154.1| PREDICTED: phospholipase A1-II 2-like [Oryza brachyantha]
Length=361

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/178 (44%), Positives = 104/178 (58%), Gaps = 13/178 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN-----------GVTDIPVTAIVFGSPQIGNQVFDKMMGE  530
            V GHSLGATLATL + D+  N           G +  PVTA+VFGSP+ G++ F  +   
Sbjct  173  VIGHSLGATLATLNAADIAANSYNASGLGRAAGESRAPVTAVVFGSPRTGDRDFRDVFHR  232

Query  529  KTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLH  350
              +L++L +RN+ D IP YP   +GY   G+E +ID R S  LK   +    H+L+  LH
Sbjct  233  LPDLRMLRVRNRPDRIPHYPP--VGYADVGVELLIDTRLSPFLKPHGSESQSHDLECHLH  290

Query  349  VVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             VAGW+G+ R FEL V R VALVNK  + L +E  +P  W V  +KSMV   +G  VL
Sbjct  291  GVAGWHGDRRAFELVVDRDVALVNKFDDCLADEYPVPVRWKVHHDKSMVKGPDGRWVL  348



>gb|KJB69607.1| hypothetical protein B456_011G033600 [Gossypium raimondii]
Length=417

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 102/182 (56%), Gaps = 10/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIP--------VTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG             VTA +F SP++G+  F K      +
Sbjct  234  ITGHSLGAALATLNAIDIVANGYNKHQNQSSKAALVTAFLFASPRVGDSDFKKAFTGFKD  293

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN +D++P YP  L+GY   G E  ID RKS  +K   N   WHNL+  LH VA
Sbjct  294  LRALRVRNALDVVPNYP--LIGYSDVGEELGIDTRKSKYVKSPGNLSSWHNLEGYLHGVA  351

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G +  F L V R +ALVNKS + L++E ++P SW V KNK MV  E+G   L     
Sbjct  352  GTQGSEGGFSLVVNRDIALVNKSLDGLKDEYMVPVSWRVRKNKGMVQKEDGSWKLMDHEG  411

Query  160  ED  155
            +D
Sbjct  412  QD  413



>ref|XP_011101305.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
 ref|XP_011101310.1| PREDICTED: phospholipase A1-II 1-like [Sesamum indicum]
Length=411

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 104/183 (57%), Gaps = 11/183 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA ++T+ + D+  NG            PVTA VF  P++G+  F   +    N
Sbjct  232  VTGHSLGAAVSTINAVDIVVNGYNRPQGMLHKHCPVTAFVFACPRVGDNNFRDFVLNLQN  291

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L IL +RN  D++P+YP   + YV  G E  ID  KS+ LK+  N   WHNL+A LH VA
Sbjct  292  LHILRVRNARDIVPKYP--FIDYVDVGEELAIDTDKSSYLKEG-NLSSWHNLEAYLHGVA  348

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G +  F+L+V R +ALVNK  + L++E  +P SWW EKNK MV   +G  VL     
Sbjct  349  GTRGSEGGFKLEVNRDIALVNKHMDALKDEFCVPVSWWCEKNKGMVQQADGSWVLMDHEY  408

Query  160  EDL  152
            +D 
Sbjct  409  DDF  411



>ref|XP_004969328.1| PREDICTED: phospholipase A1-II 2-like [Setaria italica]
Length=425

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/176 (45%), Positives = 103/176 (59%), Gaps = 11/176 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN------GVTD---IPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGATLATL + D+  N      G  D    PVTA+VFGSP+ G++ F  +     
Sbjct  237  VVGHSLGATLATLNAADIVANACNKSSGFDDGRRAPVTAVVFGSPRTGDRAFRDVFHRLR  296

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
             L++L +RNK D IP YP   +GY   G+E +ID R+S  LK   N    H+L+  LH V
Sbjct  297  GLRMLRVRNKPDRIPHYP--PVGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGV  354

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            AGW G+   FEL V+R VALVNK  + L +E  +P  W V  NK+MV   +G  VL
Sbjct  355  AGWQGDGGGFELVVERDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVL  410



>ref|XP_002525127.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37254.1| triacylglycerol lipase, putative [Ricinus communis]
Length=398

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 103/181 (57%), Gaps = 8/181 (4%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL++ D+  NG+           PVTA VF  P+ G+  F ++    ++
Sbjct  217  VTGHSLGAALATLSAVDIVANGLNRSDDQASKACPVTAFVFACPRTGDLAFREVSDSFSD  276

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+IL + N  D+IP+ P   +GY   G    +D RKST LK +     WHNL+A +H +A
Sbjct  277  LRILRVTNTPDIIPKVPPLAIGYRDVGQNLELDSRKSTYLKPTGAFITWHNLEAYMHCIA  336

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G   +F L+V R +ALVNK    L++  L+P +WW EK+K MV  E+G   L    D
Sbjct  337  GTQGGKPDFHLEVNRDIALVNKKLNSLKDIYLVPSAWWQEKHKGMVQQEDGSWKLDDHED  396

Query  160  E  158
            +
Sbjct  397  D  397



>gb|KFK37116.1| hypothetical protein AALP_AA4G215000 [Arabis alpina]
Length=346

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 79/107 (74%), Gaps = 1/107 (1%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-DIPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHI  503
            ++ GHSLGAT A +A++D+ ENG   D+P+TAIVFG PQ+GN+ F   +    NLKILH+
Sbjct  236  VLTGHSLGATEAVIAAYDIAENGSNGDVPITAIVFGCPQVGNREFRDEVTSHKNLKILHV  295

Query  502  RNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQ  362
            RNKID++  YPG LLGYV  G+ FVID +KS  LK S N GDWHNLQ
Sbjct  296  RNKIDLLTRYPGGLLGYVDIGVNFVIDTKKSPYLKDSRNPGDWHNLQ  342



>ref|XP_006852476.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
 gb|ERN13943.1| hypothetical protein AMTR_s00021p00129470 [Amborella trichopoda]
Length=398

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 102/182 (56%), Gaps = 10/182 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV--------TDIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA L TL + D+  NG         T IPVT IVF SP++GN  F K       
Sbjct  217  ITGHSLGAALTTLNAIDIVANGTNIPKGRPGTQIPVTGIVFASPRVGNTEFKKRFEGSQG  276

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            LK+L + N +D++P YP  L+ Y   G+   ID RKS  LK  +     HNL+  LH VA
Sbjct  277  LKLLRVTNALDIVPNYP--LISYDDVGVNLGIDTRKSDFLKSPVGPSGVHNLEIYLHGVA  334

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G+   F+L++ R +ALVNKS + L+ +  +P SW VEKNK MV   +G   L    +
Sbjct  335  GTQGKKGGFKLEIPRDIALVNKSLDVLKVDYTVPASWKVEKNKGMVQLPDGSWKLMDHEN  394

Query  160  ED  155
            ED
Sbjct  395  ED  396



>ref|XP_004134929.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
 ref|XP_004155629.1| PREDICTED: phospholipase A1-IIgamma-like [Cucumis sativus]
Length=437

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 110/183 (60%), Gaps = 10/183 (5%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            +  GHSLGA LATL +FD+  N +          PVT+ VF SP++G+  F +   E  +
Sbjct  252  VTTGHSLGAALATLNAFDMAANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKD  311

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            + +L ++N +D++P YP  ++GY + G E  ID RKS  LK   +   WHNL+A LH VA
Sbjct  312  VHVLRVKNAMDVVPNYP--IIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVA  369

Query  340  GWNGEDR-EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPN  164
            G  G+++  F L+++R +AL+NKS + L++E L+P +W   +NK MV   +G   L    
Sbjct  370  GTQGKNKGGFRLEIERDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHE  429

Query  163  DED  155
            ++D
Sbjct  430  EDD  432



>gb|EMS52156.1| Phospholipase A1-II 2 [Triticum urartu]
Length=386

 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 102/177 (58%), Gaps = 13/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFD----------LCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D          LC  G +  PVTA+VFGSP+ G+  F  +    
Sbjct  199  VVGHSLGATLATLNAVDIAANYYNKSALCTAG-SRAPVTAVVFGSPRTGDHDFRDIFHRL  257

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
              L++L +RN+ D IP YP   +GY   G+E +ID R+S  LK   N    H+L+  LH 
Sbjct  258  PGLRMLRVRNRPDRIPLYPP--VGYADVGVELLIDTRRSPFLKPHGNESQSHDLECHLHG  315

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            VAGW GE  EFEL V R +ALVNK  + L +E  +P  W V  NK+MV   +G  VL
Sbjct  316  VAGWQGEHGEFELVVDRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGPDGRWVL  372



>gb|EYU36835.1| hypothetical protein MIMGU_mgv1a020546mg [Erythranthe guttata]
Length=426

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 104/186 (56%), Gaps = 13/186 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGE---  530
            V GHSLGA + TL + D+  N             PVT   F SP++G+  F K++     
Sbjct  242  VTGHSLGAAVCTLNASDIVVNKYNKPNDMPDKSCPVTVFAFASPRVGDDKFRKILSSLKT  301

Query  529  KTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLH  350
              NL IL +RN  D++P+YP   + Y + G+E VID  KS+ LK   N   WH+L+  LH
Sbjct  302  NNNLNILRVRNAKDIVPKYP--FIDYSEVGVELVIDTDKSSYLKSPGNLSSWHSLEGYLH  359

Query  349  VVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             VAG  G    F+L+V R +ALVNK  + L++E  +P SWW E+NKSMV  ++G   L  
Sbjct  360  GVAGTQGSRGGFKLEVNRSLALVNKHMDGLKDEYCVPVSWWCERNKSMVQSDDGSWELID  419

Query  169  PNDEDL  152
              D+D 
Sbjct  420  HEDDDF  425



>gb|KGN49294.1| hypothetical protein Csa_6G519470 [Cucumis sativus]
Length=443

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 110/183 (60%), Gaps = 10/183 (5%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            +  GHSLGA LATL +FD+  N +          PVT+ VF SP++G+  F +   E  +
Sbjct  258  VTTGHSLGAALATLNAFDMAANKLNVAATTGEAYPVTSFVFASPRVGDSDFKRAFSEYKD  317

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            + +L ++N +D++P YP  ++GY + G E  ID RKS  LK   +   WHNL+A LH VA
Sbjct  318  VHVLRVKNAMDVVPNYP--IIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEAYLHGVA  375

Query  340  GWNGEDR-EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPN  164
            G  G+++  F L+++R +AL+NKS + L++E L+P +W   +NK MV   +G   L    
Sbjct  376  GTQGKNKGGFRLEIERDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQSDGSWKLMDHE  435

Query  163  DED  155
            ++D
Sbjct  436  EDD  438



>ref|XP_002456058.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
 gb|EES01178.1| hypothetical protein SORBIDRAFT_03g029640 [Sorghum bicolor]
Length=436

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 105/184 (57%), Gaps = 12/184 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIP--------VTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGAT+ATL + D+  N     P        VTAIVFGSP+ G++ F  +     +
Sbjct  220  VVGHSLGATMATLNAADIVANAYNKTPGYDSRRAPVTAIVFGSPRTGDRDFRDVFHRLPD  279

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L IRN+ D IP YP   +GY   G+E +ID R+S  LK   N    H+L+  LH VA
Sbjct  280  LRMLRIRNRPDRIPHYPP--VGYADVGVELLIDTRRSPFLKPHGNESQSHDLEVHLHGVA  337

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS--P  167
            GW G+   FEL V R VALVNK  + L +E  +P  W V  NK+MV   +G  VL    P
Sbjct  338  GWQGDHGGFELVVDRDVALVNKFDDCLADEYPVPVGWKVHHNKNMVKGPDGRWVLEDHEP  397

Query  166  NDED  155
            + ED
Sbjct  398  DYED  401



>ref|XP_006340582.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=401

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 106/178 (60%), Gaps = 3/178 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHS+GA + TL + D+  NG      VTAI+F SP++G+  F     +  NL+IL + 
Sbjct  224  ITGHSMGAAVGTLNAIDIVVNGFNKGCLVTAILFASPRVGDSSFVNAFSKLENLRILRVT  283

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N +D+IP YP  L+ Y + G+E  ID  KS  LK   +   WH+L+A +H VAG+ G + 
Sbjct  284  NCLDIIPNYP--LIDYSEIGVELAIDTTKSKYLKVPGDIRSWHSLEAHMHGVAGYQGANG  341

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPV  146
             F+L+V+R ++LVNK    L++E  +P  WWVEKN  MV  ++G   L    D+D  V
Sbjct  342  GFKLEVRRDISLVNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGSWKLMDHEDDDDSV  399



>ref|NP_001043734.1| Os01g0651800 [Oryza sativa Japonica Group]
 sp|Q8RZ40.1|PLA3_ORYSJ RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAB89211.1| lipase-like [Oryza sativa Japonica Group]
 dbj|BAF05648.1| Os01g0651800 [Oryza sativa Japonica Group]
Length=420

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 99/177 (56%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLGA L+TL + D+  NG          +PVTAI   SP++G+  F +     +NL
Sbjct  236  ITGHSLGAALSTLNAIDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTSNL  295

Query  517  KILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
             +L +RN  D++P   P A    V  G E ++D R+S  LK       WHNL+  LH VA
Sbjct  296  SLLRVRNAPDIVPTILPSAFFKDV--GAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVA  353

Query  340  GWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G  +   F L V R +ALVNK  + LR+E  +P +WWVEKNK MV + +G  VL
Sbjct  354  GTQGAGDGAGFSLVVDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVL  410



>ref|XP_009795642.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=397

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 106/175 (61%), Gaps = 10/175 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VTGHSLGASLATLNAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G E +ID  KS  +K   +   WH L+  LH VAG 
Sbjct  277  ILRIHNLLDIVPKYPP--IGYIDVGKELMIDTTKSPYVKPPGDIASWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             G      F+L+V R ++LVNK  + L++E  IPG WWVEK+K MV  ++G  +L
Sbjct  335  QGIGILAGFKLEVNRDISLVNKMGDTLKDEHCIPGHWWVEKHKGMVQQQDGTWLL  389



>sp|B9EYD3.2|PLA4_ORYSJ RecName: Full=Phospholipase A1-II 4 [Oryza sativa Japonica Group]
Length=396

 Score =   135 bits (341),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 102/166 (61%), Gaps = 5/166 (3%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD---IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILH  506
            V GHSLGA +ATL + D+  NG+      PVTA+ F  P++G+  F K+  E   L++L 
Sbjct  217  VVGHSLGAAVATLNAADIVSNGLNQHGACPVTAVAFACPRVGDSGFRKLFDELPGLRLLR  276

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGE  326
            + N  D++P+YP   +GY   G+E  +D R+S  LK   N   WH+L+  +H VAG  G+
Sbjct  277  VCNSPDVVPKYP--PMGYADVGVELPVDTRRSPYLKSPGNQAVWHSLECYMHGVAGAQGK  334

Query  325  DREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
               F+L+V R VALVNK+ + L+EE  +P SW V+++K MV   +G
Sbjct  335  RGGFKLEVDRDVALVNKNVDALKEEYHVPPSWSVQRDKGMVRGADG  380



>ref|XP_009628625.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 107/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  277  ILRIHNVLDIVPKYPP--VGYIDVGEELIIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK  + +++E  IPG WWV+K+K MV  ++G  +L    +
Sbjct  335  QGIGILAGFKLEVNRDISLVNKQWDIIKDEYCIPGLWWVDKHKGMVQQQDGSWLLLDREE  394

Query  160  EDL  152
             D 
Sbjct  395  YDF  397



>ref|XP_002525129.1| triacylglycerol lipase, putative [Ricinus communis]
 gb|EEF37256.1| triacylglycerol lipase, putative [Ricinus communis]
Length=402

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 100/171 (58%), Gaps = 8/171 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV--TD------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL++ D+  NG   TD       PVTA  F  P+ GN+ F ++     +
Sbjct  220  VVGHSLGAALATLSAADIVANGFNRTDKQANKSCPVTAFAFACPRTGNRGFKQVCDSLED  279

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+IL I N  DM+P+ P  + GY + G    ID RKS  LK +     WHNL+  LH +A
Sbjct  280  LRILRITNTPDMVPKVPPLIAGYSEVGENLEIDSRKSMYLKPTGGFISWHNLETYLHTIA  339

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G+   F L+ +R ++LVNK+ + L+E+ ++PG+WW   N  M+  E+G
Sbjct  340  GTQGKRSAFRLECQRDISLVNKNLDALKEKYMVPGNWWCGLNNGMIQQEDG  390



>sp|A2WTA0.1|PLA3_ORYSI RecName: Full=Phospholipase A1-II 3; Flags: Precursor [Oryza 
sativa Indica Group]
 gb|EAY75196.1| hypothetical protein OsI_03088 [Oryza sativa Indica Group]
Length=420

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 98/177 (55%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLGA L+TL + D+  NG          +PVTAI   SP++G+  F +      NL
Sbjct  236  ITGHSLGAALSTLNAIDIVANGYNVRGSSRVPVPVTAIALASPRVGDDQFKRAFDSTPNL  295

Query  517  KILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
             +L +RN  D++P   P A    V  G E ++D R+S  LK       WHNL+  LH VA
Sbjct  296  SLLRVRNAPDIVPTILPSAFFKDV--GAELLVDTRRSPYLKNPAGPAQWHNLECYLHAVA  353

Query  340  GWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G  +   F L V R +ALVNK  + LR+E  +P +WWVEKNK MV + +G  VL
Sbjct  354  GTQGAGDGAGFSLVVDRDLALVNKEVDALRDEYQVPAAWWVEKNKGMVQNASGRWVL  410



>ref|XP_009619316.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=402

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 110/186 (59%), Gaps = 15/186 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VAGHSLGASLATLNAVDIAFNGINKTSSGKEFPVTAFVFASPKVGDLNFQKTFSKLKNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGD---WHNLQAMLHVV  344
            IL I N +D++P+YP   +GY+  G E +ID  KS  LK  +N GD    HNL+  LH +
Sbjct  277  ILRIHNLLDIVPKYPP--VGYIDVGEEIIIDTTKSPYLK--LNPGDPHTRHNLEGYLHGI  332

Query  343  AGWNGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             G  G      F+L+V R +ALVN+  + L++E  IP +WW EK+K MV  E+G  +L  
Sbjct  333  DGTQGIGILAGFKLEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLD  392

Query  169  PNDEDL  152
              D DL
Sbjct  393  REDYDL  398



>ref|XP_010108436.1| Phospholipase A1-IIgamma [Morus notabilis]
 gb|EXC19464.1| Phospholipase A1-IIgamma [Morus notabilis]
Length=426

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 100/171 (58%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  N             PVTAI+F SP++G+  F  +     +
Sbjct  247  ITGHSLGAAIATLNAVDIVSNRYNKPKHHPHKPCPVTAIIFASPRVGDSDFRNLFSSYKD  306

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L +RN +D++P YP  ++ Y   G E  ID  KS+ LK   N   WHNL+  LH +A
Sbjct  307  LRALRVRNALDIVPNYP--IIEYSDVGEELKIDTSKSSYLKSPGNISSWHNLEGYLHGLA  364

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G    F+L+V R +ALVNK+ + L++E L+P SW  EKNK MV  E+G
Sbjct  365  GTQGSKGGFKLEVHRDIALVNKTMDGLKDEYLVPESWRCEKNKGMVQLEDG  415



>dbj|BAH56866.1| AT2G42690 [Arabidopsis thaliana]
Length=384

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVF-DKMMGEKTNLKILH  506
            ++ GHSLGAT A LA++D+ ENG +D +PVTAIVFG PQ+GN+ F D++M  K NLKILH
Sbjct  233  VLTGHSLGATEAVLAAYDIAENGSSDDVPVTAIVFGCPQVGNKEFRDEVMSHK-NLKILH  291

Query  505  IRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAML  353
            +RN ID++  YPG LLGYV  G+ FVID +KS  L  S N GDWHNLQ  +
Sbjct  292  VRNTIDLLTRYPGGLLGYVDIGINFVIDTKKSPFLSDSRNPGDWHNLQVRI  342



>ref|XP_003566945.1| PREDICTED: phospholipase A1-II 2-like [Brachypodium distachyon]
Length=410

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 101/175 (58%), Gaps = 10/175 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCEN--------GVTDIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGATLATL + D+  N        G    PVTA+VFGSP+ G++ F         
Sbjct  221  VIGHSLGATLATLNAVDIAANSYNRFALNGRRATPVTAVVFGSPRTGDRDFRDAFHRVPG  280

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN+ D IP YP   +GY   G+E +ID R+S  LK   +    H+L+  LH +A
Sbjct  281  LRMLRVRNRPDRIPLYPP--VGYADVGVELLIDTRRSPFLKPHGSESQSHDLECHLHGIA  338

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            GW+GE   FEL V R VALVNK  + L +E  +P  W V  NK+MV   +G  VL
Sbjct  339  GWHGEHGAFELVVDRDVALVNKFDDCLADEYPVPVGWKVNHNKNMVKGRDGRWVL  393



>ref|XP_009777407.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  211  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLH  270

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  271  ILRIHNVLDIVPKYPP--IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGT  328

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK  + L++E  IPG WW +K+K MV  ++G  +L    +
Sbjct  329  QGIGILAGFKLEVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  388

Query  160  EDL  152
             D 
Sbjct  389  YDF  391



>ref|XP_009777406.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 106/183 (58%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDLNFHKAFSKLNNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  277  ILRIHNVLDIVPKYPP--IGYIDVGEELMIDTTKSPYVKPPGEVVSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK  + L++E  IPG WW +K+K MV  ++G  +L    +
Sbjct  335  QGIGILAGFKLEVNRDISLVNKQWDILKDEYCIPGLWWADKHKGMVQQQDGSWLLLDREE  394

Query  160  EDL  152
             D 
Sbjct  395  YDF  397



>ref|NP_001056386.2| Os05g0574000 [Oryza sativa Japonica Group]
 dbj|BAF18300.2| Os05g0574000 [Oryza sativa Japonica Group]
Length=216

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 101/188 (54%), Gaps = 15/188 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT----------DIPVTAIVFGSPQIGNQVFDKMM--G  533
            V GHSLGA LATL +FD+ ENG              PVTA VF SP++G   F +     
Sbjct  27   VTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGA  86

Query  532  EKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAML  353
                L++L +RN  D++P YP A   Y   G E  ID  +S  L++  N   WHNL+  L
Sbjct  87   RGLGLRLLRVRNARDVVPRYPPAPP-YHGVGTELAIDTGESPYLRRPGNELVWHNLECYL  145

Query  352  HVVAGWNG-EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SV  179
            H VAG  G E   F+L V+R VAL NKS   LR+E  +P  WW+  N+ MV   +G  ++
Sbjct  146  HGVAGARGGEAGRFKLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTL  205

Query  178  LASPNDED  155
            +    DED
Sbjct  206  MDREEDED  213



>ref|XP_006362431.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=389

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 105/181 (58%), Gaps = 9/181 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA  F SP++G+  F     +  +L+
Sbjct  212  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKSLR  271

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D+ P+YP   +GY   G E +ID  KS  ++       WH L+  LH VAG 
Sbjct  272  ILKIHNLLDIFPKYPP--IGYFDVGQELMIDTTKSPYVRPPGEPFSWHLLEPYLHGVAGT  329

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDED  155
             G    F+L+V R ++LVNK  + L++E  IPG WWVEKNK MV  E+G  +L   ++ D
Sbjct  330  QGL-AGFKLEVNRDISLVNKQWDVLKDEYCIPGFWWVEKNKGMVQQEDGSWLLLDHDEYD  388

Query  154  L  152
             
Sbjct  389  F  389



>ref|XP_009131946.1| PREDICTED: phospholipase A1-IIgamma-like [Brassica rapa]
Length=435

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 103/177 (58%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++GN  + K+     +
Sbjct  248  ICGHSLGAALATLNATDIVANGYNRPKSRLGKSCPVTAFVFASPRVGNSEYKKLFSGLED  307

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            +++L +RN  D++P YP   LGY + G EF ID RKS  +K   N   +H L++ LH VA
Sbjct  308  IRVLRVRNLPDVVPIYPP--LGYAEVGDEFPIDTRKSQYMKTPGNFATFHCLESYLHGVA  365

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G      F L VKR + LVNKS + L+++ +IPG W V KNK MV  ++G  VL
Sbjct  366  GTQGTSSADLFRLDVKRDIGLVNKSVDGLKDQYMIPGHWRVLKNKGMVQQDDGSWVL  422



>ref|XP_009626666.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana tomentosiformis]
Length=397

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 103/171 (60%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VTGHSLGASLATLNAVDITFNGINKTTEGKEFPVTAFVFASPKVGDFNFHKAFSKLNNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY+  G E +ID  KS  +K   +   WH L+  LH VAG 
Sbjct  277  ILRIHNVLDIVPKYPP--IGYIDVGKELMIDTTKSPYVKPPGDIVSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
             G      F+L+V R ++LVNK    L++E  IPG WWVEK+K MV  ++G
Sbjct  335  QGISILAGFKLEVNRNISLVNKMGNILKDEHCIPGLWWVEKHKGMVQQQDG  385



>ref|XP_007153707.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
 gb|ESW25701.1| hypothetical protein PHAVU_003G058100g [Phaseolus vulgaris]
Length=399

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 106/184 (58%), Gaps = 14/184 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+   G+           PVTA +F SP++GN  F K+  E  +
Sbjct  216  VTGHSLGAALATLNAVDIAAQGLNKPKDQPHRVFPVTAFLFASPRVGNSHFGKIFSEYKH  275

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRNK D +P+ P   +G    G E VID RKS  LK+ ++    HNL+A LH VA
Sbjct  276  LRALRIRNKKDQVPKLP---IGLAVVGQELVIDTRKSKYLKEGVSA---HNLEAYLHGVA  329

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
            G  G+   F L+V R +AL+NK  + L++E L+P  W V +NK MV   +G   L   N+
Sbjct  330  GTQGKKGGFNLEVNRDIALLNKGMDALKDEYLVPVEWRVHENKGMVQQSDGTWKLFDHNE  389

Query  160  EDLP  149
            + +P
Sbjct  390  DVIP  393



>emb|CDX99456.1| BnaC01g10960D [Brassica napus]
Length=402

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 102/177 (58%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++GN  + K+     +
Sbjct  215  ICGHSLGAALATLNATDIVANGYNRPKSRPGKSCPVTAFVFASPRVGNSEYKKLFSRLED  274

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            +++L +RN  D++P YP   LGY + G E  ID RKS  +K   N   +H L++ LH VA
Sbjct  275  IRVLRVRNLPDVVPIYPP--LGYAEVGDELPIDTRKSQYMKTPGNFATFHCLESYLHGVA  332

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G      F L VKR + LVNKS + L++E ++PG W V KNK MV  ++G  +L
Sbjct  333  GTQGTSSGDLFRLDVKRAIGLVNKSVDGLKDEYMVPGHWRVLKNKGMVQQDDGSWIL  389



>gb|KFK28527.1| hypothetical protein AALP_AA7G008200 [Arabis alpina]
Length=417

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 102/173 (59%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  230  VCGHSLGAALATLNAADIVANGYNRPKNRPDKSCPVTAFVFASPRVGDSDFKKLFSGLED  289

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L IRN  D++P YP   LGY + G E  ID+RKS  +K   N   +HNL+  LH VA
Sbjct  290  LRVLRIRNLPDVVPIYPP--LGYSEVGDELQIDNRKSPYMKSPGNLSTFHNLEGYLHGVA  347

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR + LVNKS + L++E ++PG W V KNK MV  ++G
Sbjct  348  GTQGTTKADLFRLDVKRDIGLVNKSVDGLKDEYMVPGYWRVLKNKGMVQLDDG  400



>gb|KCW89613.1| hypothetical protein EUGRSUZ_A01896, partial [Eucalyptus grandis]
Length=330

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 101/172 (59%), Gaps = 11/172 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGA LA+L + D+  NG             PVTA V+ SP++GN  F  +     
Sbjct  143  VAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSIP  202

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            +L++L   N +D++P+ PGA  GY  +G E +I+ + S  LK   N   WH+++  LH +
Sbjct  203  SLRLLRTANLLDVVPKVPGA--GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYLHGL  260

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            AG  G    F+L+VKR VALVNK   F+R+E L+P  WWV KN+ MV  E+G
Sbjct  261  AGTQGTKGGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDG  312



>ref|XP_008647947.1| PREDICTED: triacylglycerol lipase isoform X1 [Zea mays]
 gb|ACN26514.1| unknown [Zea mays]
 gb|AFW79274.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 99/176 (56%), Gaps = 11/176 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGA+LATL + DL  NGV            PVTA+VF SP++G+  F + +    
Sbjct  223  VCGHSLGASLATLNAVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFP  282

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            +L+ LH++N  D++P YP   LGYV   ++  I   +S  L++       HNL+  LH V
Sbjct  283  DLRALHVKNAGDIVPTYPP--LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGV  340

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            AG  G    F L+V R VALVNK  + L+++  +P  WWV KNK MV   +G   L
Sbjct  341  AGEQGSAGGFRLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYAL  396



>ref|XP_006362433.1| PREDICTED: phospholipase A1-II 1-like [Solanum tuberosum]
Length=403

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 103/180 (57%), Gaps = 15/180 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA +ATL + D+  NG        + PVTA VF SP +G+  F     +  NL 
Sbjct  218  VTGHSLGAAVATLNAVDIVYNGFNKTSNGKEFPVTACVFASPNVGDLNFRVAFSKLKNLH  277

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL + N +D++P+YP   +GY+  G   VID  KS  LK   N   WHNL+A LH VAG 
Sbjct  278  ILRVDNIVDIVPKYPP--IGYIDVGEVLVIDTAKSDYLKSPGNLQTWHNLEAYLHGVAGT  335

Query  334  NGED-------REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             G          +F+L+V R +ALVNKS + L+ E  +P +WWVEKNK MV  ++   VL
Sbjct  336  QGVGILIGEFFGDFKLEVDRDIALVNKSTDALKGEYGVPANWWVEKNKGMVQKKDKTWVL  395



>ref|NP_001151242.1| triacylglycerol lipase [Zea mays]
 gb|ACG42106.1| triacylglycerol lipase [Zea mays]
Length=402

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 99/176 (56%), Gaps = 11/176 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGA+LATL + DL  NGV            PVTA+VF SP++G+  F + +    
Sbjct  223  VCGHSLGASLATLNAVDLAANGVNAPPAGSSQPPCPVTALVFASPRVGDGNFKRAIASFP  282

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            +L+ LH++N  D++P YP   LGYV   ++  I   +S  L++       HNL+  LH V
Sbjct  283  DLRALHVKNAGDIVPTYPP--LGYVDVAVQLPIATGRSPYLRQPGTIATLHNLECYLHGV  340

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            AG  G    F L+V R VALVNK  + L+++  +P  WWV KNK MV   +G   L
Sbjct  341  AGEQGSAGGFRLEVDRDVALVNKGEDALKDQYPVPAQWWVAKNKCMVKGADGHYAL  396



>ref|XP_006362430.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=394

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 101/171 (59%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA  F SP++G+  F     +  +L+
Sbjct  214  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKLKSLR  273

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY   G E +ID  +S  +K   +   WH L+  LH VAG 
Sbjct  274  ILKIHNLLDIVPKYPP--IGYFDVGKELMIDTARSPYVKPPGDPASWHLLEPYLHGVAGT  331

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
             G      F+L+V R ++LVNK    L++E  IPG WWVEKNK MV  E+G
Sbjct  332  QGLGLLAGFKLEVNRDISLVNKQWNVLKDEYCIPGFWWVEKNKGMVQQEDG  382



>ref|XP_010439839.1| PREDICTED: phospholipase A1-IIgamma-like [Camelina sativa]
Length=435

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 101/173 (58%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  248  ICGHSLGAALATLNAADIVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLED  307

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L  RN  D+IP YP   +GY + G E  ID RKS  +K   N   +H L+A LH VA
Sbjct  308  LRVLRTRNLPDVIPIYPP--IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVA  365

Query  340  GWNGEDR--EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +  EF L VKR + LVNKS + L++E ++PG W V KNK MV  ++G
Sbjct  366  GTQGTAKADEFRLDVKRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDG  418



>ref|XP_004232965.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=394

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 105/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA  F SP++G+  F     +   L+
Sbjct  214  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFPFASPKVGDLQFKAAFDKIKGLR  273

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            +L I N +D++P+YP   +GY   G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  274  VLKIHNLLDIVPKYPP--IGYFDVGQELMIDTTKSPYVKPPGEPVSWHLLEPYLHGVAGT  331

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK  + L++E  IPG WWVEKNK MV  E+G  ++   ++
Sbjct  332  QGLGLLAGFKLEVNRDISLVNKQWDVLKDEYCIPGLWWVEKNKGMVQQEDGSWLMLDRDE  391

Query  160  EDL  152
             D 
Sbjct  392  YDF  394



>ref|XP_009787871.1| PREDICTED: phospholipase A1-IIgamma-like [Nicotiana sylvestris]
Length=402

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 109/186 (59%), Gaps = 15/186 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG        + PVTA VF SP++G+  F K   +  NL 
Sbjct  217  VAGHSLGASLATLNAVDIAFNGFNKTSSGKEFPVTAFVFASPKVGDLNFQKAFSKLKNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGD---WHNLQAMLHVV  344
            IL I N +D++P+YP   +G++  G E +ID  KS  LK  +N GD    HNL+  LH +
Sbjct  277  ILRIHNLLDIVPKYPP--IGFIDVGEEIIIDTTKSPYLK--LNPGDPHTRHNLEGYLHGI  332

Query  343  AGWNGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             G  G      F+L+V R +ALVN+  + L++E  IP +WW EK+K MV  E+G  +L  
Sbjct  333  DGTQGIGVLAGFKLEVNRDLALVNRIWDMLKDEYCIPAAWWTEKHKGMVQQEDGTWLLLD  392

Query  169  PNDEDL  152
              D DL
Sbjct  393  REDYDL  398



>ref|XP_010070312.1| PREDICTED: phospholipase A1-II 1 [Eucalyptus grandis]
Length=422

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 101/172 (59%), Gaps = 11/172 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGA LA+L + D+  NG             PVTA V+ SP++GN  F  +     
Sbjct  235  VAGHSLGAALASLNAVDIAWNGYNRSCGIQSQQPCPVTAFVYASPRVGNLKFCNIANSIP  294

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            +L++L   N +D++P+ PGA  GY  +G E +I+ + S  LK   N   WH+++  LH +
Sbjct  295  SLRLLRTANLLDVVPKVPGA--GYSDAGQELLINTQLSKYLKNPGNISKWHSVETYLHGL  352

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            AG  G    F+L+VKR VALVNK   F+R+E L+P  WWV KN+ MV  E+G
Sbjct  353  AGTQGTKGGFKLEVKRDVALVNKHQSFVRDEYLVPDEWWVMKNRGMVQMEDG  404



>ref|XP_006414089.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
 gb|ESQ55542.1| hypothetical protein EUTSA_v10025238mg [Eutrema salsugineum]
Length=436

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 101/173 (58%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  249  VCGHSLGAALATLNATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFMKLFYGLQD  308

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L IRN  D++P YP   LGY + G E  ID RKS  +K   N   +H L+A LH VA
Sbjct  309  LRVLRIRNLPDVVPIYPP--LGYAEVGDELPIDTRKSQYMKSPGNFATFHCLEAYLHGVA  366

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR + LVNKS + L++E +IPG W V KNK MV  ++G
Sbjct  367  GTQGTAKSDLFRLDVKRDIGLVNKSVDGLKDECMIPGHWRVLKNKGMVQQDDG  419



>ref|XP_004232942.2| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=398

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 111/186 (60%), Gaps = 15/186 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F     +  NL 
Sbjct  217  VAGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDVNFVNTFNKLKNLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGD---WHNLQAMLHVV  344
            I+ I N +D++P+YP   +GY   G E +ID  KS  LK  +N GD    HNL+  LH +
Sbjct  277  IMRIDNLLDIVPKYPP--IGYFDVGQEIIIDTTKSPYLK--LNPGDPHTRHNLEGYLHGI  332

Query  343  AGWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLAS  170
             G  G      F+L+V R +ALVN+  + L++E L+PG+WWVEK+  MV  ENG+ +L  
Sbjct  333  DGTQGIGPLDGFKLEVNRDLALVNRIWDILKDEHLVPGAWWVEKHNGMVQQENGKWILMD  392

Query  169  PNDEDL  152
              + +L
Sbjct  393  HEEYEL  398



>gb|EMT15520.1| Feruloyl esterase A [Aegilops tauschii]
Length=663

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 101/173 (58%), Gaps = 13/173 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFD----------LCENGVTDIPVTAIVFGSPQIGNQVFDKMMGEK  527
            V GHSLGATLATL + D          LC  G +  PVTA+VFGSP+ G++ F  +    
Sbjct  423  VVGHSLGATLATLNAVDIAANYYNKSALCTAG-SRAPVTAVVFGSPRTGDRDFRDIFHRL  481

Query  526  TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHV  347
              L++L +RN+ D IP YP   +GY   G+E +ID R+S  LK   N    H+L+  LH 
Sbjct  482  PGLRMLRVRNRPDRIPLYPP--VGYADVGVELLIDTRRSLFLKPHGNESQSHDLECHLHG  539

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            +AGW GE  EFEL V R +ALVNK  + L +E  +P  W V  NK+MV   +G
Sbjct  540  IAGWQGEHGEFELVVDRDIALVNKFDDCLTDEHPVPVGWKVHHNKNMVKGTDG  592



>ref|XP_006282609.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
 gb|EOA15507.1| hypothetical protein CARUB_v10004827mg [Capsella rubella]
Length=440

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 100/173 (58%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD--------IPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K+     N
Sbjct  253  ICGHSLGAALATLNAADIVANGYNRPKSRPDKACPVTAFVFASPRVGDSDFKKLFYGLEN  312

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L  RN  D+IP YP   +GY + G E  ID RKS  +K   N   +H L+A LH VA
Sbjct  313  LRVLRTRNLPDVIPIYPP--IGYSEVGDELPIDTRKSQYMKSPGNLASYHCLEAYLHGVA  370

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR + LVNKS + L++E ++PG W V KNK MV  ++G
Sbjct  371  GTQGTAKADIFRLDVKRDIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDG  423



>gb|EMT11182.1| hypothetical protein F775_27795 [Aegilops tauschii]
Length=474

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 98/174 (56%), Gaps = 9/174 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            V GHSLGA++ATL + DL  +G+          PVTAIVF SP +G + F        +L
Sbjct  297  VCGHSLGASVATLNAVDLVSSGINKPEGSTKSFPVTAIVFASPHVGCRFFRSAFNSFPDL  356

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            K LH++N  D++P YP   LGYV   +E  I   +S  ++K    G  HNL+  LH VAG
Sbjct  357  KALHVQNAGDVVPMYPP--LGYVDVAVELTIRTIRSPYIRKPATVGTLHNLECYLHGVAG  414

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
              G    F+L+V R +ALVNK  + L +E  +P  WWV ++K MV  E+G   L
Sbjct  415  EQGSAGGFKLEVDRDIALVNKGADALTDEHPVPACWWVPRHKFMVKGEDGRWTL  468



>ref|XP_004231490.1| PREDICTED: phospholipase A1-II 1 [Solanum lycopersicum]
Length=410

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 105/178 (59%), Gaps = 3/178 (2%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTD-IPVTAIVFGSPQIGNQVFDKMMGEKTNLKILHIR  500
            + GHS+GA + TL + D+  NG      VTAI+F SP++G+  F     +  NL+IL + 
Sbjct  233  ITGHSMGAAVGTLNAIDIVVNGFNKGCLVTAILFASPRVGDSNFVNAFSKLENLRILRVT  292

Query  499  NKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGWNGEDR  320
            N +D+IP YP  L+ Y + G+E  ID  KS  LK   +   WH+L+A +H VAG+ G + 
Sbjct  293  NCLDIIPNYP--LIDYSEIGVELGIDTTKSKYLKVPGDIRSWHSLEAYMHGVAGYQGANG  350

Query  319  EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPNDEDLPV  146
             F+L+V R ++L+NK    L++E  +P  WWVEKN  MV  ++G   L    D+D  V
Sbjct  351  GFKLEVGRDISLLNKHLNALKDEYCVPTCWWVEKNNGMVQQDDGYWKLMDHEDDDDSV  408



>emb|CDY53993.1| BnaA03g58180D [Brassica napus]
Length=351

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 103/177 (58%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  + K+     +
Sbjct  164  ICGHSLGAALATLNASDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGLED  223

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L ++N  D++P YP   LGY + G E  ID RKS  +K   N   +H L++ LH VA
Sbjct  224  LRVLRVKNLPDVVPIYPP--LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVA  281

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G  +   F L VKR + LVNKS + L +E ++PG+W V KNK MV  ++G  VL
Sbjct  282  GTQGTSKSDIFRLDVKRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVL  338



>ref|XP_002867985.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44244.1| lipase class 3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=418

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 101/173 (58%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K++    +
Sbjct  231  ICGHSLGAALATLNATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLLSILED  290

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            +++L  RN  D+IP YP   +GY + G E  ID RKS  +K   N   +H L+A LH VA
Sbjct  291  MRVLRTRNLPDVIPIYPP--IGYSEVGDELPIDTRKSQYMKSPGNLATFHCLEAYLHGVA  348

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR + LVNKS + L++E ++PG W V KNK MV  ++G
Sbjct  349  GTQGTAKADLFRLDVKRAIGLVNKSVDGLKDECMVPGKWRVLKNKGMVQQDDG  401



>ref|XP_006654823.1| PREDICTED: phospholipase A1-II 6-like [Oryza brachyantha]
Length=408

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 100/190 (53%), Gaps = 16/190 (8%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENG-----------VTDIPVTAIVFGSPQIGNQVFDKMM-  536
             V GHSLGA L TL +FD+  NG            T  PVTA  F SP++G   F +   
Sbjct  218  TVTGHSLGAALGTLNAFDIAANGYNRSPRAAAATATGCPVTAFAFASPRVGGHGFRRRFD  277

Query  535  -GEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQA  359
                  L++L +RN  D++P YP ALL Y   G E  ID  +S  L+   N   WHNL++
Sbjct  278  GARGAGLRLLRVRNARDIVPRYPTALL-YHDVGAELAIDTGESPYLRNPGNELLWHNLES  336

Query  358  MLHVVAGWNG-EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-  185
             LH VAG  G E   FEL V+R VAL NK    LR+E  +P  WW+  N+ MV   +G  
Sbjct  337  YLHGVAGARGGEAGRFELAVERDVALTNKFYGALRDEHPVPAGWWIPSNRGMVRGADGRW  396

Query  184  SVLASPNDED  155
            +++    DED
Sbjct  397  TLMDCEEDED  406



>ref|NP_193590.1| phospholipase A1-IIgamma [Arabidopsis thaliana]
 sp|O49523.1|DSEL_ARATH RecName: Full=Phospholipase A1-IIgamma; AltName: Full=DAD1-like 
seedling establishment-related lipase; Short=AtDSEL; Short=Phospholipase 
DSEL [Arabidopsis thaliana]
 emb|CAA16735.1| lipase-like protein [Arabidopsis thaliana]
 emb|CAB78857.1| lipase-like protein [Arabidopsis thaliana]
 gb|ABN04794.1| At4g18550 [Arabidopsis thaliana]
 gb|AEE84060.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=419

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 101/173 (58%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL++ D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  232  ICGHSLGAALATLSATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFRKLFSGLED  291

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            +++L  RN  D+IP YP   +GY + G EF ID RKS  +K   N   +H L+  LH VA
Sbjct  292  IRVLRTRNLPDVIPIYPP--IGYSEVGDEFPIDTRKSPYMKSPGNLATFHCLEGYLHGVA  349

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G ++   F L V+R + LVNKS + L++E ++PG W V KNK M   ++G
Sbjct  350  GTQGTNKADLFRLDVERAIGLVNKSVDGLKDECMVPGKWRVLKNKGMAQQDDG  402



>ref|XP_006644445.1| PREDICTED: phospholipase A1-II 3-like [Oryza brachyantha]
Length=426

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 96/177 (54%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLGA L+TL + D+  NG          +PVTAI   SP++G+  F +       +
Sbjct  242  ITGHSLGAALSTLNAVDIVANGYNVRGPSRVPVPVTAIALASPRVGDDQFKRAFDSMAGV  301

Query  517  KILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
             +L +RN  D++P   P A    V  G E ++D R+S  LK       WHNL+  LH VA
Sbjct  302  SLLRVRNAPDIVPTILPSAFFKDV--GAELLVDTRRSPYLKSPAGPAQWHNLECYLHAVA  359

Query  340  GWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G  +   F L V R VALVNK  + LR+E  +P +WW EKNK MV + +G  VL
Sbjct  360  GTQGAGDGAGFSLAVDRDVALVNKEVDALRDEYQVPAAWWGEKNKGMVQNASGRWVL  416



>gb|EMT05279.1| Lipase [Aegilops tauschii]
Length=300

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 100/176 (57%), Gaps = 10/176 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLG  L+TL + DL  NG        + +PVTAI FG+P++G++ F K       L
Sbjct  55   ITGHSLGGALSTLNAIDLVANGFNVHGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGL  114

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
             +L +RN  D++P     ++ Y   G+E ++D RKS  LK+      WHNL+  LH VAG
Sbjct  115  SLLRVRNVPDIVPTILPPVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAG  173

Query  337  WNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             +G  +   F L+V R +AL+NK  + LR+E  +P  WW E NK MV +  G  VL
Sbjct  174  THGARDVAGFGLEVDRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVL  229



>ref|XP_006364325.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=399

 Score =   130 bits (328),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 106/187 (57%), Gaps = 10/187 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  N +       + PVTA VF SP++G+  F     +   L 
Sbjct  214  VTGHSLGASLATLNAVDIAYNKINKSSHGKEFPVTAFVFASPKVGDLNFLNAFNKLKYLH  273

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            ++ I N +D++P+YP   +GY+  G E +ID  KS  L    +   WHNL+  +H VAG 
Sbjct  274  VMRIHNILDIVPKYPP--IGYLDVGQEIIIDTTKSPYLNLPGDILTWHNLECYMHGVAGT  331

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R +ALVNKS   L+ E L+P +WW  KNK M   E+G+ VL    +
Sbjct  332  QGIGLLTGFKLEVDRDIALVNKSSGALKSEYLVPANWWTVKNKGMFQQEDGKWVLNDREE  391

Query  160  EDLPVPE  140
             D+ V E
Sbjct  392  YDIVVAE  398



>gb|EEE64775.1| hypothetical protein OsJ_19631 [Oryza sativa Japonica Group]
Length=387

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 101/189 (53%), Gaps = 15/189 (8%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT----------DIPVTAIVFGSPQIGNQVFDKMM--  536
             V GHSLGA LATL +FD+ ENG              PVTA VF SP++G   F +    
Sbjct  197  TVTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDG  256

Query  535  GEKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAM  356
                 L++L +RN  D++P YP A   Y   G E  ID  +S  L++  N   WHNL+  
Sbjct  257  ARGLGLRLLRVRNARDVVPRYPPAPP-YHGVGTELAIDTGESPYLRRPGNELVWHNLECY  315

Query  355  LHVVAGWNG-EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-S  182
            LH VAG  G E   F+L V+R VAL NKS   LR+E  +P  WW+  N+ MV   +G  +
Sbjct  316  LHGVAGARGGEAGRFKLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWT  375

Query  181  VLASPNDED  155
            ++    DED
Sbjct  376  LMDREEDED  384



>emb|CDY01554.1| BnaC07g35440D [Brassica napus]
Length=433

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 103/177 (58%), Gaps = 12/177 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  + K+     +
Sbjct  246  ICGHSLGAALATLNATDIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDYRKLFSGFED  305

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L ++N  D++P YP   LGY + G E  ID RKS  +K   N   +H L++ LH VA
Sbjct  306  LRVLRVKNLPDIVPIYPP--LGYAEVGEELSIDTRKSQYMKSPGNFATFHCLESYLHGVA  363

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            G  G  +   F L VKR + LVNKS + L +E ++PG+W V KNK MV  ++G  VL
Sbjct  364  GTQGTSKNDIFRLDVKRDIGLVNKSVDGLTDECMVPGNWRVLKNKGMVQQDDGSWVL  420



>ref|XP_009414857.1| PREDICTED: phospholipase A1-Igamma2, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=508

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/183 (37%), Positives = 106/183 (58%), Gaps = 20/183 (11%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLG+ LATL ++D+ E  +        +P+    +G P++GN+ F K   +K  LK
Sbjct  298  VAGHSLGSALATLNAYDIAEMELIKGADGKQVPMAVFSYGGPRVGNEHF-KERCDKLGLK  356

Query  514  ILHIRNKIDMIPEYPGALL-------------GYVKSGLEFVIDHRKSTILKKSMNTGDW  374
            +L + N  D +P  PG L+             GYV  G+E ++DH+ S  LK S++  ++
Sbjct  357  VLRVVNVHDKVPTVPGVLINEHMPEFMLRAMDGYVHVGVELLLDHKHSPFLKDSLDPSNY  416

Query  373  HNLQAMLHVVAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDE  194
            HNL+A LH++ G+ G+ R+F     R  ALVNKSC+FL E L++P +W  ++NK M+  +
Sbjct  417  HNLEAHLHLLDGFQGKGRKFAPTTGRDPALVNKSCDFLHEHLMVPPNWRQDENKGMMRSQ  476

Query  193  NGE  185
             G 
Sbjct  477  EGR  479



>sp|Q6F358.1|PLA6_ORYSJ RecName: Full=Phospholipase A1-II 6 [Oryza sativa Japonica Group]
 gb|AAT69580.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAU44110.1| putative lipase [Oryza sativa Japonica Group]
Length=411

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 101/188 (54%), Gaps = 15/188 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT----------DIPVTAIVFGSPQIGNQVFDKMM--G  533
            V GHSLGA LATL +FD+ ENG              PVTA VF SP++G   F +     
Sbjct  222  VTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGA  281

Query  532  EKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAML  353
                L++L +RN  D++P YP A   Y   G E  ID  +S  L++  N   WHNL+  L
Sbjct  282  RGLGLRLLRVRNARDVVPRYPPAPP-YHGVGTELAIDTGESPYLRRPGNELVWHNLECYL  340

Query  352  HVVAGWNG-EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SV  179
            H VAG  G E   F+L V+R VAL NKS   LR+E  +P  WW+  N+ MV   +G  ++
Sbjct  341  HGVAGARGGEAGRFKLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTL  400

Query  178  LASPNDED  155
            +    DED
Sbjct  401  MDREEDED  408



>gb|EAY99121.1| hypothetical protein OsI_21080 [Oryza sativa Indica Group]
Length=399

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 101/188 (54%), Gaps = 15/188 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT----------DIPVTAIVFGSPQIGNQVFDKMM--G  533
            V GHSLGA LATL +FD+ ENG              PVTA VF SP++G   F +     
Sbjct  210  VTGHSLGAALATLNAFDIVENGYNRAPRAAAAAAGCPVTAFVFASPRVGGHGFKRRFDGA  269

Query  532  EKTNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAML  353
                L++L +RN  D++P YP A   Y   G E  ID  +S  L++  N   WHNL+  L
Sbjct  270  RGLGLRLLRVRNARDVVPRYPPAPP-YHGVGTELAIDTGESPYLRRPGNELVWHNLECYL  328

Query  352  HVVAGWNG-EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SV  179
            H VAG  G E   F+L V+R VAL NKS   LR+E  +P  WW+  N+ MV   +G  ++
Sbjct  329  HGVAGARGGEAGRFKLAVERDVALANKSYGALRDEHAVPAGWWIPSNRGMVRGADGRWTL  388

Query  178  LASPNDED  155
            +    DED
Sbjct  389  MDREEDED  396



>ref|XP_010469763.1| PREDICTED: phospholipase A1-IIbeta-like [Camelina sativa]
Length=411

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 105/182 (58%), Gaps = 11/182 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVTDIP---------VTAIVFGSPQIGNQVFDKMMGEKT  524
            + GHSLGA L+ L++ D   N +  I          VT   FGSP+IG++ F +++    
Sbjct  219  LTGHSLGAVLSILSAADFLHNELPKITPSLQHRLTCVTVFAFGSPRIGDRSFKRLVESFQ  278

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVV  344
            +L IL + N  D+IP YP  +  +   G E  I+  KS  LK+S+N G +HNL+A LH V
Sbjct  279  HLHILRVTNVPDLIPRYP--VFRFTDVGEELQINTLKSEYLKRSLNLGHFHNLEAYLHGV  336

Query  343  AGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPN  164
            AG      EF+L++KR +ALVNK  + L ++ L+PG WWV +NK MV  ++G   L    
Sbjct  337  AGTQHNQGEFKLEIKRDIALVNKGLDALEDKYLVPGHWWVLENKGMVQSDDGTWKLNGDR  396

Query  163  DE  158
            D+
Sbjct  397  DK  398



>ref|XP_004232962.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 103/183 (56%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LAT+ + D+  N +       + PVTA  F SP++G+  F     +  +L 
Sbjct  217  VTGHSLGASLATMNAVDIAFNKINKASNGKEFPVTAFAFASPKVGDIQFKATFDKLKHLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY   G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  277  ILRIHNLLDIVPKYPP--IGYFDVGKELMIDTTKSPYVKPPGENVSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK    L++E  IPG WWVEKNK MV  E+G  ++   ++
Sbjct  335  QGLGLFAGFKLEVNRDISLVNKQWNILKDEYCIPGMWWVEKNKGMVQQEDGSWLMLDRDE  394

Query  160  EDL  152
             D 
Sbjct  395  YDF  397



>ref|XP_008439757.1| PREDICTED: phospholipase A1-IIgamma [Cucumis melo]
Length=447

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 108/186 (58%), Gaps = 10/186 (5%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            +  GHSLGA LATL + D+  N +          PVT+ VF  P++G+  F +   E  +
Sbjct  258  VTTGHSLGAALATLNAVDIAANKLNIAAATGQAYPVTSFVFACPRVGDSEFKRAFSEYKD  317

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            + +L ++N +D++P YP   +GY + G E  ID RKS  LK   +   WHNL+  LH VA
Sbjct  318  VHVLRVKNAMDVVPNYP-MFIGYSEVGEELEIDTRKSKYLKSPGSLSSWHNLEGYLHGVA  376

Query  340  GWNGEDR-EFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE-SVLASP  167
            G  G+++  F L+++R +AL+NKS + L++E L+P +W   +NK MV   +G   ++   
Sbjct  377  GTQGKNKGGFRLEIERDIALLNKSLDALKDEYLVPVAWRCLQNKGMVQQTDGSWKLMDHE  436

Query  166  NDEDLP  149
             D++ P
Sbjct  437  EDDEFP  442



>ref|NP_001149813.1| triacylglycerol lipase [Zea mays]
 gb|ACG36877.1| triacylglycerol lipase [Zea mays]
Length=400

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 92/171 (54%), Gaps = 9/171 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENG-------VTDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            V GHSLGA LATL +FD+  NG           PVT+  F SP++G   F K       L
Sbjct  219  VTGHSLGAALATLNAFDIAANGYNVTATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGL  278

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++L +RN  D++P+YP  ++ Y   G E  ID  +S  L+       WHNL+  LH VAG
Sbjct  279  RLLRVRNARDVVPKYP--VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAG  336

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE  185
              G    FEL V R VALVNK+ + LR+   +P  WWV  N+ MV   +G 
Sbjct  337  TRGARGGFELAVARDVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGR  387



>gb|AFW79273.1| hypothetical protein ZEAMMB73_515320 [Zea mays]
Length=400

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/171 (41%), Positives = 92/171 (54%), Gaps = 9/171 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENG-------VTDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            V GHSLGA LATL +FD+  NG           PVT+  F SP++G   F K       L
Sbjct  219  VTGHSLGAALATLNAFDIAANGYNVAATGAAACPVTSFAFASPRVGGGGFKKRFDAVPGL  278

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            ++L +RN  D++P+YP  ++ Y   G E  ID  +S  L+       WHNL+  LH VAG
Sbjct  279  RLLRVRNARDVVPKYP--VVFYHDVGAELAIDTGESPYLRSPGGEQTWHNLEVYLHGVAG  336

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE  185
              G    FEL V R VALVNK+ + LR+   +P  WWV  N+ MV   +G 
Sbjct  337  TRGARGGFELAVARDVALVNKAYDALRDHHGVPPGWWVPLNRGMVEGADGR  387



>gb|EMT07769.1| hypothetical protein F775_18307 [Aegilops tauschii]
Length=229

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 97/174 (56%), Gaps = 11/174 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            V GHSLGA+LA L + D+  N V            PVTAI+F SPQ+GN  F        
Sbjct  48   VTGHSLGASLAILNTVDMVANSVNVPLNSAKQPPCPVTAIMFASPQVGNNKFKSAFASFR  107

Query  523  NLKILHIRNKIDMIPEYPGALLGYVKSGLEFV-IDHRKSTILKKSMNTGDWHNLQAMLHV  347
            +L  +H++N  D+IP  PG LLGYV      V I+  +S  L  + N   +HNL+  LH 
Sbjct  108  DLHAIHVKNAPDIIPTLPGPLLGYVDVATATVPINTNRSPYLYPN-NRDTYHNLECYLHG  166

Query  346  VAGWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE  185
            VAG  G+  +F+L V R VALVNK    L+++  +P +W+V KNK MV   +G 
Sbjct  167  VAGDQGDGMDFKLVVDRDVALVNKKVNILKDQYPVPENWYVAKNKWMVKGADGH  220



>emb|CDM85400.1| unnamed protein product [Triticum aestivum]
Length=416

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 99/176 (56%), Gaps = 10/176 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGV-------TDIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLG  L TL + DL  NG        + +PVTAI FG+P++G++ F K       L
Sbjct  232  ITGHSLGGALTTLNAIDLVANGFNVRGPSRSPVPVTAIHFGAPRVGDEQFKKAFHSMAGL  291

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
             +L +RN  D++P     ++ Y   G+E ++D RKS  LK+      WHNL+  LH VAG
Sbjct  292  SLLRVRNVPDIVPTILPPVI-YADVGVELLVDTRKSPYLKEKAGPAQWHNLEGYLHGVAG  350

Query  337  WNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             +G  +   F ++V R +AL+NK  + LR+E  +P  WW E NK MV +  G  VL
Sbjct  351  THGARDSAGFGMEVDRDLALINKEEDALRDEYPVPAMWWAENNKGMVKNATGHWVL  406



>ref|NP_001152663.1| triacylglycerol lipase precursor [Zea mays]
 gb|ACF88339.1| unknown [Zea mays]
 gb|ACG48810.1| triacylglycerol lipase [Zea mays]
 gb|AFW83435.1| Triacylglycerol lipase [Zea mays]
Length=430

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 100/178 (56%), Gaps = 13/178 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLGA L+TL + D+  NG+         +PV AIVFGSP++G+  F K        
Sbjct  245  LTGHSLGAALSTLTAIDIVANGLNVRGPNNDTVPVAAIVFGSPRVGDDQFKKAFDSTPGA  304

Query  517  KILHIRNKIDMIPEY-PGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVV  344
            ++L +RN  D++P   P A   Y   G+E ++D RKS  LK+       WHNL+  LH V
Sbjct  305  RLLRVRNAPDVVPTVLPNAF--YKDVGVELLLDTRKSPHLKRPGPGPAAWHNLECYLHGV  362

Query  343  AGWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            AG  G  +   F L+V R VALVNK  + L ++  +P +WWVE NK M  D +G  VL
Sbjct  363  AGTQGAGDAAGFSLEVDRDVALVNKEVDALSDDYPVPAAWWVEGNKGMTRDASGRWVL  420



>ref|XP_004232966.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=395

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 104/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  N +       + PVTA  F  P++G+  F     +   L+
Sbjct  215  VTGHSLGASLATLNAVDIAFNKINKASNGKEFPVTAFPFACPKVGDLQFKAAFDKIIGLR  274

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D+ P+YP   +GY   G E +ID  KS  +K      +WH+L++ LH +AG 
Sbjct  275  ILRIDNLLDIAPKYPP--IGYFDVGQELMIDTTKSPYVKPPGQPVNWHSLESYLHGIAGT  332

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F L+V R ++L+NK  + L++E  IP +WWVEKNK MV  E+G  +L   +D
Sbjct  333  QGTGLLAGFNLEVNRDISLINKQLDGLKDEYCIPVNWWVEKNKGMVQQEDGSWLLLDRDD  392

Query  160  EDL  152
             D 
Sbjct  393  YDF  395



>ref|XP_003565876.1| PREDICTED: phospholipase A1-II 6-like [Brachypodium distachyon]
Length=446

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 96/184 (52%), Gaps = 22/184 (12%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENG--------------VTDIPVTAIVFGSPQIGNQVFDKM  539
            V GHSLGA LATL +FD+ ENG               T  PV    F SP+IG   F K 
Sbjct  244  VTGHSLGAALATLNAFDIAENGYNTAIRAGAAPGPRATTFPVAVFAFASPRIGGAGFKKR  303

Query  538  MGEK---TNLKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHN  368
                   + L++L IRN  D++P+YP ALL Y   G E  ID   S  LK   N   WHN
Sbjct  304  FAAAAIASPLRVLRIRNARDIVPKYP-ALL-YHDVGCELTIDTGASPYLKAPGNERVWHN  361

Query  367  LQAMLHVVAG---WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLD  197
            L++ LH VAG          FEL V R VALVNK+ + LREE  +P  WWV +NK M   
Sbjct  362  LESYLHGVAGVPASGAPSSGFELVVARDVALVNKAYDALREEHGVPAGWWVPQNKGMAKG  421

Query  196  ENGE  185
            ++G 
Sbjct  422  DDGR  425



>ref|XP_009389473.1| PREDICTED: phospholipase A1-II 5-like [Musa acuminata subsp. 
malaccensis]
Length=368

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 99/172 (58%), Gaps = 12/172 (7%)
 Frame = -3

Query  679  IVXGHSLGATLATLASFDLCENGVTDI------PVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            +  GHSLG  LA L+++D+  +G++ I      PV  +VFGSP+ GNQ F     +  NL
Sbjct  192  VCLGHSLGGALAILSAYDIVRSGLSKIGEKEEFPVCTMVFGSPRAGNQAFSDSWAKLPNL  251

Query  517  KILHIRNKIDM-IPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            + L + NK D+ IP +P    GYV  G    +D RKS  LK +    D HNLQ  LH VA
Sbjct  252  RALRVLNKDDLDIPNFPPTSDGYVDIGTVLTVDSRKSPCLKTNH---DRHNLQVNLHTVA  308

Query  340  GWNGEDREFELK-VKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            GW GE+ +F+   VKR +ALVNK   +L     +  SWW EKNK MV  E+G
Sbjct  309  GWTGENGDFDCTIVKRSLALVNKHGGYLSINPALQ-SWWAEKNKRMVRGEDG  359



>ref|XP_010434518.1| PREDICTED: phospholipase A1-IIgamma-like isoform X1 [Camelina 
sativa]
 ref|XP_010434519.1| PREDICTED: phospholipase A1-IIgamma-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 98/173 (57%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA LATL + D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  248  ICGHSLGAALATLNAADIVANGYNRPKSRPDKSFPVTAFVFASPRVGDSDFKKLFSGLED  307

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L  RN  D+IP YP   +GY + G E  ID RKS  +K   N   +H L+A LH VA
Sbjct  308  LRVLRTRNLPDVIPIYPP--IGYSEVGDEIPIDTRKSQYMKSPGNLATFHCLEAYLHGVA  365

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR V LVNKS + L  E ++PG W V KNK MV  ++G
Sbjct  366  GTQGTAKADLFRLDVKRDVGLVNKSVDGLNVECMVPGKWRVLKNKGMVQQDDG  418



>gb|ABQ95989.1| phospholipase A1 [Capsicum annuum]
Length=397

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 73/183 (40%), Positives = 104/183 (57%), Gaps = 10/183 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F K   +  +L 
Sbjct  217  VTGHSLGASLATLNAVDIAFNGINKSSNGKEFPVTAFVFASPKVGDLNFHKAFSKLKHLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY   G E +ID  KS  +K       WH L+  LH +AG 
Sbjct  277  ILRIHNLLDIVPKYPP--VGYFDVGQELMIDTTKSPYVKPPGEVVSWHLLEPYLHGIAGT  334

Query  334  NG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVLASPND  161
             G      F+L+V R ++LVNK    L++E  IP  WW EK+K MV  ++G  +L   +D
Sbjct  335  QGIGMTAGFKLEVNRDISLVNKQWMILKDEYCIPPLWWSEKHKGMVQQQDGSWLLQDRDD  394

Query  160  EDL  152
             + 
Sbjct  395  YEF  397



>ref|XP_003528480.1| PREDICTED: phospholipase A1-IIgamma-like [Glycine max]
 gb|KHN31002.1| Phospholipase A1-IIgamma [Glycine soja]
Length=402

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 99/171 (58%), Gaps = 13/171 (8%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            V GHSLGA LATL + D+   G+           PVTA  +  P++G+  F++      +
Sbjct  218  VTGHSLGAALATLNAVDIAAQGLNIPKNQPQKAFPVTAFAYACPRVGDSSFEETFNGYKD  277

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L+ L IRN  D++P  P   LG+   G E VID RKS  LK  ++    HNL+A LH VA
Sbjct  278  LRSLRIRNVTDIVPITP--FLGFSDVGEELVIDTRKSKYLKSGVSA---HNLEAYLHGVA  332

Query  340  GWNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  GE   F L+V R +ALVNKS + L++E L+P +W V++NK MV   +G
Sbjct  333  GTQGEKGGFNLEVNRDIALVNKSMDALKDEYLVPVAWRVQENKGMVQQSDG  383



>ref|XP_004969332.1| PREDICTED: phospholipase A1-II 3-like [Setaria italica]
Length=424

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 99/178 (56%), Gaps = 13/178 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            + GHSLGA L+TL + D+  NGV         +PV AIVFGSP++G++   K        
Sbjct  239  ITGHSLGAALSTLTAIDIVSNGVNVRGSTNDTVPVAAIVFGSPRVGDEQLKKAFDSTPGA  298

Query  517  KILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQAMLHVV  344
            ++L +RN  D++P   P A   Y   G+E ++D RKS  LK+       WHNL+  LH V
Sbjct  299  RLLRVRNAPDIVPTILPAAF--YKDVGVELLVDTRKSPHLKQPGPGPAAWHNLECYLHGV  356

Query  343  AGWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
            AG  G  +   F L V R +ALVNK  + L +E  +P  WWVE NK MV D +G  VL
Sbjct  357  AGTQGAGDGAGFGLVVDRDLALVNKEVDALDDEYPVPAGWWVEGNKGMVKDGSGRWVL  414



>emb|CDX76515.1| BnaA08g08850D [Brassica napus]
Length=398

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 99/173 (57%), Gaps = 12/173 (7%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT--------DIPVTAIVFGSPQIGNQVFDKMMGEKTN  521
            + GHSLGA +ATL + D+  NG            PVTA VF SP++G+  F K+     +
Sbjct  211  ICGHSLGAAIATLNAADIVANGYNRPKSRPDKSCPVTAFVFASPRVGDSDFKKLFSGLKD  270

Query  520  LKILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVA  341
            L++L +RN  D++P YP   LGY + G E  ID RKS  LK   +   +H L+  LH +A
Sbjct  271  LRVLRVRNLPDVVPIYPP--LGYAEVGDELPIDTRKSPYLKSPGDLATFHCLEVYLHGLA  328

Query  340  GWNGEDRE--FELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
            G  G  +   F L VKR + LVNKS + L++E ++PG W + KNK MV   +G
Sbjct  329  GTQGTSKADLFRLDVKRDIGLVNKSVDGLKDEYMVPGHWRILKNKGMVQQNDG  381



>ref|XP_003569464.1| PREDICTED: phospholipase A1-II 3-like [Brachypodium distachyon]
Length=418

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 100/181 (55%), Gaps = 16/181 (9%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT----------DIPVTAIVFGSPQIGNQVFDKMMGEK  527
            + GHSLGA L+TL + D+  NG+            +PVTAI+FGSP++G++ F K +   
Sbjct  230  LTGHSLGAALSTLNAIDIVANGINALRSSSGDNITVPVTAILFGSPRVGDEQFKKALDSM  289

Query  526  TN-LKILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAML  353
               + +L +RN  D++P   P     Y   G+E ++D  KS  LK       WHNL+  L
Sbjct  290  AGAVSLLRVRNAPDIVPTILPTPF--YRDVGVELLVDTLKSPYLKTPAGPAQWHNLECYL  347

Query  352  HVVAGWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESV  179
            H VAG  G  +D  F L+V R VALVNK  + L+ E  +P SWW E NK MV +  G  V
Sbjct  348  HAVAGTQGPGDDAGFSLEVDRDVALVNKEEDALKGEYPVPASWWAENNKGMVKNATGHWV  407

Query  178  L  176
            L
Sbjct  408  L  408



>ref|XP_002456062.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
 gb|EES01182.1| hypothetical protein SORBIDRAFT_03g029680 [Sorghum bicolor]
Length=440

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 102/184 (55%), Gaps = 19/184 (10%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT---------DIPVTAIVFGSPQIGNQVFDKMMGEKT  524
            + GHSLGA LATL + D+  NG+           +PV AIVFGSP++G+  F K     +
Sbjct  249  LTGHSLGAALATLTAIDIVANGLNVRGGSNSNDTVPVAAIVFGSPRVGDDQFKKAFESPS  308

Query  523  N----LKILHIRNKIDMIPE-YPGALLGYVKSGLEFVIDHRKSTILKK-SMNTGDWHNLQ  362
                  ++L +RN  D++P   P A   Y   G+E ++D RKS  LK+       WHNL+
Sbjct  309  TPGGGARLLRVRNAPDIVPTILPAAF--YRDVGVELLLDTRKSPHLKRPGPGPAAWHNLE  366

Query  361  AMLHVVAGWNG--EDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
              LH VAG  G  +   F L+V R VALVNK  + L +E  +P +WWVE NK M  D++G
Sbjct  367  CYLHGVAGTQGAGDGAGFRLEVDRDVALVNKEVDALSDEYPVPAAWWVEGNKGMTRDKSG  426

Query  187  ESVL  176
              VL
Sbjct  427  RWVL  430



>ref|XP_002440294.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
 gb|EES18724.1| hypothetical protein SORBIDRAFT_09g029220 [Sorghum bicolor]
Length=408

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 91/170 (54%), Gaps = 8/170 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENG------VTDIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA LATL +FD+  NG          PVTA  F SP++G   F K       L+
Sbjct  228  VVGHSLGAALATLNAFDIAANGYNVATGAAACPVTAFAFASPRVGGGGFKKRFDAVPGLR  287

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            +L +RN  D++P+YP  ++ Y   G E  ID  +S  L+       WHNL+  LH VAG 
Sbjct  288  LLRVRNARDVVPKYP--IVFYHDVGAELAIDTGESPYLRSPGREHTWHNLEVYLHGVAGT  345

Query  334  NGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGE  185
             G    FEL V R VALVNK  + L ++  +P  WWV  NK MV   +G 
Sbjct  346  RGARGGFELAVARDVALVNKLYDVLWDDYGVPPGWWVPLNKGMVEGADGR  395



>ref|XP_004232964.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum lycopersicum]
Length=397

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 100/175 (57%), Gaps = 10/175 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA VF SP++G+  F     +  +L 
Sbjct  217  VTGHSLGASLATLNAVDIAFNGINKTSEGKEFPVTAFVFASPKVGDINFLNKFSKLKHLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            IL I N +D++P+YP   +GY   G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  277  ILRIHNLLDIVPKYPP--IGYFDVGQEIMIDTTKSPYVKPPGEIVSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
             G      F+L+V R ++LVNK  + L+ E  +P  WW EK+K MV  ENG  +L
Sbjct  335  QGLGLLAGFKLEVNRDISLVNKEWDILKNEYCVPAFWWTEKHKGMVQQENGSWLL  389



>gb|EMS68153.1| Phospholipase A1-II 7 [Triticum urartu]
Length=388

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 96/174 (55%), Gaps = 9/174 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            V GHSLGA+LATL + DL  +G           PVTAIVF SP +G++ F        +L
Sbjct  211  VCGHSLGASLATLNAVDLVSSGANKPESSTKSFPVTAIVFASPHVGDRFFRSAFNSFPDL  270

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            K LH++N  D++P YP   LGYV   +E  I   +S  ++        HNL+  LH VAG
Sbjct  271  KALHVQNAGDIVPMYPP--LGYVDVAVELTIRTIRSPYMRMPATVLTLHNLECYLHGVAG  328

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
              G    F+L+V+R VALVNK  + L  E  +P  WWV K+K MV  ++G   L
Sbjct  329  EQGSAGGFKLEVERDVALVNKGADALTNEHPVPAEWWVPKHKFMVKGKDGRWAL  382



>ref|XP_006362432.1| PREDICTED: phospholipase A1-IIgamma-like [Solanum tuberosum]
Length=397

 Score =   127 bits (320),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 98/171 (57%), Gaps = 10/171 (6%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT------DIPVTAIVFGSPQIGNQVFDKMMGEKTNLK  515
            V GHSLGA+LATL + D+  NG+       + PVTA  F SP++G+  F     +  +L 
Sbjct  217  VTGHSLGASLATLNAVDITFNGINKTSEGKEFPVTAFAFASPKVGDLQFKAAFDKLKHLH  276

Query  514  ILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAGW  335
            +L I N +D++P+YP   +GY   G E +ID  KS  +K       WH L+  LH VAG 
Sbjct  277  VLRIHNLMDIVPKYPP--IGYFDVGKELMIDTTKSPYVKPPGEPLSWHLLEPYLHGVAGT  334

Query  334  NGED--REFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENG  188
             G      F+L+V R ++LVNK    L++E  IPG WWVEK K MV  E+G
Sbjct  335  QGLGIFAGFKLEVNRDISLVNKQWNILKDEYCIPGRWWVEKCKGMVQQEDG  385



>dbj|BAJ90094.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=359

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 97/174 (56%), Gaps = 9/174 (5%)
 Frame = -3

Query  676  VXGHSLGATLATLASFDLCENGVT-------DIPVTAIVFGSPQIGNQVFDKMMGEKTNL  518
            V GHSLGA++ATL + D+  +G+          PVTAIVF SP +G + F        +L
Sbjct  182  VCGHSLGASIATLNAVDMVSSGINKPEGATKSFPVTAIVFASPHVGCRFFRSAFHSFPDL  241

Query  517  KILHIRNKIDMIPEYPGALLGYVKSGLEFVIDHRKSTILKKSMNTGDWHNLQAMLHVVAG  338
            K LH++N  D++P YP   LGYV   ++  I   +S  L+     G  HNL+  LH VAG
Sbjct  242  KALHVQNVGDVVPLYPP--LGYVDVAVQLTITTIRSPYLRVPATVGTLHNLECYLHGVAG  299

Query  337  WNGEDREFELKVKRCVALVNKSCEFLREELLIPGSWWVEKNKSMVLDENGESVL  176
              G    F+L+V R +ALVNK  + L +E  +P SWWV K+K MV   +G   L
Sbjct  300  EQGSAGGFKLEVDRDIALVNKGADALADEHPVPASWWVPKHKFMVKGGDGRWTL  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060