BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF031A16

Length=783
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009785816.1|  PREDICTED: eukaryotic translation initiation...    284   7e-89   Nicotiana sylvestris
ref|XP_009595023.1|  PREDICTED: eukaryotic translation initiation...    285   7e-87   Nicotiana tomentosiformis
ref|XP_006354613.1|  PREDICTED: eukaryotic translation initiation...    283   2e-86   Solanum tuberosum [potatoes]
sp|P56821.1|EIF3B_TOBAC  RecName: Full=Eukaryotic translation ini...    283   2e-86   Nicotiana tabacum [American tobacco]
ref|XP_004173704.1|  PREDICTED: eukaryotic translation initiation...    276   6e-86   
gb|ABS01433.1|  eukaryotic translation initiation factor                268   8e-86   Artemisia annua [sweet Annie]
ref|XP_004229693.1|  PREDICTED: eukaryotic translation initiation...    281   1e-85   Solanum lycopersicum
gb|KJB32896.1|  hypothetical protein B456_005G267000                    275   1e-85   Gossypium raimondii
gb|KJB32895.1|  hypothetical protein B456_005G267000                    275   1e-84   Gossypium raimondii
ref|XP_007208057.1|  hypothetical protein PRUPE_ppa002067mg             277   4e-84   Prunus persica
ref|XP_008218420.1|  PREDICTED: eukaryotic translation initiation...    277   4e-84   Prunus mume [ume]
ref|XP_002285591.1|  PREDICTED: eukaryotic translation initiation...    277   6e-84   Vitis vinifera
emb|CAN76773.1|  hypothetical protein VITISV_017587                     276   7e-84   Vitis vinifera
ref|XP_008447811.1|  PREDICTED: eukaryotic translation initiation...    273   8e-84   Cucumis melo [Oriental melon]
gb|KJB32894.1|  hypothetical protein B456_005G267000                    276   1e-83   Gossypium raimondii
gb|KHF99557.1|  Eukaryotic translation initiation factor 3 subunit B    276   1e-83   Gossypium arboreum [tree cotton]
ref|XP_004139759.1|  PREDICTED: eukaryotic translation initiation...    275   2e-83   
ref|XP_007041116.1|  Translation initiation factor 3B1 isoform 1        275   3e-83   
ref|XP_008345739.1|  PREDICTED: eukaryotic translation initiation...    274   9e-83   
ref|XP_008447809.1|  PREDICTED: eukaryotic translation initiation...    273   1e-82   Cucumis melo [Oriental melon]
ref|XP_004150392.1|  PREDICTED: eukaryotic translation initiation...    273   1e-82   
ref|XP_004160247.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    273   1e-82   
gb|KHN42137.1|  Eukaryotic translation initiation factor 3 subunit B    273   1e-82   Glycine soja [wild soybean]
ref|XP_003522102.1|  PREDICTED: eukaryotic translation initiation...    273   1e-82   Glycine max [soybeans]
ref|XP_009337980.1|  PREDICTED: eukaryotic translation initiation...    273   2e-82   Pyrus x bretschneideri [bai li]
ref|XP_003529057.1|  PREDICTED: eukaryotic translation initiation...    273   2e-82   Glycine max [soybeans]
ref|XP_006450238.1|  hypothetical protein CICLE_v100076092mg            270   2e-82   
gb|KHN25084.1|  Eukaryotic translation initiation factor 3 subunit B    273   2e-82   Glycine soja [wild soybean]
gb|AIU34463.1|  putative eukaryotic translation initiation factor...    272   3e-82   Taraxacum brevicorniculatum
ref|XP_008461500.1|  PREDICTED: eukaryotic translation initiation...    272   4e-82   Cucumis melo [Oriental melon]
ref|XP_004501412.1|  PREDICTED: eukaryotic translation initiation...    272   4e-82   
gb|KGN44408.1|  hypothetical protein Csa_7G281370                       272   4e-82   Cucumis sativus [cucumbers]
ref|XP_009784422.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    271   7e-82   Nicotiana sylvestris
ref|XP_006287158.1|  hypothetical protein CARUB_v10000332mg             269   8e-82   
ref|XP_010525888.1|  PREDICTED: eukaryotic translation initiation...    271   9e-82   Tarenaya hassleriana [spider flower]
ref|XP_007136908.1|  hypothetical protein PHAVU_009G084000g             271   9e-82   Phaseolus vulgaris [French bean]
gb|EPS67275.1|  hypothetical protein M569_07499                         271   9e-82   Genlisea aurea
ref|XP_009346830.1|  PREDICTED: eukaryotic translation initiation...    271   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_002515389.1|  Eukaryotic translation initiation factor 3 s...    271   1e-81   Ricinus communis
ref|XP_010933521.1|  PREDICTED: eukaryotic translation initiation...    271   1e-81   Elaeis guineensis
ref|XP_008388785.1|  PREDICTED: eukaryotic translation initiation...    271   1e-81   Malus domestica [apple tree]
gb|KDO67378.1|  hypothetical protein CISIN_1g005140mg                   270   1e-81   Citrus sinensis [apfelsine]
ref|XP_006483512.1|  PREDICTED: eukaryotic translation initiation...    271   1e-81   Citrus sinensis [apfelsine]
gb|KDP33486.1|  hypothetical protein JCGZ_07057                         270   2e-81   Jatropha curcas
gb|KJB47939.1|  hypothetical protein B456_008G047600                    266   2e-81   Gossypium raimondii
ref|XP_010033332.1|  PREDICTED: eukaryotic translation initiation...    270   3e-81   Eucalyptus grandis [rose gum]
emb|CDP20278.1|  unnamed protein product                                269   4e-81   Coffea canephora [robusta coffee]
ref|NP_568498.1|  translation initiation factor 3 subunit B             269   5e-81   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287159.1|  hypothetical protein CARUB_v10000332mg             269   6e-81   Capsella rubella
ref|NP_001031954.1|  translation initiation factor 3 subunit B          269   8e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KJB47938.1|  hypothetical protein B456_008G047600                    265   8e-81   Gossypium raimondii
ref|XP_002874283.1|  TIF3B1                                             268   1e-80   
ref|XP_011085122.1|  PREDICTED: eukaryotic translation initiation...    268   1e-80   Sesamum indicum [beniseed]
ref|XP_006405042.1|  hypothetical protein EUTSA_v10000061mg             268   2e-80   Eutrema salsugineum [saltwater cress]
ref|XP_010421590.1|  PREDICTED: eukaryotic translation initiation...    267   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008784685.1|  PREDICTED: eukaryotic translation initiation...    267   2e-80   Phoenix dactylifera
ref|XP_008786288.1|  PREDICTED: eukaryotic translation initiation...    267   3e-80   Phoenix dactylifera
ref|XP_011036732.1|  PREDICTED: eukaryotic translation initiation...    267   3e-80   Populus euphratica
ref|XP_010454917.1|  PREDICTED: eukaryotic translation initiation...    267   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010455107.1|  PREDICTED: eukaryotic translation initiation...    267   3e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010493833.1|  PREDICTED: eukaryotic translation initiation...    266   4e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006841801.1|  hypothetical protein AMTR_s00003p00268400          266   5e-80   Amborella trichopoda
gb|KJB47936.1|  hypothetical protein B456_008G047600                    266   5e-80   Gossypium raimondii
gb|KHG06633.1|  Eukaryotic translation initiation factor 3 subuni...    266   5e-80   Gossypium arboreum [tree cotton]
ref|XP_002872264.1|  TIF3B1                                             266   6e-80   
gb|KFK32610.1|  hypothetical protein AALP_AA6G266400                    266   6e-80   Arabis alpina [alpine rockcress]
ref|XP_010421435.1|  PREDICTED: eukaryotic translation initiation...    262   9e-80   Camelina sativa [gold-of-pleasure]
gb|EYU40305.1|  hypothetical protein MIMGU_mgv1a002098mg                266   1e-79   Erythranthe guttata [common monkey flower]
ref|XP_010695357.1|  PREDICTED: eukaryotic translation initiation...    265   1e-79   Beta vulgaris subsp. vulgaris [field beet]
gb|AIZ68196.1|  eukaryotic translation initiation factor 3 subuni...    265   2e-79   Ornithogalum longebracteatum [sea-onion]
gb|AES73491.2|  eukaryotic translation initiation factor 3 subunit B    265   2e-79   Medicago truncatula
ref|XP_003603240.1|  Eukaryotic translation initiation factor 3 s...    264   4e-79   
ref|XP_006371769.1|  Eukaryotic translation initiation factor 3 s...    264   5e-79   Populus trichocarpa [western balsam poplar]
ref|XP_002874327.1|  hypothetical protein ARALYDRAFT_351685             269   8e-79   
ref|XP_010675245.1|  PREDICTED: eukaryotic translation initiation...    263   9e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006855977.1|  hypothetical protein AMTR_s00037p00235640          263   1e-78   Amborella trichopoda
ref|XP_010919846.1|  PREDICTED: eukaryotic translation initiation...    262   2e-78   
ref|XP_010421436.1|  PREDICTED: eukaryotic translation initiation...    263   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010276277.1|  PREDICTED: eukaryotic translation initiation...    262   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010245655.1|  PREDICTED: eukaryotic translation initiation...    262   3e-78   Nelumbo nucifera [Indian lotus]
ref|XP_011031407.1|  PREDICTED: eukaryotic translation initiation...    261   7e-78   Populus euphratica
ref|XP_002308719.1|  Eukaryotic translation initiation factor 3 s...    260   1e-77   Populus trichocarpa [western balsam poplar]
gb|ABK25119.1|  unknown                                                 260   1e-77   Picea sitchensis
ref|XP_009140599.1|  PREDICTED: eukaryotic translation initiation...    259   2e-77   Brassica rapa
emb|CDX76792.1|  BnaC08g33780D                                          259   2e-77   
ref|XP_009117099.1|  PREDICTED: eukaryotic translation initiation...    259   2e-77   Brassica rapa
emb|CDY34755.1|  BnaA09g41220D                                          259   2e-77   Brassica napus [oilseed rape]
ref|XP_009140598.1|  PREDICTED: eukaryotic translation initiation...    259   3e-77   Brassica rapa
emb|CDY36167.1|  BnaC04g37270D                                          259   3e-77   Brassica napus [oilseed rape]
ref|NP_568477.1|  eukaryotic translation initiation factor 3B-2         258   4e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009381931.1|  PREDICTED: eukaryotic translation initiation...    258   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001136479.1|  hypothetical protein                               246   3e-76   
ref|XP_010108292.1|  Eukaryotic translation initiation factor 3 s...    256   4e-76   Morus notabilis
ref|XP_004302144.1|  PREDICTED: eukaryotic translation initiation...    251   4e-74   Fragaria vesca subsp. vesca
ref|NP_001065446.1|  Os10g0569200                                       247   1e-72   
gb|EEC67477.1|  hypothetical protein OsI_34716                          247   1e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_004983594.1|  PREDICTED: eukaryotic translation initiation...    246   2e-72   Setaria italica
ref|XP_002464900.1|  hypothetical protein SORBIDRAFT_01g028520          246   3e-72   Sorghum bicolor [broomcorn]
dbj|BAJ85622.1|  predicted protein                                      246   3e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008664809.1|  PREDICTED: uncharacterized protein LOC100216...    245   5e-72   
gb|EMS54123.1|  Eukaryotic translation initiation factor 3 subunit B    244   1e-71   Triticum urartu
ref|XP_003578786.1|  PREDICTED: eukaryotic translation initiation...    244   1e-71   Brachypodium distachyon [annual false brome]
gb|EMT19614.1|  Eukaryotic translation initiation factor 3 subunit B    241   7e-71   
ref|XP_010232157.1|  PREDICTED: eukaryotic translation initiation...    241   2e-70   Brachypodium distachyon [annual false brome]
ref|XP_006662084.1|  PREDICTED: eukaryotic translation initiation...    241   2e-70   Oryza brachyantha
gb|EMT20627.1|  Eukaryotic translation initiation factor 3 subunit B    240   3e-70   
ref|XP_001770820.1|  predicted protein                                  233   2e-67   
gb|AAF67758.1|AF255680_1  eIF3b                                         231   9e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KJB47937.1|  hypothetical protein B456_008G047600                    228   3e-66   Gossypium raimondii
gb|KHN29663.1|  Eukaryotic translation initiation factor 3 subunit B    218   1e-65   Glycine soja [wild soybean]
ref|XP_002986150.1|  hypothetical protein SELMODRAFT_182220             227   3e-65   Selaginella moellendorffii
ref|XP_002984964.1|  hypothetical protein SELMODRAFT_446105             227   3e-65   Selaginella moellendorffii
ref|XP_001771510.1|  predicted protein                                  226   4e-65   
ref|XP_006412558.1|  hypothetical protein EUTSA_v10027018mg             217   6e-62   
gb|EMS45026.1|  Eukaryotic translation initiation factor 3 subunit B    216   2e-61   Triticum urartu
gb|KGN44088.1|  hypothetical protein Csa_7G181630                       192   3e-57   Cucumis sativus [cucumbers]
ref|XP_007041117.1|  Translation initiation factor 3B1 isoform 2        201   3e-56   
gb|KCW52937.1|  hypothetical protein EUGRSUZ_J02249                     196   3e-54   Eucalyptus grandis [rose gum]
gb|EEE51441.1|  hypothetical protein OsJ_32527                          194   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002505347.1|  eukaryotic translation initiation factor-lik...    189   2e-51   Micromonas commoda
dbj|BAD94379.1|  TRANSLATION INITIATION FACTOR 3 SUBUNIT 9-like p...    174   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003060268.1|  predicted protein                                  184   5e-50   Micromonas pusilla CCMP1545
ref|XP_001421305.1|  predicted protein                                  184   8e-50   Ostreococcus lucimarinus CCE9901
emb|CEG01790.1|  Eukaryotic translation initiation factor 3 subun...    183   2e-49   Ostreococcus tauri
ref|XP_002958408.1|  eukaryotic translation initiation factor 3b        182   4e-49   Volvox carteri f. nagariensis
emb|CDY66663.1|  BnaCnng51870D                                          171   6e-49   Brassica napus [oilseed rape]
ref|XP_007514980.1|  predicted protein                                  182   6e-49   Bathycoccus prasinos
gb|ABD98042.1|  translation initiation factor                           171   6e-49   Striga asiatica [witchweed]
ref|XP_005648006.1|  eukaryotic initiation factor                       181   9e-49   Coccomyxa subellipsoidea C-169
ref|XP_001691870.1|  eukaryotic initiation factor                       177   2e-47   Chlamydomonas reinhardtii
ref|XP_003083330.1|  Translation initiation factor 3, subunit b (...    175   1e-46   
ref|XP_010495540.1|  PREDICTED: eukaryotic translation initiation...    164   2e-44   Camelina sativa [gold-of-pleasure]
gb|EEC67479.1|  hypothetical protein OsI_34722                          153   2e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_007136909.1|  hypothetical protein PHAVU_009G0841001g            148   1e-40   Phaseolus vulgaris [French bean]
gb|ELT99648.1|  hypothetical protein CAPTEDRAFT_163351                  156   8e-40   Capitella teleta
ref|XP_002595784.1|  hypothetical protein BRAFLDRAFT_131352             152   1e-38   Branchiostoma floridae
ref|XP_011398773.1|  Eukaryotic translation initiation factor 3 s...    152   1e-38   Auxenochlorella protothecoides
ref|XP_005829927.1|  translation initiation factor 3, subunit B         150   6e-38   Guillardia theta CCMP2712
ref|XP_002930168.1|  PREDICTED: eukaryotic translation initiation...    141   3e-37   
ref|XP_011432969.1|  PREDICTED: eukaryotic translation initiation...    149   3e-37   Crassostrea gigas
gb|KDD76724.1|  eukaryotic translation initiation factor eIF2A          146   3e-36   Helicosporidium sp. ATCC 50920
dbj|BAK06071.1|  predicted protein                                      139   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ELK28991.1|  Eukaryotic translation initiation factor 3 subunit B    144   8e-36   Myotis davidii
ref|XP_009045450.1|  hypothetical protein LOTGIDRAFT_230249             144   1e-35   Lottia gigantea
ref|XP_006749739.1|  PREDICTED: eukaryotic translation initiation...    142   1e-35   Leptonychotes weddellii
ref|XP_009029697.1|  hypothetical protein HELRODRAFT_157973             144   2e-35   Helobdella robusta
ref|XP_005698181.1|  PREDICTED: eukaryotic translation initiation...    143   2e-35   
ref|XP_006889671.1|  PREDICTED: eukaryotic translation initiation...    142   2e-35   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003972378.1|  PREDICTED: eukaryotic translation initiation...    143   3e-35   Takifugu rubripes [tiger puffer]
gb|AAH07175.1|  Eif3b protein                                           143   3e-35   Mus musculus [mouse]
ref|XP_006637297.1|  PREDICTED: eukaryotic translation initiation...    143   3e-35   Lepisosteus oculatus
ref|XP_011376839.1|  PREDICTED: eukaryotic translation initiation...    142   3e-35   
ref|XP_007129565.1|  PREDICTED: eukaryotic translation initiation...    142   4e-35   
gb|AAH09986.1|  EIF3B protein                                           142   4e-35   Homo sapiens [man]
ref|XP_005883424.1|  PREDICTED: eukaryotic translation initiation...    142   4e-35   
ref|XP_008519592.1|  PREDICTED: eukaryotic translation initiation...    143   4e-35   Equus przewalskii [Przewalski horse]
ref|XP_008048700.1|  PREDICTED: eukaryotic translation initiation...    142   4e-35   Carlito syrichta
gb|EPQ18395.1|  Eukaryotic translation initiation factor 3 subunit B    142   4e-35   Myotis brandtii
ref|XP_007094914.1|  PREDICTED: eukaryotic translation initiation...    142   5e-35   Panthera tigris altaica
ref|XP_005340894.1|  PREDICTED: eukaryotic translation initiation...    143   5e-35   Ictidomys tridecemlineatus
ref|XP_005887389.1|  PREDICTED: eukaryotic translation initiation...    142   5e-35   Bos mutus
ref|XP_006915964.1|  PREDICTED: eukaryotic translation initiation...    142   5e-35   
ref|XP_008696680.1|  PREDICTED: eukaryotic translation initiation...    142   5e-35   Ursus maritimus [white bear]
ref|XP_010830964.1|  PREDICTED: eukaryotic translation initiation...    142   6e-35   Bison bison bison
ref|XP_005953850.1|  PREDICTED: eukaryotic translation initiation...    142   6e-35   Pantholops hodgsonii [Tibetan antelope]
emb|CAF92736.1|  unnamed protein product                                142   6e-35   Tetraodon nigroviridis
ref|XP_006108329.1|  PREDICTED: eukaryotic translation initiation...    142   6e-35   
ref|XP_006796258.1|  PREDICTED: eukaryotic translation initiation...    141   6e-35   Neolamprologus brichardi [lyretail cichlid]
ref|XP_007467476.1|  PREDICTED: eukaryotic translation initiation...    142   6e-35   Lipotes vexillifer [baiji]
ref|XP_004440982.1|  PREDICTED: eukaryotic translation initiation...    142   6e-35   
ref|XP_004066017.1|  PREDICTED: eukaryotic translation initiation...    142   7e-35   Oryzias latipes [Japanese rice fish]
ref|XP_006046081.1|  PREDICTED: eukaryotic translation initiation...    143   7e-35   
dbj|BAG63448.1|  unnamed protein product                                142   7e-35   Homo sapiens [man]
ref|XP_006765559.1|  PREDICTED: eukaryotic translation initiation...    142   8e-35   
ref|XP_007174714.1|  PREDICTED: eukaryotic translation initiation...    142   8e-35   
ref|XP_005080033.1|  PREDICTED: eukaryotic translation initiation...    143   8e-35   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005615263.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   8e-35   
ref|XP_008971434.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   9e-35   
ref|XP_008154277.1|  PREDICTED: eukaryotic translation initiation...    142   9e-35   Eptesicus fuscus
ref|XP_006113006.1|  PREDICTED: eukaryotic translation initiation...    142   9e-35   
ref|XP_003496346.1|  PREDICTED: eukaryotic translation initiation...    142   9e-35   Cricetulus griseus [Chinese hamsters]
ref|XP_011288807.1|  PREDICTED: eukaryotic translation initiation...    142   9e-35   
gb|ERE76540.1|  eukaryotic translation initiation factor 3 subunit B    142   1e-34   Cricetulus griseus [Chinese hamsters]
ref|XP_007631404.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   
ref|XP_004892431.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   
ref|XP_005368038.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Microtus ochrogaster [prairie voles]
ref|XP_004672764.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Jaculus jaculus
ref|NP_001026810.1|  eukaryotic translation initiation factor 3 s...    142   1e-34   Rattus norvegicus [brown rat]
ref|XP_010594562.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   
ref|XP_008849626.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Nannospalax galili
ref|NP_598677.1|  eukaryotic translation initiation factor 3 subu...    142   1e-34   Mus musculus [mouse]
dbj|BAG62591.1|  unnamed protein product                                142   1e-34   Homo sapiens [man]
ref|XP_007525166.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Erinaceus europaeus [common hedgehog]
ref|XP_004617310.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Sorex araneus [Eurasian shrew]
ref|XP_003456022.2|  PREDICTED: eukaryotic translation initiation...    141   1e-34   Oreochromis niloticus
ref|XP_002736509.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Saccoglossus kowalevskii
ref|XP_006990812.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Peromyscus maniculatus bairdii
ref|XP_003416544.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Loxodonta africana [African bush elephant]
ref|XP_010641158.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Fukomys damarensis [Damara mole rat]
ref|XP_007467475.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Lipotes vexillifer [baiji]
ref|XP_008564978.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004385981.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Trichechus manatus latirostris
ref|XP_006210499.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   
ref|NP_001095826.1|  eukaryotic translation initiation factor 3 s...    142   1e-34   Bos taurus [bovine]
ref|XP_004394188.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   
ref|XP_005549077.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Macaca fascicularis [crab eating macaque]
ref|XP_004459096.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Dasypus novemcinctus
ref|XP_005397937.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Chinchilla lanigera
ref|XP_006859850.1|  PREDICTED: eukaryotic translation initiation...    142   1e-34   Chrysochloris asiatica
gb|EAL23952.1|  eukaryotic translation initiation factor 3, subun...    142   1e-34   Homo sapiens [man]
ref|XP_536894.3|  PREDICTED: eukaryotic translation initiation fa...    142   2e-34   
ref|XP_008282630.1|  PREDICTED: eukaryotic translation initiation...    141   2e-34   Stegastes partitus
ref|XP_003470101.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Cavia porcellus [guinea pig]
ref|XP_004688115.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Condylura cristata
ref|XP_007939402.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Orycteropus afer afer
ref|XP_006167965.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   
ref|XP_006173591.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   
ref|XP_004840481.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Heterocephalus glaber [naked mole rat]
ref|XP_003470094.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Cavia porcellus [guinea pig]
gb|AAH23767.1|  Eif3b protein                                           142   2e-34   Mus musculus [mouse]
ref|XP_009200773.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   2e-34   
ref|NP_003742.2|  eukaryotic translation initiation factor 3 subu...    142   2e-34   Homo sapiens [man]
ref|XP_004776427.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   
ref|XP_004045092.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   2e-34   
ref|XP_004815751.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   
ref|XP_010364964.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Rhinopithecus roxellana
gb|AAC99479.1|  eukaryotic translation initiation factor                142   2e-34   Homo sapiens [man]
ref|XP_004269024.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Orcinus orca [Orca]
ref|XP_004320350.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   2e-34   
gb|EAW87239.1|  eukaryotic translation initiation factor 3, subun...    142   2e-34   Homo sapiens [man]
ref|XP_003761584.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Sarcophilus harrisii
ref|XP_002744483.2|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Callithrix jacchus [common marmoset]
ref|XP_010329908.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Saimiri boliviensis boliviensis
ref|XP_010997888.1|  PREDICTED: eukaryotic translation initiation...    141   2e-34   Camelus dromedarius [camel]
ref|XP_003318263.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   2e-34   
ref|XP_008017159.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Chlorocebus sabaeus
ref|XP_004568396.1|  PREDICTED: eukaryotic translation initiation...    140   2e-34   Maylandia zebra
ref|XP_001086876.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   
gb|AAB42010.1|  Prt1 homolog                                            142   2e-34   Homo sapiens [man]
ref|XP_010964806.1|  PREDICTED: eukaryotic translation initiation...    141   2e-34   Camelus bactrianus [camel]
gb|KHN29644.1|  Eukaryotic translation initiation factor 3 subunit B    137   2e-34   Glycine soja [wild soybean]
gb|KFM63204.1|  Eukaryotic translation initiation factor 3 subunit B    141   2e-34   Stegodyphus mimosarum
ref|XP_007498394.1|  PREDICTED: eukaryotic translation initiation...    142   2e-34   Monodelphis domestica
ref|XP_005549076.1|  PREDICTED: eukaryotic translation initiation...    141   2e-34   Macaca fascicularis [crab eating macaque]
ref|XP_008314516.1|  PREDICTED: eukaryotic translation initiation...    140   2e-34   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_009240769.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   2e-34   
ref|XP_010742912.1|  PREDICTED: eukaryotic translation initiation...    140   3e-34   
ref|XP_003795497.1|  PREDICTED: eukaryotic translation initiation...    141   3e-34   
ref|XP_003278760.2|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    142   3e-34   
ref|XP_004598208.1|  PREDICTED: eukaryotic translation initiation...    140   3e-34   
ref|XP_007543689.1|  PREDICTED: eukaryotic translation initiation...    140   3e-34   Poecilia formosa
ref|XP_010863060.1|  PREDICTED: eukaryotic translation initiation...    140   3e-34   Esox lucius
ref|XP_009304773.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    140   3e-34   
gb|EFX65461.1|  hypothetical protein DAPPUDRAFT_303630                  140   4e-34   Daphnia pulex
ref|XP_008401228.1|  PREDICTED: eukaryotic translation initiation...    140   5e-34   Poecilia reticulata
ref|XP_005816262.1|  PREDICTED: eukaryotic translation initiation...    140   5e-34   Xiphophorus maculatus
ref|XP_007247954.1|  PREDICTED: eukaryotic translation initiation...    139   6e-34   
ref|XP_004705943.1|  PREDICTED: eukaryotic translation initiation...    140   6e-34   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_004629754.1|  PREDICTED: eukaryotic translation initiation...    140   7e-34   
gb|KFV75198.1|  Eukaryotic translation initiation factor 3 subunit B    139   7e-34   Struthio camelus australis
ref|XP_005990915.1|  PREDICTED: eukaryotic translation initiation...    139   7e-34   Latimeria chalumnae
ref|XP_008251049.1|  PREDICTED: eukaryotic translation initiation...    141   7e-34   Oryctolagus cuniculus [domestic rabbit]
gb|KFO25335.1|  Eukaryotic translation initiation factor 3 subunit B    141   8e-34   Fukomys damarensis [Damara mole rat]
ref|XP_009688428.1|  PREDICTED: eukaryotic translation initiation...    139   1e-33   Struthio camelus australis
ref|NP_001277022.1|  eukaryotic translation initiation factor 3 s...    139   1e-33   Danio rerio [leopard danio]
ref|XP_001513573.2|  PREDICTED: eukaryotic translation initiation...    139   1e-33   
ref|XP_005289179.1|  PREDICTED: eukaryotic translation initiation...    139   1e-33   Chrysemys picta bellii
ref|XP_007904268.1|  PREDICTED: eukaryotic translation initiation...    139   1e-33   Callorhinchus milii [Australian ghost shark]
gb|KFP25975.1|  Eukaryotic translation initiation factor 3 subunit B    136   1e-33   Colius striatus
ref|XP_007065442.1|  PREDICTED: eukaryotic translation initiation...    138   2e-33   
ref|XP_010216688.1|  PREDICTED: eukaryotic translation initiation...    139   2e-33   Tinamus guttatus
ref|NP_001016724.1|  eukaryotic translation initiation factor 3, ...    138   2e-33   Xenopus tropicalis [western clawed frog]
gb|EMP30609.1|  Eukaryotic translation initiation factor 3 subunit B    138   2e-33   Chelonia mydas [green seaturtle]
ref|NP_001090004.1|  eukaryotic translation initiation factor 3 s...    138   2e-33   Xenopus laevis [clawed frog]
gb|EFB24035.1|  hypothetical protein PANDA_020528                       130   2e-33   Ailuropoda melanoleuca
ref|XP_010784192.1|  PREDICTED: eukaryotic translation initiation...    136   2e-33   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010201332.1|  PREDICTED: eukaryotic translation initiation...    136   2e-33   Colius striatus
ref|XP_007442220.1|  PREDICTED: eukaryotic translation initiation...    138   2e-33   
ref|XP_001630617.1|  predicted protein                                  137   3e-33   Nematostella vectensis
ref|XP_005108064.1|  PREDICTED: eukaryotic translation initiation...    137   3e-33   
ref|XP_006273727.1|  PREDICTED: eukaryotic translation initiation...    137   5e-33   
ref|XP_004341005.1|  eukaryotic translation initiation factor fam...    137   5e-33   
ref|XP_003382835.1|  PREDICTED: eukaryotic translation initiation...    136   9e-33   
ref|XP_003226093.1|  PREDICTED: eukaryotic translation initiation...    137   9e-33   
gb|KFQ99849.1|  Eukaryotic translation initiation factor 3 subunit B    135   1e-32   
gb|KFU93921.1|  Eukaryotic translation initiation factor 3 subunit B    135   1e-32   
ref|XP_006034509.1|  PREDICTED: eukaryotic translation initiation...    137   1e-32   
ref|XP_008631870.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009080010.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009476287.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009934823.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009862650.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_010012782.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_005504631.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_005229148.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_010173760.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_010390974.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_010074670.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009284832.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_008937388.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009318344.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009466192.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009698341.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009509726.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009961250.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_002155584.2|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_005487519.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_009578594.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_005020204.1|  PREDICTED: eukaryotic translation initiation...    135   1e-32   
ref|XP_010289877.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009884341.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009959720.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009922320.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009644219.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_005703598.1|  translation initiation factor eIF-3 subunit 9      135   2e-32   
ref|XP_010001646.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009986913.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_009808230.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_008496803.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_010718149.1|  PREDICTED: eukaryotic translation initiation...    135   2e-32   
ref|XP_796053.3|  PREDICTED: eukaryotic translation initiation fa...    135   3e-32   
ref|XP_003729782.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_009896080.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_010182788.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_005420512.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_005438287.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_009090340.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_005054707.1|  PREDICTED: eukaryotic translation initiation...    135   3e-32   
ref|XP_010568891.1|  PREDICTED: eukaryotic translation initiation...    135   4e-32   
ref|XP_005145359.1|  PREDICTED: eukaryotic translation initiation...    135   4e-32   
ref|XP_002191028.2|  PREDICTED: eukaryotic translation initiation...    135   4e-32   
gb|KFH64958.1|  hypothetical protein MVEG_09686                         134   5e-32   
ref|XP_003642190.2|  PREDICTED: eukaryotic translation initiation...    134   5e-32   
ref|XP_005523244.1|  PREDICTED: eukaryotic translation initiation...    135   5e-32   
ref|XP_010159954.1|  PREDICTED: eukaryotic translation initiation...    134   5e-32   
ref|XP_011498180.1|  PREDICTED: eukaryotic translation initiation...    134   8e-32   
gb|KFW84435.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFV61445.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFZ65624.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFO92180.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFQ49346.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFP58302.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFR12266.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFP46951.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
ref|XP_003423811.1|  PREDICTED: eukaryotic translation initiation...    133   1e-31   
gb|KFV42036.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFQ68134.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFO09109.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFV52129.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFV09322.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFW94620.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFV97319.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFZ66175.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFP21771.1|  Eukaryotic translation initiation factor 3 subunit B    132   1e-31   
gb|KFW64358.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
gb|EOB00916.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
gb|KFM12378.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
gb|KFQ18372.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
gb|KDQ52424.1|  hypothetical protein JAAARDRAFT_162852                  133   2e-31   
gb|EMC88506.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
ref|XP_008926400.1|  PREDICTED: eukaryotic translation initiation...    132   2e-31   
ref|WP_028830563.1|  hypothetical protein                               128   2e-31   
gb|KFP04537.1|  Eukaryotic translation initiation factor 3 subunit B    132   2e-31   
emb|CCA16831.1|  eukaryotic translation initiation factor 3 subun...    132   3e-31   
ref|XP_006611541.1|  PREDICTED: eukaryotic translation initiation...    132   5e-31   
ref|XP_005766982.1|  hypothetical protein EMIHUDRAFT_51173              130   5e-31   
ref|XP_008544236.1|  PREDICTED: eukaryotic translation initiation...    131   5e-31   
ref|XP_003400822.1|  PREDICTED: eukaryotic translation initiation...    131   5e-31   
ref|XP_011254633.1|  PREDICTED: eukaryotic translation initiation...    131   5e-31   
ref|XP_011302520.1|  PREDICTED: eukaryotic translation initiation...    131   6e-31   
ref|XP_003697518.1|  PREDICTED: eukaryotic translation initiation...    131   6e-31   
ref|XP_003400823.1|  PREDICTED: eukaryotic translation initiation...    131   6e-31   
ref|XP_393588.2|  PREDICTED: eukaryotic translation initiation fa...    131   6e-31   
gb|KFV90979.1|  Eukaryotic translation initiation factor 3 subunit B    130   6e-31   
ref|XP_657963.1|  hypothetical protein AN0359.2                         131   7e-31   
ref|XP_011144150.1|  PREDICTED: eukaryotic translation initiation...    131   7e-31   
gb|EHB07911.1|  Eukaryotic translation initiation factor 3 subunit B    131   7e-31   
ref|XP_003697519.1|  PREDICTED: eukaryotic translation initiation...    131   7e-31   
ref|XP_003702862.1|  PREDICTED: eukaryotic translation initiation...    130   1e-30   
ref|XP_011066137.1|  PREDICTED: eukaryotic translation initiation...    130   1e-30   
ref|XP_008551694.1|  PREDICTED: eukaryotic translation initiation...    130   1e-30   
gb|EXX53310.1|  Prt1p                                                   129   2e-30   
ref|XP_007780334.1|  eukaryotic translation initiation factor 3 s...    130   2e-30   
ref|XP_003038935.1|  hypothetical protein SCHCODRAFT_65071              130   2e-30   
ref|XP_011348022.1|  PREDICTED: eukaryotic translation initiation...    130   2e-30   
gb|ERZ94763.1|  hypothetical protein GLOINDRAFT_341583                  129   3e-30   
ref|XP_006393191.1|  hypothetical protein EUTSA_v10012255mg             127   4e-30   
ref|XP_006681017.1|  hypothetical protein BATDEDRAFT_17457              128   4e-30   
gb|KFO59036.1|  Eukaryotic translation initiation factor 3 subunit B    128   4e-30   
ref|XP_005714482.1|  Translation initiation factor eIF3, subunit B      129   5e-30   
ref|XP_011270842.1|  hypothetical protein CAOG_09132                    128   5e-30   
ref|XP_011176217.1|  PREDICTED: eukaryotic translation initiation...    128   7e-30   
dbj|GAA83553.1|  eukaryotic translation initiation factor 3 subun...    128   7e-30   
ref|XP_002912128.1|  PRT1p                                              128   8e-30   
gb|KFP87618.1|  Eukaryotic translation initiation factor 3 subunit B    127   9e-30   
gb|EPY89345.1|  hypothetical protein CB1_000114010                      129   1e-29   
emb|CBQ68844.1|  related to PRT1-translation initiation factor eI...    128   1e-29   
ref|XP_008615783.1|  hypothetical protein SDRG_11520                    127   1e-29   
ref|XP_011390752.1|  hypothetical protein UMAG_04299                    128   1e-29   
gb|KFP96431.1|  Eukaryotic translation initiation factor 3 subunit B    127   1e-29   
ref|XP_007812250.1|  eukaryotic translation initiation factor 3         128   1e-29   
gb|KFG80966.1|  eukaryotic translation initiation factor 3              128   1e-29   
gb|KDO35278.1|  hypothetical protein SPRG_00125                         127   1e-29   
ref|XP_007824074.1|  Translation initiation factor 2A                   127   1e-29   
gb|KID72905.1|  eukaryotic translation initiation factor 3              127   1e-29   
gb|KID84296.1|  eukaryotic translation initiation factor 3              127   1e-29   
dbj|GAK68145.1|  translation initiation factor eIF-3b                   127   1e-29   
gb|KHO01555.1|  eukaryotic translation initiation factor 3              127   2e-29   
ref|XP_006393068.1|  hypothetical protein EUTSA_v10012256mg             121   2e-29   
gb|KEY67049.1|  hypothetical protein S7711_04729                        127   2e-29   
gb|KFH41947.1|  Eukaryotic translation initiation factor 3 subuni...    127   2e-29   
gb|KFA65064.1|  hypothetical protein S40285_03110                       127   2e-29   
ref|XP_001389047.1|  eukaryotic translation initiation factor 3 s...    127   2e-29   
gb|KDR85099.1|  hypothetical protein GALMADRAFT_233724                  127   2e-29   
gb|EHA26523.1|  hypothetical protein ASPNIDRAFT_55391                   127   2e-29   
emb|CDO69577.1|  hypothetical protein BN946_scf184759.g17               127   2e-29   
ref|XP_008035365.1|  translation initiation factor eIF-3b               127   3e-29   
gb|KID99315.1|  eukaryotic translation initiation factor 3              127   3e-29   
ref|XP_007364979.1|  translation initiation factor eIF-3b               127   3e-29   
dbj|BAJ94994.1|  predicted protein                                      127   3e-29   
ref|XP_007304673.1|  translation initiation factor eIF-3b               126   3e-29   
emb|CDI54920.1|  related to PRT1-translation initiation factor eI...    126   3e-29   
gb|KFU98606.1|  Eukaryotic translation initiation factor 3 subunit B    126   3e-29   
ref|XP_002626265.1|  eukaryotic translation initiation factor 3         126   4e-29   
ref|XP_003745509.1|  PREDICTED: eukaryotic translation initiation...    126   4e-29   
gb|KEZ46339.1|  Eukaryotic translation initiation factor 3 subunit B    126   4e-29   
ref|NP_001037602.1|  eukaryotic translation initiation factor 3 s...    126   4e-29   
gb|ETS64446.1|  hypothetical protein PaG_00902                          126   4e-29   
dbj|GAC75664.1|  translation initiation factor 3, subunit b             126   4e-29   
ref|XP_002109554.1|  hypothetical protein TRIADDRAFT_21889              126   4e-29   
ref|XP_007136910.1|  hypothetical protein PHAVU_009G0841000g            125   4e-29   
gb|KFQ49488.1|  Eukaryotic translation initiation factor 3 subunit B    125   5e-29   
emb|CCJ28370.1|  unnamed protein product                                126   5e-29   
emb|CCX33645.1|  Similar to Eukaryotic translation initiation fac...    126   5e-29   
ref|XP_007692972.1|  hypothetical protein COCMIDRAFT_9628               126   5e-29   
ref|XP_007714108.1|  hypothetical protein COCCADRAFT_100901             126   5e-29   
gb|EEQ92624.1|  eukaryotic translation initiation factor 3              125   5e-29   
gb|KFQ08173.1|  Eukaryotic translation initiation factor 3 subunit B    125   5e-29   
gb|EMD91216.1|  hypothetical protein COCHEDRAFT_1137760                 126   5e-29   
emb|CCE30187.1|  related to PRT1-translation initiation factor eI...    126   5e-29   
gb|EQL31131.1|  eukaryotic translation initiation factor 3 subunit B    126   5e-29   
ref|XP_003291433.1|  hypothetical protein DICPUDRAFT_156027             125   6e-29   
gb|KFK29772.1|  hypothetical protein AALP_AA7G177200                    120   6e-29   
ref|XP_009846212.1|  hypothetical protein H257_18787                    125   6e-29   
ref|XP_007872409.1|  hypothetical protein PNEG_00521                    125   7e-29   
ref|XP_003665332.1|  hypothetical protein MYCTH_2308932                 125   7e-29   
gb|EGE83120.1|  hypothetical protein BDDG_06064                         125   8e-29   
ref|XP_007702511.1|  hypothetical protein COCSADRAFT_95303              125   8e-29   
ref|XP_007582741.1|  putative eukaryotic translation initiation f...    125   8e-29   
gb|EHJ75157.1|  eukaryotic translation initiation factor 3 subunit B    125   9e-29   
emb|CCF50857.1|  related to PRT1-translation initiation factor eI...    125   9e-29   
gb|EMD40362.1|  hypothetical protein CERSUDRAFT_45150                   125   9e-29   
ref|XP_007720700.1|  eukaryotic translation initiation factor 3 s...    125   9e-29   
ref|XP_007325156.1|  hypothetical protein AGABI1DRAFT_66759             126   9e-29   
ref|XP_002837488.1|  hypothetical protein                               125   1e-28   
ref|XP_006454423.1|  hypothetical protein AGABI2DRAFT_182409            126   1e-28   
ref|XP_007736760.1|  eukaryotic translation initiation factor 3 s...    125   1e-28   
gb|KDB17675.1|  eukaryotic translation initiation factor 3              125   1e-28   
gb|EJT99885.1|  translation initiation factor eIF-3b                    125   1e-28   
ref|XP_009255901.1|  hypothetical protein FPSE_04508                    125   1e-28   
ref|XP_003654221.1|  hypothetical protein THITE_2089378                 125   1e-28   
ref|XP_001748298.1|  hypothetical protein                               124   1e-28   
gb|ERS95666.1|  eukaryotic translation initiation factor 3 subunit B    125   1e-28   
ref|XP_011324366.1|  hypothetical protein FGSG_05777                    125   1e-28   
gb|KIH90957.1|  translation initiation factor 3 subunit B               125   1e-28   
gb|EST08924.1|  translation initiation factor 3, subunit b              124   1e-28   
ref|XP_001933045.1|  eukaryotic translation initiation factor 3 s...    124   2e-28   
ref|XP_008866561.1|  hypothetical protein H310_04142                    124   2e-28   
ref|XP_639023.2|  RNA-binding region RNP-1 domain-containing protein    124   2e-28   
gb|KIK06889.1|  hypothetical protein K443DRAFT_88385                    124   2e-28   
ref|XP_009651915.1|  eukaryotic translation initiation factor 3 s...    124   2e-28   
ref|XP_006962508.1|  hypothetical protein TRIREDRAFT_21564              124   2e-28   
ref|XP_002130037.1|  PREDICTED: eukaryotic translation initiation...    124   2e-28   
ref|XP_001652847.1|  AAEL007718-PA                                      124   2e-28   
gb|KIJ45291.1|  hypothetical protein M422DRAFT_67411                    124   2e-28   
gb|KIY72856.1|  translation initiation factor eIF-3b                    124   2e-28   
gb|EER36895.1|  eukaryotic translation initiation factor 3              123   2e-28   
gb|EXM18071.1|  translation initiation factor 3 subunit B               124   2e-28   
gb|EFA76381.1|  RNA-binding region RNP-1 domain-containing protein      124   2e-28   
ref|XP_007915789.1|  putative eukaryotic translation initiation f...    124   2e-28   
gb|KIL93038.1|  hypothetical protein FAVG1_04219                        124   2e-28   
ref|XP_001226218.1|  conserved hypothetical protein                     124   3e-28   
gb|EGU86683.1|  hypothetical protein FOXB_02789                         124   3e-28   
gb|EWY97224.1|  translation initiation factor 3 subunit B               124   3e-28   
ref|XP_007842236.1|  eukaryotic translation initiation factor 3 s...    124   3e-28   
gb|EPS29574.1|  hypothetical protein PDE_04524                          124   3e-28   
dbj|GAC99793.1|  eukaryotic translation initiation factor 3             124   3e-28   
gb|KIN03888.1|  hypothetical protein OIDMADRAFT_193873                  124   3e-28   
ref|XP_001873237.1|  predicted protein                                  123   3e-28   
dbj|GAM23909.1|  hypothetical protein SAMD00019534_070840               123   3e-28   
gb|KIK71114.1|  hypothetical protein GYMLUDRAFT_149002                  124   4e-28   
emb|CEJ93731.1|  Putative Eukaryotic translation initiation facto...    124   4e-28   
ref|XP_001729379.1|  hypothetical protein MGL_3414                      124   4e-28   
ref|XP_001817900.1|  eukaryotic translation initiation factor 3 s...    123   4e-28   
gb|KIM25506.1|  hypothetical protein M408DRAFT_331075                   123   4e-28   
ref|XP_003833509.1|  similar to eukaryotic translation initiation...    123   4e-28   
gb|EHK50206.1|  hypothetical protein TRIATDRAFT_154464                  123   4e-28   
gb|KIL70727.1|  hypothetical protein M378DRAFT_183326                   123   4e-28   
gb|KFQ22872.1|  Eukaryotic translation initiation factor 3 subunit B    122   5e-28   
ref|XP_008031612.1|  hypothetical protein SETTUDRAFT_166441             123   5e-28   



>ref|XP_009785816.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like, partial [Nicotiana sylvestris]
 ref|XP_009797104.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like, partial [Nicotiana sylvestris]
Length=505

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRF+ILAGLKGFNGQLEFFDVDELETMA+AEHFMATD+
Sbjct  289  GRVSKLTTLKGKQANALYWSPGGRFLILAGLKGFNGQLEFFDVDELETMASAEHFMATDV  348

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQ+LWRPRPP FL++EKEE
Sbjct  349  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQYLWRPRPPSFLSKEKEE  408

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLK+YSKKYEAEDQDVSLQLSEQDR+KRKKLKE+WE+W+N
Sbjct  409  EIAKNLKRYSKKYEAEDQDVSLQLSEQDREKRKKLKEEWEAWIN  452



>ref|XP_009595023.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B {ECO:0000255|HAMAP-Rule:MF_03001} [Nicotiana tomentosiformis]
Length=717

 Score =   285 bits (728),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRF+ILAGLKGFNGQLEFFDVDELETMA+AEHFMATD+
Sbjct  501  GRVSKLTTLKGKQANALYWSPGGRFLILAGLKGFNGQLEFFDVDELETMASAEHFMATDV  560

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQ+LWRPRPP FL++EKEE
Sbjct  561  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQYLWRPRPPSFLSKEKEE  620

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLK+YSKKYEAEDQDVSLQLSEQDR+KRKKLKE+WE+W+N
Sbjct  621  EIAKNLKRYSKKYEAEDQDVSLQLSEQDREKRKKLKEEWEAWIN  664



>ref|XP_006354613.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Solanum tuberosum]
Length=717

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/164 (87%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRFIILAG+KGFNGQLEFFDVDEL+TMA+AEHFMATD+
Sbjct  501  GRVSKLTTLKGKQANALYWSPGGRFIILAGMKGFNGQLEFFDVDELDTMASAEHFMATDV  560

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL++EKEE
Sbjct  561  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSKEKEE  620

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRKKLKE+WE+W+N
Sbjct  621  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKKLKEEWEAWIN  664



>sp|P56821.1|EIF3B_TOBAC RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=eIF-3-eta; AltName: Full=eIF3 
p110 [Nicotiana tabacum]
 emb|CAA72721.1| PRT1 protein [Nicotiana tabacum]
Length=719

 Score =   283 bits (724),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 158/168 (94%), Gaps = 0/168 (0%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
             +T G   KL TLKGKQANAL+WSP GRF+IL GLKGFNGQLEFFDVDELETMA+AEHFM
Sbjct  499  ALTPGLVSKLTTLKGKQANALYWSPGGRFLILTGLKGFNGQLEFFDVDELETMASAEHFM  558

Query  596  ATDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTR  417
            ATD+EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQ+LWRPRPP FL++
Sbjct  559  ATDVEWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQYLWRPRPPSFLSK  618

Query  416  ekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EKEEEI KNLK+YSKKYEAEDQDVSLQLSEQDR+KRKKLKE+WE+W+N
Sbjct  619  EKEEEIAKNLKRYSKKYEAEDQDVSLQLSEQDREKRKKLKEEWEAWIN  666



>ref|XP_004173704.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like, partial [Cucumis sativus]
Length=483

 Score =   276 bits (705),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            + G   KL TLKGKQANALFWSP GRFIILAGLKGFNGQLEF++VDELETMATAEHFMAT
Sbjct  266  SSGRVSKLTTLKGKQANALFWSPGGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMAT  325

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            DIEWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ E+
Sbjct  326  DIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEQ  385

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEEI KNLKKY+KKYEAEDQDVS+ LSEQDR+KRK LK+DW+ W+N
Sbjct  386  EEEIAKNLKKYTKKYEAEDQDVSMLLSEQDREKRKMLKDDWDKWLN  431



>gb|ABS01433.1| eukaryotic translation initiation factor [Artemisia annua]
Length=236

 Score =   268 bits (684),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 153/167 (92%), Gaps = 0/167 (0%)
 Frame = -2

Query  773  VTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMA  594
            V  G+  KL TLK +QANALFWSP GRF+ILAGLKGFNGQLEFF+VDELETMATAEHFMA
Sbjct  21   VKGGKVSKLTTLKQRQANALFWSPNGRFVILAGLKGFNGQLEFFNVDELETMATAEHFMA  80

Query  593  TDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRe  414
            TDIEWDP+GRYVAT++TSVHEMENGFNIWSF+GKLLY I+KDHFFQFLWRPRPP FLT E
Sbjct  81   TDIEWDPSGRYVATSVTSVHEMENGFNIWSFNGKLLYHIMKDHFFQFLWRPRPPSFLTPE  140

Query  413  keeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            KEEEI KNLKKYS+KY+ EDQD+SL LS+QD +KRK+LK+DWESW+N
Sbjct  141  KEEEISKNLKKYSEKYDVEDQDISLLLSKQDLEKRKQLKDDWESWVN  187



>ref|XP_004229693.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Solanum lycopersicum]
Length=717

 Score =   281 bits (720),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRFIILAG+KGFNGQLEFFDVDEL+TMA+AEHFMATD+
Sbjct  501  GRVSKLTTLKGKQANALYWSPGGRFIILAGMKGFNGQLEFFDVDELDTMASAEHFMATDV  560

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL++EKEE
Sbjct  561  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSKEKEE  620

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRKKLKE+WE+W++
Sbjct  621  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKKLKEEWEAWIS  664



>gb|KJB32896.1| hypothetical protein B456_005G267000 [Gossypium raimondii]
Length=493

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATD+
Sbjct  280  GRVAKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDV  339

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  340  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  399

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI +NLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  400  EIARNLKKYSKKYEAEDQDVSMLLSEQDREKRRMLKEEWEKWVS  443



>gb|KJB32895.1| hypothetical protein B456_005G267000 [Gossypium raimondii]
Length=573

 Score =   275 bits (703),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATD+
Sbjct  360  GRVAKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDV  419

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  420  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  479

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI +NLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  480  EIARNLKKYSKKYEAEDQDVSMLLSEQDREKRRMLKEEWEKWVS  523



>ref|XP_007208057.1| hypothetical protein PRUPE_ppa002067mg [Prunus persica]
 gb|EMJ09256.1| hypothetical protein PRUPE_ppa002067mg [Prunus persica]
Length=722

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALFWSPSGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  569  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSMFLSEQDREKRRMLKEEWEKWV  671



>ref|XP_008218420.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Prunus mume]
Length=722

 Score =   277 bits (709),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALFWSPSGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  569  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSMFLSEQDREKRRMLKEEWEKWV  671



>ref|XP_002285591.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Vitis vinifera]
 emb|CBI21174.3| unnamed protein product [Vitis vinifera]
Length=718

 Score =   277 bits (708),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGR+IILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPAGRYIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  561

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  562  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSPEKEE  621

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KRK LK++WE W+N
Sbjct  622  EIAKNLKKYSKKYEAEDQDVSMLLSEQDREKRKMLKDEWERWVN  665



>emb|CAN76773.1| hypothetical protein VITISV_017587 [Vitis vinifera]
Length=719

 Score =   276 bits (707),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGR+IILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPAGRYIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  561

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  562  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSPEKEE  621

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KRK LK++WE W+N
Sbjct  622  EIAKNLKKYSKKYEAEDQDVSMLLSEQDREKRKMLKDEWERWVN  665



>ref|XP_008447811.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X2 [Cucumis melo]
Length=575

 Score =   273 bits (698),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            + G   KL TLKGKQANALFWSPAGRFIILAGLKGFNGQLEF++VDELETMATAEHFMAT
Sbjct  358  SSGRVSKLTTLKGKQANALFWSPAGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMAT  417

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            DIEWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ E+
Sbjct  418  DIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEQ  477

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEEI KNLKKY+KKYEAEDQDVS+ LSEQDR+KR+ LK+ W+ W+N
Sbjct  478  EEEIAKNLKKYTKKYEAEDQDVSMLLSEQDREKRRMLKDQWDKWLN  523



>gb|KJB32894.1| hypothetical protein B456_005G267000 [Gossypium raimondii]
Length=716

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATD+
Sbjct  503  GRVAKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDV  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  563  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI +NLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  623  EIARNLKKYSKKYEAEDQDVSMLLSEQDREKRRMLKEEWEKWVS  666



>gb|KHF99557.1| Eukaryotic translation initiation factor 3 subunit B [Gossypium 
arboreum]
Length=716

 Score =   276 bits (706),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATD+
Sbjct  503  GRVAKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDV  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  563  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI +NLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  623  EIARNLKKYSKKYEAEDQDVSMLLSEQDREKRRMLKEEWEKWVS  666



>ref|XP_004139759.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis sativus]
Length=718

 Score =   275 bits (704),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            + G   KL TLKGKQANALFWSP GRFIILAGLKGFNGQLEF++VDELETMATAEHFMAT
Sbjct  501  SSGRVSKLTTLKGKQANALFWSPGGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMAT  560

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            DIEWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ E+
Sbjct  561  DIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEQ  620

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEEI KNLKKY+KKYEAEDQDVS+ LSEQDR+KRK LK+DW+ W+N
Sbjct  621  EEEIAKNLKKYTKKYEAEDQDVSMLLSEQDREKRKMLKDDWDKWLN  666



>ref|XP_007041116.1| Translation initiation factor 3B1 isoform 1 [Theobroma cacao]
 gb|EOX96947.1| Translation initiation factor 3B1 isoform 1 [Theobroma cacao]
Length=718

 Score =   275 bits (703),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  504  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFN+WSF+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFNVWSFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI +NLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+W+ W++
Sbjct  624  EIARNLKKYSKKYEAEDQDVSMLLSEQDREKRRMLKEEWDKWVS  667



>ref|XP_008345739.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=722

 Score =   274 bits (700),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALYWSPTGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT +TSVHEMENGFNIW+F+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  569  EWDPTGRYVATTVTSVHEMENGFNIWTFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSIFLSEQDREKRRMLKEEWEKWV  671



>ref|XP_008447809.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Cucumis melo]
 ref|XP_008447810.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Cucumis melo]
Length=718

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            + G   KL TLKGKQANALFWSPAGRFIILAGLKGFNGQLEF++VDELETMATAEHFMAT
Sbjct  501  SSGRVSKLTTLKGKQANALFWSPAGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMAT  560

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            DIEWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ E+
Sbjct  561  DIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEQ  620

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEEI KNLKKY+KKYEAEDQDVS+ LSEQDR+KR+ LK+ W+ W+N
Sbjct  621  EEEIAKNLKKYTKKYEAEDQDVSMLLSEQDREKRRMLKDQWDKWLN  666



>ref|XP_004150392.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis sativus]
Length=718

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  503  GRVSKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQ+R++R+ LK++W+ W+N
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSMLLSEQERERRRMLKDEWDKWVN  666



>ref|XP_004160247.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B-like [Cucumis sativus]
Length=718

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/164 (85%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  503  GRVSKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQ+R++R+ LK++W+ W+N
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSMLLSEQERERRRMLKDEWDKWVN  666



>gb|KHN42137.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=718

 Score =   273 bits (699),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDELETMATAEHFMATDIEWDP
Sbjct  506  KLTTLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDIEWDP  565

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FLT EKEEEI K
Sbjct  566  TGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLTPEKEEEIAK  625

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W+N
Sbjct  626  NLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEWDKWVN  665



>ref|XP_003522102.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Glycine max]
Length=718

 Score =   273 bits (698),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDELETMATAEHFMATDIEWDP
Sbjct  506  KLTTLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDIEWDP  565

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FLT EKEEEI K
Sbjct  566  TGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLTPEKEEEIAK  625

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W+N
Sbjct  626  NLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEWDKWVN  665



>ref|XP_009337980.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=722

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/163 (86%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP G FIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALYWSPTGHFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIW+F+GKLLYRILKDHFFQFLWRPRPP FLT EKEE
Sbjct  569  EWDPTGRYVATAVTSVHEMENGFNIWTFNGKLLYRILKDHFFQFLWRPRPPSFLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSIFLSEQDREKRRMLKEEWEKWV  671



>ref|XP_003529057.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Glycine max]
Length=718

 Score =   273 bits (698),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDELETMATAEHFMATDIEWDP
Sbjct  506  KLITLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDIEWDP  565

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FLT EKEEEI K
Sbjct  566  TGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLTPEKEEEIAK  625

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W+N
Sbjct  626  NLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEWDKWVN  665



>ref|XP_006450238.1| hypothetical protein CICLE_v100076092mg, partial [Citrus clementina]
 gb|ESR63478.1| hypothetical protein CICLE_v100076092mg, partial [Citrus clementina]
Length=592

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GRFI+LAGLKGFNGQLEF++VDELETMATAEHFMATD+
Sbjct  382  GRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDV  441

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYR LKDHFFQFLWRPRPP FLT EKEE
Sbjct  442  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEE  501

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWE  285
            EI KNLKKYSKKYEAEDQDVS+QLSEQ+R+KR+ LK +WE
Sbjct  502  EIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWE  541



>gb|KHN25084.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=718

 Score =   273 bits (697),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/160 (88%), Positives = 152/160 (95%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDELETMATAEHFMATDIEWDP
Sbjct  506  KLITLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDIEWDP  565

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FLT EKEEEI K
Sbjct  566  TGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLTPEKEEEIAK  625

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W+N
Sbjct  626  NLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEWDKWVN  665



>gb|AIU34463.1| putative eukaryotic translation initiation factor 3 subunit B, 
partial [Taraxacum brevicorniculatum]
Length=708

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G+  KL TLKGKQAN LFWSP GRF+ILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  499  GKVSKLVTLKGKQANGLFWSPGGRFVILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRI KDHFFQFLWRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRIAKDHFFQFLWRPRPPSFLSAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI+KNLKKYSKKY+ EDQD+SL LSEQDR+KRK+LKE+W +W+N
Sbjct  619  EIMKNLKKYSKKYDVEDQDISLLLSEQDREKRKQLKEEWSTWVN  662



>ref|XP_008461500.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cucumis melo]
Length=718

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPAGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQ+R++R+ LK++W+ W+N
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSMLLSEQERERRRMLKDEWDKWVN  666



>ref|XP_004501412.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cicer arietinum]
Length=719

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGRFI+LAGLKGFNGQLEF++VDELETMATAEHFMATD+
Sbjct  503  GRVSKLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDV  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQ+LWRPRPP FLT EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQYLWRPRPPSFLTPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W++
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRILKEEWDKWVS  666



>gb|KGN44408.1| hypothetical protein Csa_7G281370 [Cucumis sativus]
Length=718

 Score =   272 bits (695),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLKGKQANALFWSPAGRFIILAGLKGFNGQ EF++VDELETMATAEHFMATDI
Sbjct  503  GRVSKLATLKGKQANALFWSPAGRFIILAGLKGFNGQFEFYNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRPRPPSFLSPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQ+R++R+ LK++W+ W+N
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSMLLSEQERERRRMLKDEWDKWVN  666



>ref|XP_009784422.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B-like [Nicotiana sylvestris]
Length=724

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 139/171 (81%), Positives = 155/171 (91%), Gaps = 7/171 (4%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP G F+ILAGLKGFNGQLEFFDVDELETMA+AEHFMATD+
Sbjct  501  GRVSKLTTLKGKQANALYWSPGGCFLILAGLKGFNGQLEFFDVDELETMASAEHFMATDV  560

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQ-------FLWRPRPPPF  426
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQ        LWRPRPP F
Sbjct  561  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQVTVFPIHLLWRPRPPSF  620

Query  425  LTRekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            L++EKEEEI+KNLK+Y+ +YEAEDQDVSLQLSEQDRQKRKKLKE+WE+W+N
Sbjct  621  LSKEKEEEIVKNLKRYNTRYEAEDQDVSLQLSEQDRQKRKKLKEEWEAWIN  671



>ref|XP_006287158.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
 gb|EOA20056.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
Length=619

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  405  GRVSKLGTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  464

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  465  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRILKDHFFQLAWRPRPPSFLTAEKEE  524

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  525  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  567



>ref|XP_010525888.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tarenaya hassleriana]
Length=715

 Score =   271 bits (693),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G+  KL TLKGKQANALFWSP G++IILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  499  GKISKLTTLKGKQANALFWSPTGKYIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQ+ WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQYSWRPRPPSFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRGLKEEWEKWV  661



>ref|XP_007136908.1| hypothetical protein PHAVU_009G084000g [Phaseolus vulgaris]
 gb|ESW08902.1| hypothetical protein PHAVU_009G084000g [Phaseolus vulgaris]
Length=718

 Score =   271 bits (693),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 151/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDELETMATAEHFMATDIEWDP
Sbjct  506  KLTTLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDIEWDP  565

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FL+ EKEEEI K
Sbjct  566  TGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLSPEKEEEIAK  625

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQ+R KR+ LKEDW+ W++
Sbjct  626  NLKKYSKKYEAEDQDVSLLLSEQERDKRRMLKEDWDKWIH  665



>gb|EPS67275.1| hypothetical protein M569_07499 [Genlisea aurea]
Length=712

 Score =   271 bits (692),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 138/159 (87%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KLATLKGKQANALFWSP+GRFI+LAGLKG NGQLEF++VD+LETMA AEHFMATDIEWDP
Sbjct  504  KLATLKGKQANALFWSPSGRFILLAGLKGLNGQLEFYNVDDLETMAQAEHFMATDIEWDP  563

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYV TA+TSVHEMENGFN+WSF+GKLLYRILKDHFFQF WRPRPP FLT E EEEI K
Sbjct  564  TGRYVVTAVTSVHEMENGFNVWSFNGKLLYRILKDHFFQFSWRPRPPSFLTAEMEEEIAK  623

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYEAEDQDVSL LSEQDR+KRKKLKE+WE W+
Sbjct  624  NLKKYSKKYEAEDQDVSLLLSEQDREKRKKLKEEWERWI  662



>ref|XP_009346830.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Pyrus x bretschneideri]
Length=722

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALYWSPTGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIW+F+GKLLYR LKDHFFQFLWRPRPP  LT EKEE
Sbjct  569  EWDPTGRYVATAVTSVHEMENGFNIWTFNGKLLYRTLKDHFFQFLWRPRPPSLLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSIFLSEQDREKRRMLKEEWEKWV  671



>ref|XP_002515389.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
 gb|EEF46838.1| Eukaryotic translation initiation factor 3 subunit, putative 
[Ricinus communis]
Length=720

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAG ++ILAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPAGHYLILAGLKGFNGQLEFYNVDELETMATTEHFMATDI  562

Query  584  EWDPTGRYVATALTSVH-EMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            +WDPTGRYVAT++TSVH EMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL+ EKE
Sbjct  563  DWDPTGRYVATSVTSVHHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSAEKE  622

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI  NLKKYSKKYEAEDQDVSLQLSEQDR+KR+ LK+DWE W+N
Sbjct  623  EEIANNLKKYSKKYEAEDQDVSLQLSEQDREKRRMLKDDWEKWVN  667



>ref|XP_010933521.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
Length=717

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/164 (84%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLKGKQANAL+WSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  504  GRVSKLATLKGKQANALYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF+IWSF+GKLLYRI KDHF+QFLWRPRPP  L+ EKEE
Sbjct  564  EWDPTGRYVATAVTSVHEMENGFHIWSFNGKLLYRIPKDHFYQFLWRPRPPSLLSAEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSLQLSEQDR+KRK L+E+W++W++
Sbjct  624  EIAKNLKKYSKKYEAEDQDVSLQLSEQDRKKRKMLQEEWDAWVS  667



>ref|XP_008388785.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Malus domestica]
Length=722

 Score =   271 bits (693),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP GRFIILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  509  GRVSKLTTLKGKQANALYWSPTGRFIILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  568

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIW+F+GKLLYR LKDHFFQFLWRPRPP  LT EKEE
Sbjct  569  EWDPTGRYVATAVTSVHEMENGFNIWTFNGKLLYRTLKDHFFQFLWRPRPPSLLTPEKEE  628

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KR+ LKE+WE W+
Sbjct  629  EIAKNLKKYSKKYEAEDQDVSIFLSEQDREKRRMLKEEWEKWV  671



>gb|KDO67378.1| hypothetical protein CISIN_1g005140mg [Citrus sinensis]
Length=702

 Score =   270 bits (691),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GRFI+LAGLKGFNGQLEF++VDELETMATAEHFMATD+
Sbjct  492  GRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDV  551

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYR LKDHFFQFLWRPRPP FLT EKEE
Sbjct  552  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEE  611

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWE  285
            EI KNLKKYSKKYEAEDQDVS+QLSEQ+R+KR+ LK +WE
Sbjct  612  EIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWE  651



>ref|XP_006483512.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Citrus sinensis]
 gb|KDO67379.1| hypothetical protein CISIN_1g005140mg [Citrus sinensis]
Length=712

 Score =   271 bits (692),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/160 (86%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GRFI+LAGLKGFNGQLEF++VDELETMATAEHFMATD+
Sbjct  502  GRVSKLTTLKGKQANALFWSPSGRFIVLAGLKGFNGQLEFYNVDELETMATAEHFMATDV  561

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYR LKDHFFQFLWRPRPP FLT EKEE
Sbjct  562  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSFLTPEKEE  621

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWE  285
            EI KNLKKYSKKYEAEDQDVS+QLSEQ+R+KR+ LK +WE
Sbjct  622  EIAKNLKKYSKKYEAEDQDVSMQLSEQEREKRRSLKNEWE  661



>gb|KDP33486.1| hypothetical protein JCGZ_07057 [Jatropha curcas]
Length=720

 Score =   270 bits (691),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAG +IILAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPAGHYIILAGLKGFNGQLEFYNVDELETMATTEHFMATDI  562

Query  584  EWDPTGRYVATALTSVH-EMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT++TSVH EMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL+ EKE
Sbjct  563  EWDPTGRYVATSVTSVHHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSPEKE  622

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI  NLKKYSKKYEAEDQDVSLQLSEQDR+KR+ LK++W+ W+N
Sbjct  623  EEIANNLKKYSKKYEAEDQDVSLQLSEQDREKRRMLKDEWDKWVN  667



>gb|KJB47939.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=550

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  338  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  397

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  398  EWDPTGRYVATAVTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPSFLSAEKEE  457

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EILK LKKYSKKY+AEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  458  EILKYLKKYSKKYDAEDQDVSMLLSEQDREKRRMLKEEWEKWIS  501



>ref|XP_010033332.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Eucalyptus grandis]
 gb|KCW52935.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
 gb|KCW52936.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
Length=714

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQAN LFWSPAGR+IILAGLK FNGQLEF++VDELETMATAEHFMATDI
Sbjct  499  GRVSKLTTLKGKQANFLFWSPAGRYIILAGLKNFNGQLEFYNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP  L+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSLLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KRK LK++WE W++
Sbjct  619  EIAKNLKKYSKKYEAEDQDVSMLLSEQDREKRKMLKDEWEKWVS  662



>emb|CDP20278.1| unnamed protein product [Coffea canephora]
Length=710

 Score =   269 bits (688),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 152/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL T+KGKQANAL+WSPAGRFI+LAGLK FNGQLEF++VDELETMATAEHFMATDI
Sbjct  498  GRVSKLTTIKGKQANALYWSPAGRFIVLAGLKNFNGQLEFYNVDELETMATAEHFMATDI  557

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRPRPP  L+ EKEE
Sbjct  558  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFSWRPRPPSLLSPEKEE  617

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSLQLSEQ+R+KRK +KE+WE W++
Sbjct  618  EISKNLKKYSKKYEAEDQDVSLQLSEQEREKRKIVKEEWERWIS  661



>ref|NP_568498.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
 sp|Q9C5Z1.1|EIF3B_ARATH RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=eIF-3-eta; AltName: Full=eIF3 
p110; AltName: Full=p82 [Arabidopsis thaliana]
 gb|AAG53615.1|AF285834_1 eukaryotic initiation factor 3B1 subunit [Arabidopsis thaliana]
 gb|AAK55686.1|AF378883_1 AT5g27640/F15A18_100 [Arabidopsis thaliana]
 gb|AAM26716.1| AT5g27640/F15A18_100 [Arabidopsis thaliana]
 gb|AED93709.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
Length=712

 Score =   269 bits (687),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G +LYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAWRPRPPSFLTAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI K LKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKTLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|XP_006287159.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
 gb|EOA20057.1| hypothetical protein CARUB_v10000332mg [Capsella rubella]
Length=713

 Score =   269 bits (687),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLGTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRILKDHFFQLAWRPRPPSFLTAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|NP_001031954.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
 gb|AED93710.1| translation initiation factor 3 subunit B [Arabidopsis thaliana]
Length=738

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  525  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  584

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G +LYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  585  EWDPTGRYVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAWRPRPPSFLTAEKEE  644

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI K LKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  645  EIAKTLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  687



>gb|KJB47938.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=572

 Score =   265 bits (677),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  360  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  419

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  420  EWDPTGRYVATAVTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPSFLSAEKEE  479

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EILK LKKYSKKY+AEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  480  EILKYLKKYSKKYDAEDQDVSMLLSEQDREKRRMLKEEWEKWIS  523



>ref|XP_002874283.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50542.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  525  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  584

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G L+YRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  585  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLVYRILKDHFFQLAWRPRPPSFLTAEKEE  644

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+WE W+
Sbjct  645  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRALKEEWEKWV  687



>ref|XP_011085122.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Sesamum indicum]
Length=715

 Score =   268 bits (685),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSPAGRFIILAGLKGFNGQLEF++VDELETMA AEHFMATD+
Sbjct  503  GRVSKLTTLKGKQANALYWSPAGRFIILAGLKGFNGQLEFYNVDELETMAQAEHFMATDV  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYV TA+TSVHEMENGFN+WSF+GKLLYRI +DHFFQFLWRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVVTAVTSVHEMENGFNVWSFNGKLLYRIPRDHFFQFLWRPRPPSFLSPEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+W+ W++
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRMLKEEWDRWVS  666



>ref|XP_006405042.1| hypothetical protein EUTSA_v10000061mg [Eutrema salsugineum]
 gb|ESQ46495.1| hypothetical protein EUTSA_v10000061mg [Eutrema salsugineum]
Length=716

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLGTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF+IWSF+G LLYRILKDHFFQ  WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFSIWSFNGNLLYRILKDHFFQLAWRPRPPSFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            E+ KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EVAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|XP_010421590.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Camelina sativa]
Length=713

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLGTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRILKDHFFQLAWRPRPPSFLTAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK L E+WE W+
Sbjct  619  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALNEEWEKWV  661



>ref|XP_008784685.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Phoenix dactylifera]
Length=720

 Score =   267 bits (683),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANAL+WSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  504  GRVSKLTTLKAKQANALYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGF+IWSF+GKLLYRI KDHF+QFLWRPRPP FL+ EKEE
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFHIWSFNGKLLYRIPKDHFYQFLWRPRPPSFLSAEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQD+SLQLSEQDR+KRK L+E+WE+W+
Sbjct  624  EIAKNLKKYSKKYEAEDQDMSLQLSEQDRKKRKMLQEEWEAWV  666



>ref|XP_008786288.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Phoenix dactylifera]
Length=718

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLKGKQANAL+WSPAG FI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  504  GRVSKLATLKGKQANALYWSPAGHFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGF+IWSF+GKLLYRI KDHF+QFLWRPRPP  L+ EKE+
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFHIWSFNGKLLYRIPKDHFYQFLWRPRPPSLLSAEKED  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSLQLSEQDR+KRK L+E+W++W++
Sbjct  624  EIAKNLKKYSKKYEAEDQDVSLQLSEQDRKKRKMLQEEWDAWVS  667



>ref|XP_011036732.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Populus euphratica]
Length=718

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 153/165 (93%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GR+IILAGLKGFNGQLEF++VDELETMATAEHF ATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPSGRYIILAGLKGFNGQLEFYNVDELETMATAEHFTATDI  561

Query  584  EWDPTGRYVATALTSV-HEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT++TSV HEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRPP FL+ EKE
Sbjct  562  EWDPTGRYVATSVTSVHHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPPSFLSPEKE  621

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LK++WE W++
Sbjct  622  EEIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRMLKDEWEKWVS  666



>ref|XP_010454917.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=715

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMAT+I
Sbjct  501  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATEI  560

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYR LKDHFFQ  WRPRPP FLT EKEE
Sbjct  561  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRTLKDHFFQLAWRPRPPSFLTAEKEE  620

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  621  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  663



>ref|XP_010455107.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=721

 Score =   267 bits (683),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  507  GRVSKLGTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  566

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  567  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRILKDHFFQLAWRPRPPSFLTAEKEE  626

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK L E+WE W+
Sbjct  627  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALNEEWEKWV  669



>ref|XP_010493833.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=713

 Score =   266 bits (681),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMAT+I
Sbjct  499  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATEI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G LLYR LKDHFFQ  WRPRPP FLT EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRTLKDHFFQLAWRPRPPSFLTAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI K+LKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKDLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|XP_006841801.1| hypothetical protein AMTR_s00003p00268400 [Amborella trichopoda]
 gb|ERN03476.1| hypothetical protein AMTR_s00003p00268400 [Amborella trichopoda]
Length=718

 Score =   266 bits (681),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KLAT+KGKQANAL+WSPAGRFIILAGLKG NGQLEF++VDELETMA  EHFMATD+EWDP
Sbjct  508  KLATIKGKQANALYWSPAGRFIILAGLKGLNGQLEFYNVDELETMAVGEHFMATDVEWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVAT++TSVHEMENGFNIWSFHGKLLYRI +DHF+QFLWRPRPP FLT +KEEEI K
Sbjct  568  TGRYVATSVTSVHEMENGFNIWSFHGKLLYRISRDHFYQFLWRPRPPSFLTPDKEEEIAK  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYEAEDQDVSL LSEQDR+KR++L E+W+ W+
Sbjct  628  NLKKYSKKYEAEDQDVSLLLSEQDREKRRQLHEEWDRWV  666



>gb|KJB47936.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=715

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPSFLSAEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EILK LKKYSKKY+AEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  623  EILKYLKKYSKKYDAEDQDVSMLLSEQDREKRRMLKEEWEKWIS  666



>gb|KHG06633.1| Eukaryotic translation initiation factor 3 subunit B -like protein 
[Gossypium arboreum]
Length=715

 Score =   266 bits (680),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/164 (87%), Positives = 153/164 (93%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPSFLSAEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EILK LKKYSKKY+AEDQDVS+ LSEQDR+KR+ LKE+WE W++
Sbjct  623  EILKYLKKYSKKYDAEDQDVSMLLSEQDREKRRMLKEEWEKWIS  666



>ref|XP_002872264.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48523.1| TIF3B1 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+G ++YRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGIVIYRILKDHFFQLAWRPRPPSFLTAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LK++WE W+
Sbjct  619  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKDEWEKWV  661



>gb|KFK32610.1| hypothetical protein AALP_AA6G266400 [Arabis alpina]
Length=713

 Score =   266 bits (680),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 137/163 (84%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  499  GRVSKLVTLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF+IWSF+G LLYRILKDHFFQ  WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFSIWSFNGNLLYRILKDHFFQLAWRPRPPSFLSAEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYE EDQDVSLQLSEQDR KR  LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYELEDQDVSLQLSEQDRAKRNALKEEWEKWL  661



>ref|XP_010421435.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X1 [Camelina sativa]
Length=566

 Score =   262 bits (670),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMAT+I
Sbjct  352  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATEI  411

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
             WDPTGRYVATA+TSVHEM+NGF IWSF+G LLYR LKDHFFQ  WRPRPP FLT EKEE
Sbjct  412  LWDPTGRYVATAVTSVHEMDNGFTIWSFNGNLLYRTLKDHFFQLAWRPRPPSFLTAEKEE  471

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  472  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  514



>gb|EYU40305.1| hypothetical protein MIMGU_mgv1a002098mg [Erythranthe guttata]
Length=715

 Score =   266 bits (679),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLAT+KGKQANALFWSP GRFIILAGLK  NGQLEF++VDELETMA AEHFMATD+
Sbjct  503  GRVSKLATIKGKQANALFWSPTGRFIILAGLKTLNGQLEFYNVDELETMAQAEHFMATDV  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYV TA+TSVHEMENGFN+WSF+GKLLYRILKDHFFQFLWRPRP  FLT EKEE
Sbjct  563  EWDPTGRYVVTAVTSVHEMENGFNVWSFNGKLLYRILKDHFFQFLWRPRPQSFLTAEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVS+ LSEQDR+KRK +KE+W  W+N
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSMLLSEQDREKRKMVKEEWARWVN  666



>ref|XP_010695357.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Beta vulgaris subsp. vulgaris]
Length=711

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/164 (82%), Positives = 148/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANAL+WSP GR+IILAGLKGFNGQLEFF+VDELETMAT EHFM TD+
Sbjct  496  GRVSKLTTLKSKQANALYWSPGGRYIILAGLKGFNGQLEFFNVDELETMATTEHFMCTDV  555

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF+IWSF+GK LYR+LKDHFFQF+WRPRPP  LT EKEE
Sbjct  556  EWDPTGRYVATAVTSVHEMENGFHIWSFNGKSLYRVLKDHFFQFIWRPRPPTLLTPEKEE  615

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+W SW+N
Sbjct  616  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRLLKEEWSSWIN  659



>gb|AIZ68196.1| eukaryotic translation initiation factor 3 subunit B-like protein 
[Ornithogalum saundersiae]
Length=718

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G  +KL TLK KQANAL+WSP GRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  504  GRVQKLTTLKSKQANALYWSPGGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            +WDPTGRYVAT++TSVHEMENGF+IWSF+GKLLY I KDHFFQFLWRPRPP FLT EKEE
Sbjct  564  DWDPTGRYVATSVTSVHEMENGFHIWSFNGKLLYSIPKDHFFQFLWRPRPPSFLTAEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSLQLSEQDR+KRK L+E+W+ W+
Sbjct  624  EIAKNLKKYSKKYEAEDQDVSLQLSEQDRKKRKMLQEEWDDWV  666



>gb|AES73491.2| eukaryotic translation initiation factor 3 subunit B [Medicago 
truncatula]
Length=716

 Score =   265 bits (676),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGRFI+LAGLKGFNG LEF++VDELETMA  EHF ATD+
Sbjct  502  GRVSKLTTLKGKQANALFWSPAGRFIVLAGLKGFNGLLEFYNVDELETMANTEHFYATDV  561

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRP  FLT EKEE
Sbjct  562  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPASFLTAEKEE  621

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKEDW+ W N
Sbjct  622  EIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRVLKEDWDKWAN  665



>ref|XP_003603240.1| Eukaryotic translation initiation factor 3 subunit B [Medicago 
truncatula]
Length=731

 Score =   264 bits (675),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSPAGRFI+LAGLKGFNG LEF++VDELETMA  EHF ATD+
Sbjct  517  GRVSKLTTLKGKQANALFWSPAGRFIVLAGLKGFNGLLEFYNVDELETMANTEHFYATDV  576

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRP  FLT EKEE
Sbjct  577  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPASFLTAEKEE  636

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKEDW+ W N
Sbjct  637  EIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRVLKEDWDKWAN  680



>ref|XP_006371769.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
 gb|ERP49566.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
Length=718

 Score =   264 bits (674),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/165 (84%), Positives = 152/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GR+IILAGLKGFNGQLEF++VDELETMATAEHF ATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPSGRYIILAGLKGFNGQLEFYNVDELETMATAEHFTATDI  561

Query  584  EWDPTGRYVATALTSV-HEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT++TSV HEMENGFNIWSF+GKLLYRILKDHFFQFLWRPRP  FL+ EKE
Sbjct  562  EWDPTGRYVATSVTSVHHEMENGFNIWSFNGKLLYRILKDHFFQFLWRPRPASFLSPEKE  621

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LK++WE W++
Sbjct  622  EEIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRMLKDEWEKWVS  666



>ref|XP_002874327.1| hypothetical protein ARALYDRAFT_351685 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50586.1| hypothetical protein ARALYDRAFT_351685 [Arabidopsis lyrata subsp. 
lyrata]
Length=1247

 Score =   269 bits (687),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMAT+EHFMATDI
Sbjct  426  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATSEHFMATDI  485

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF +WSF+G L+YRILKDHFFQ  WRPRPP FLT EKEE
Sbjct  486  EWDPTGRYVATAVTSVHEMENGFTMWSFNGNLVYRILKDHFFQLAWRPRPPSFLTAEKEE  545

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+WE W+
Sbjct  546  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRALKEEWEKWV  588



>ref|XP_010675245.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Beta vulgaris subsp. vulgaris]
Length=712

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 135/160 (84%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQANAL+WSP GR+IILAGLKGFNGQLEF++VDELETMAT EHFM TDIEWDP
Sbjct  501  KLTTLKSKQANALYWSPGGRYIILAGLKGFNGQLEFYNVDELETMATTEHFMCTDIEWDP  560

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRYVATA+TSVHEMENGF IWSF+GKLLYRI KDHFFQFLWRPRPP  L+ EKEEEI K
Sbjct  561  TGRYVATAVTSVHEMENGFTIWSFNGKLLYRISKDHFFQFLWRPRPPTLLSPEKEEEIAK  620

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVSL LSEQDR+KR+ LKE+W SW+N
Sbjct  621  NLKKYSKKYEAEDQDVSLLLSEQDREKRRLLKEEWNSWLN  660



>ref|XP_006855977.1| hypothetical protein AMTR_s00037p00235640 [Amborella trichopoda]
 gb|ERN17444.1| hypothetical protein AMTR_s00037p00235640 [Amborella trichopoda]
Length=719

 Score =   263 bits (672),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL T+KGKQANAL+WSPAGRFIILAGLKG NGQLEF++VDELETMA  EHFMATD+
Sbjct  504  GRVSKLTTIKGKQANALYWSPAGRFIILAGLKGLNGQLEFYNVDELETMAVGEHFMATDV  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSFHGKLLYRI +DHF+QFLWRPRP  FLT EKEE
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFNIWSFHGKLLYRISRDHFYQFLWRPRPASFLTLEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSK+YEAEDQDVSL LSEQDR+KR++L+E+W+ W+
Sbjct  624  EIAKNLKKYSKRYEAEDQDVSLLLSEQDREKRRQLQEEWDRWV  666



>ref|XP_010919846.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
 ref|XP_010919847.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Elaeis guineensis]
Length=720

 Score =   262 bits (670),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   K+ TLK KQANAL+WSP G FI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  504  GRVSKITTLKAKQANALYWSPGGHFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGF+IWSF+GKLLYRI KDHF+QFLWRPRPP FL+ EKEE
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFHIWSFNGKLLYRIPKDHFYQFLWRPRPPSFLSAEKEE  623

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQD+SLQLSEQDR+KRK L+E+W++W++
Sbjct  624  EIAKNLKKYSKKYEAEDQDMSLQLSEQDRKKRKMLQEEWDAWVS  667



>ref|XP_010421436.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like isoform X2 [Camelina sativa]
Length=734

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMAT+I
Sbjct  520  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATEI  579

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
             WDPTGRYVATA+TSVHEM+NGF IWSF+G LLYR LKDHFFQ  WRPRPP FLT EKEE
Sbjct  580  LWDPTGRYVATAVTSVHEMDNGFTIWSFNGNLLYRTLKDHFFQLAWRPRPPSFLTAEKEE  639

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  640  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  682



>ref|XP_010276277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nelumbo nucifera]
Length=721

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSP+GRFIILAGLK FNGQLEF++VDELETMAT EHFMATDI
Sbjct  503  GRVSKLITLKGKQANALYWSPSGRFIILAGLKSFNGQLEFYNVDELETMATGEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRI +DHF QFLWRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRIPRDHFCQFLWRPRPPSFLSVEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ L+E+W+ W+
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRMLQEEWDRWV  665



>ref|XP_010245655.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Nelumbo nucifera]
Length=719

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/163 (82%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSPAGRFIILAGLK FNGQLEF++VD+LETMAT EHFMATDI
Sbjct  503  GRVSKLITLKGKQANALYWSPAGRFIILAGLKSFNGQLEFYNVDDLETMATGEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYRI +DHF QFLWRPRPP FL+ EKEE
Sbjct  563  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRIPRDHFCQFLWRPRPPSFLSAEKEE  622

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVSL LSEQDR+KR+ L+E+W+ W+
Sbjct  623  EIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRRLLQEEWDRWV  665



>ref|XP_011031407.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Populus euphratica]
Length=719

 Score =   261 bits (666),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GR+IILAGLKGFNGQLEF++VDELETMATAEHF ATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPSGRYIILAGLKGFNGQLEFYNVDELETMATAEHFTATDI  561

Query  584  EWDPTGRYVATALTSV-HEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT++TSV H+MENGFNIWSF+GKLLYR LKDHFFQFLWRPRPP  L+ EKE
Sbjct  562  EWDPTGRYVATSVTSVHHDMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPPSLLSPEKE  621

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI KNLKKYSKKYEAEDQDVSLQLSEQDR+KR+ +K++W  W++
Sbjct  622  EEIAKNLKKYSKKYEAEDQDVSLQLSEQDREKRRMMKDEWYKWVS  666



>ref|XP_002308719.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
 gb|EEE92242.1| Eukaryotic translation initiation factor 3 subunit 9 family protein 
[Populus trichocarpa]
Length=719

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/165 (82%), Positives = 151/165 (92%), Gaps = 1/165 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP+GR++ILAGLKGFNGQLEF++VDELETMATAEHFMATDI
Sbjct  502  GRVSKLTTLKGKQANALFWSPSGRYLILAGLKGFNGQLEFYNVDELETMATAEHFMATDI  561

Query  584  EWDPTGRYVATALTSV-HEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT++TSV H+MENGFNIWSF+GKLLYR LKDHFFQFLWRPRP   L+ EKE
Sbjct  562  EWDPTGRYVATSVTSVHHDMENGFNIWSFNGKLLYRTLKDHFFQFLWRPRPLSLLSPEKE  621

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEI KNLKKYSKKYEAEDQDVSLQLSEQDR+KR+ +K++W  W+N
Sbjct  622  EEIAKNLKKYSKKYEAEDQDVSLQLSEQDREKRRMMKDEWYKWVN  666



>gb|ABK25119.1| unknown [Picea sitchensis]
Length=724

 Score =   260 bits (664),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLAT+KGKQAN+L+WSP GRFIILAGLK  NGQLEFF+VDELETMAT EHFMATDI
Sbjct  507  GRVSKLATIKGKQANSLYWSPIGRFIILAGLKALNGQLEFFNVDELETMATGEHFMATDI  566

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRY AT++T VHEMENGFNIWSF+GKLLYRI +DHF+Q LWRPRPP  L+ EKEE
Sbjct  567  EWDPTGRYAATSVTVVHEMENGFNIWSFNGKLLYRIPRDHFYQLLWRPRPPSLLSPEKEE  626

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNL+KYSKKYEAEDQDVSL LSEQDR+KRK+L+EDW+ W+N
Sbjct  627  EISKNLRKYSKKYEAEDQDVSLLLSEQDREKRKRLQEDWQGWVN  670



>ref|XP_009140599.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Brassica rapa]
 emb|CDY45599.1| BnaA04g14660D [Brassica napus]
Length=714

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP+G++IILAGLK FNGQLEFF+VDE+ETMAT EHFMATDI
Sbjct  499  GRVTKLGTLKAKQANALFWSPSGKYIILAGLKNFNGQLEFFNVDEMETMATTEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF +WSF+GKLLYR+LKDHFFQ  WRPRP  FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTVWSFNGKLLYRVLKDHFFQLAWRPRPASFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNL+KYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLRKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>emb|CDX76792.1| BnaC08g33780D [Brassica napus]
Length=714

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLK FNGQLEFF+VDELETMAT EHFMATDI
Sbjct  499  GRVTKLGTLKAKQANALFWSPTGKYIILAGLKNFNGQLEFFNVDELETMATTEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+GKLLYR LKDHFFQ  WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGKLLYRNLKDHFFQLAWRPRPPSFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYE EDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYELEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|XP_009117099.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brassica rapa]
Length=714

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLK FNGQLEFF+VDELETMAT EHFMATDI
Sbjct  499  GRVTKLGTLKAKQANALFWSPTGKYIILAGLKNFNGQLEFFNVDELETMATTEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+GKLLYR LKDHFFQ  WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGKLLYRNLKDHFFQLAWRPRPPSFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYE EDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYELEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>emb|CDY34755.1| BnaA09g41220D [Brassica napus]
Length=714

 Score =   259 bits (663),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLK FNGQLEFF+VDELETMAT EHFMATDI
Sbjct  499  GRVTKLGTLKAKQANALFWSPTGKYIILAGLKNFNGQLEFFNVDELETMATTEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF IWSF+GKLLYR LKDHFFQ  WRPRPP FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTIWSFNGKLLYRNLKDHFFQLAWRPRPPSFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYE EDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLKKYSKKYELEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|XP_009140598.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Brassica rapa]
Length=737

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP+G++IILAGLK FNGQLEFF+VDE+ETMAT EHFMATDI
Sbjct  522  GRVTKLGTLKAKQANALFWSPSGKYIILAGLKNFNGQLEFFNVDEMETMATTEHFMATDI  581

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF +WSF+GKLLYR+LKDHFFQ  WRPRP  FL+ EKEE
Sbjct  582  EWDPTGRYVATAVTSVHEMENGFTVWSFNGKLLYRVLKDHFFQLAWRPRPASFLSPEKEE  641

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNL+KYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  642  EIAKNLRKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  684



>emb|CDY36167.1| BnaC04g37270D [Brassica napus]
Length=714

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANALFWSP G++IILAGLK FNGQLEFF+VDE+ETMAT EHFMATDI
Sbjct  499  GRVTKLGTLKAKQANALFWSPTGKYIILAGLKNFNGQLEFFNVDEMETMATTEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF +WSF+GKLLYR+LKDHFFQ  WRPRP  FL+ EKEE
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFTVWSFNGKLLYRVLKDHFFQLAWRPRPASFLSPEKEE  618

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNL+KYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  619  EIAKNLRKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  661



>ref|NP_568477.1| eukaryotic translation initiation factor 3B-2 [Arabidopsis thaliana]
 gb|AAO00753.1| eukaryotic translation initiation factor - like protein [Arabidopsis 
thaliana]
 gb|AED93487.1| eukaryotic translation initiation factor 3B-2 [Arabidopsis thaliana]
Length=714

 Score =   258 bits (660),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KLATLK KQANALFWSP G++IILAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  500  GRVSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDI  559

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++T+VHEMENGF IWSF+G ++YRILKDHFFQ  WRPRP  FLT EKEE
Sbjct  560  EWDPTGRYVATSVTTVHEMENGFTIWSFNGNMVYRILKDHFFQLAWRPRPASFLTAEKEE  619

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNL+ YSK+YEAEDQDVSL LSEQDR+KR+ L E+W+ W+
Sbjct  620  EIAKNLRNYSKRYEAEDQDVSLLLSEQDREKRRALNEEWQKWV  662



>ref|XP_009381931.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Musa acuminata subsp. malaccensis]
Length=721

 Score =   258 bits (659),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLK KQANAL+WSPAGR+I+LAGLKGFNGQLEF++VDELETMAT EHFMATDI
Sbjct  505  GRVSKLTTLKAKQANALYWSPAGRYIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDI  564

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENGF+IWSF GKLLYRI +DHF+QF WRPRPP  L+ EKEE
Sbjct  565  EWDPTGRYVATAVTSVHEMENGFHIWSFSGKLLYRISRDHFYQFEWRPRPPSLLSAEKEE  624

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSKKYEAEDQDVS+QL+EQDR+KRK L+E W  W+
Sbjct  625  EIAKNLKKYSKKYEAEDQDVSMQLNEQDRRKRKMLQEQWNEWV  667



>ref|NP_001136479.1| hypothetical protein [Zea mays]
 gb|ACF82021.1| unknown [Zea mays]
Length=337

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQAN L+WSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  125  KLTTLKAKQANTLYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  184

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF GK LY++ KDHF+QF+WRPRPP  LT EKEEEI +
Sbjct  185  TGRYLATAVTSVHEMENGFQIWSFSGKHLYKVSKDHFYQFIWRPRPPSLLTAEKEEEISR  244

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYE EDQD   QLSEQDR++R +L+E+W+SW+
Sbjct  245  NLKKYSKKYEQEDQDAFNQLSEQDRKRRTQLQEEWDSWV  283



>ref|XP_010108292.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
 gb|EXC18772.1| Eukaryotic translation initiation factor 3 subunit B [Morus notabilis]
Length=714

 Score =   256 bits (654),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 147/164 (90%), Gaps = 0/164 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGK ANALFWSPAGRFII AGLK  NG LEF++VDELETMA+ EHFM TDI
Sbjct  500  GRISKLTTLKGKNANALFWSPAGRFIIFAGLKTQNGTLEFYNVDELETMASGEHFMCTDI  559

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVAT++TSVHEMENGFNIWSF+GKLLYR+++DHFFQFLWRPRPP FL+ EKEE
Sbjct  560  EWDPTGRYVATSVTSVHEMENGFNIWSFNGKLLYRVMRDHFFQFLWRPRPPSFLSPEKEE  619

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EI KNLKKYSKKYEAEDQDVSL LSEQ+R+KR+ LKE+W+ W++
Sbjct  620  EIAKNLKKYSKKYEAEDQDVSLLLSEQEREKRRMLKEEWDKWVS  663



>ref|XP_004302144.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Fragaria vesca subsp. vesca]
Length=713

 Score =   251 bits (640),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL WSP+GRFIILAGLKG NGQLEF++VDE ETMAT EHFMATDI
Sbjct  502  GRVSKLITLKGKQANALSWSPSGRFIILAGLKGLNGQLEFYNVDEQETMATQEHFMATDI  561

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekee  405
            EWDPTGRYVATA+TSVHEMENG+ IW+F+GKLLYR+LKDHF QFLWRPRP  FLT E+EE
Sbjct  562  EWDPTGRYVATAVTSVHEMENGYIIWTFNGKLLYRVLKDHFLQFLWRPRPASFLTPEQEE  621

Query  404  eilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            EI KNLKKYSK+YE ED DV  QLSEQDR KR++LKE+WE W+
Sbjct  622  EIAKNLKKYSKRYELEDNDVEKQLSEQDRAKRRELKEEWEKWV  664



>ref|NP_001065446.1| Os10g0569200 [Oryza sativa Japonica Group]
 gb|AAL86464.1|AC077693_3 putative eukaryotic initiation factor subunit [Oryza sativa Japonica 
Group]
 gb|AAP55090.1| Eukaryotic translation initiation factor 3 subunit 9, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF27283.1| Os10g0569200 [Oryza sativa Japonica Group]
 dbj|BAG90702.1| unnamed protein product [Oryza sativa Japonica Group]
Length=719

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSP GRFI+ AGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKGKQANALFWSPGGRFIVFAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+A+A+TSVHEMENGF IWSF GK LY++ KDHFFQFLWRPRPP  LT EKE+EI K
Sbjct  568  TGRYLASAVTSVHEMENGFQIWSFSGKQLYKVSKDHFFQFLWRPRPPSLLTPEKEDEIAK  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NL+KYSKKYE EDQD   QLSEQ+R++RK+L+E+WE W+
Sbjct  628  NLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQEEWEGWV  666



>gb|EEC67477.1| hypothetical protein OsI_34716 [Oryza sativa Indica Group]
Length=720

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSP GRFI+ AGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKGKQANALFWSPGGRFIVFAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+A+A+TSVHEMENGF IWSF GK LY++ KDHFFQFLWRPRPP  LT EKE+EI K
Sbjct  568  TGRYLASAVTSVHEMENGFQIWSFSGKQLYKVSKDHFFQFLWRPRPPSLLTPEKEDEIAK  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NL+KYSKKYE EDQD   QLSEQ+R++RK+L+E+WE W+
Sbjct  628  NLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQEEWEGWV  666



>ref|XP_004983594.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Setaria italica]
Length=720

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQANALFWSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKAKQANALFWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF+GK LY++ KDHF+QF+WRPRPP  LT EKEEEI K
Sbjct  568  TGRYLATAVTSVHEMENGFQIWSFNGKHLYKVSKDHFYQFIWRPRPPSLLTPEKEEEISK  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYE EDQD   QLSEQ+R++R +L+E+W+SW+
Sbjct  628  NLKKYSKKYEQEDQDAFNQLSEQERKRRTQLQEEWDSWV  666



>ref|XP_002464900.1| hypothetical protein SORBIDRAFT_01g028520 [Sorghum bicolor]
 gb|EER91898.1| hypothetical protein SORBIDRAFT_01g028520 [Sorghum bicolor]
Length=720

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQANAL+WSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKAKQANALYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF+GK LY++ KDHF+QF+WRPRPP  L+ EKEEEI +
Sbjct  568  TGRYLATAVTSVHEMENGFQIWSFNGKHLYKVSKDHFYQFIWRPRPPSLLSPEKEEEISR  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYE EDQD   QLSEQDR++R +L+E+W+SW+
Sbjct  628  NLKKYSKKYEQEDQDAFNQLSEQDRKRRTQLQEEWDSWV  666



>dbj|BAJ85622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=721

 Score =   246 bits (628),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGRFI+LAGLKGFNGQLEFF+VD+LETMAT EHFMATDI WDP
Sbjct  509  KLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQLEFFNVDDLETMATGEHFMATDIMWDP  568

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGR++ATA+TSVHEMENGF IWSF+GKL+Y+I KDHF+QF WRPRPP  LT EKEE+I K
Sbjct  569  TGRFLATAVTSVHEMENGFQIWSFNGKLIYKISKDHFYQFQWRPRPPSLLTPEKEEDISK  628

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE EDQDVS Q+ EQ+R++R +L+E+W +W+
Sbjct  629  NLKRYSKKYEQEDQDVSNQVGEQERKRRTQLQEEWLAWV  667



>ref|XP_008664809.1| PREDICTED: uncharacterized protein LOC100216593 isoform X1 [Zea 
mays]
 gb|ACN28856.1| unknown [Zea mays]
 tpg|DAA46387.1| TPA: hypothetical protein ZEAMMB73_070228 [Zea mays]
Length=720

 Score =   245 bits (626),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQAN L+WSPAGRFI+LAGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKAKQANTLYWSPAGRFIVLAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF GK LY++ KDHF+QF+WRPRPP  LT EKEEEI +
Sbjct  568  TGRYLATAVTSVHEMENGFQIWSFSGKHLYKVSKDHFYQFIWRPRPPSLLTAEKEEEISR  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYE EDQD   QLSEQDR++R +L+E+W+SW+
Sbjct  628  NLKKYSKKYEQEDQDAFNQLSEQDRKRRTQLQEEWDSWV  666



>gb|EMS54123.1| Eukaryotic translation initiation factor 3 subunit B [Triticum 
urartu]
Length=721

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGRFI+LAGLKGFNGQLEFF+VD+LETMAT EHFMATDI WDP
Sbjct  509  KLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQLEFFNVDDLETMATGEHFMATDIMWDP  568

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGR++ATA+TSVHEMENGF IWSF+GKL+Y+I KDHF+QF WRPRPP  LT EKEE+I K
Sbjct  569  TGRFLATAVTSVHEMENGFQIWSFNGKLIYKISKDHFYQFQWRPRPPSLLTPEKEEDISK  628

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE ED DVS Q+ EQ+R++R +L+E+W+ W+
Sbjct  629  NLKRYSKKYEQEDLDVSNQVGEQERKRRTQLQEEWQGWV  667



>ref|XP_003578786.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brachypodium distachyon]
Length=719

 Score =   244 bits (623),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            K+ TLKGKQANALFWSPAG FI+LAGLKGFNGQLEF++VD+LETMAT EHFMATDI WDP
Sbjct  509  KITTLKGKQANALFWSPAGHFIVLAGLKGFNGQLEFYNVDDLETMATGEHFMATDIMWDP  568

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGR++ATA+TSVHEMENGF IWSF+GK +Y++ KDHF+QF WRPRPP  LT EKEEEI  
Sbjct  569  TGRFLATAVTSVHEMENGFQIWSFNGKQIYKVSKDHFYQFHWRPRPPSLLTPEKEEEISA  628

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE EDQDV  Q+SEQDR++RK+L+E+WE W+
Sbjct  629  NLKRYSKKYEQEDQDVFNQVSEQDRKRRKQLQEEWEGWV  667



>gb|EMT19614.1| Eukaryotic translation initiation factor 3 subunit B [Aegilops 
tauschii]
Length=672

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGRFI+LAGLKGFNGQLEFF+VD+LETMAT EHFMATDI WDP
Sbjct  460  KLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQLEFFNVDDLETMATGEHFMATDIMWDP  519

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGR++ATA+TSVHEMENGF IWSF+GKL+Y+I KDHF+QF WRPRPP  LT EKEE+I K
Sbjct  520  TGRFLATAVTSVHEMENGFQIWSFNGKLIYKISKDHFYQFQWRPRPPSLLTPEKEEDISK  579

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE ED DVS Q+ E +R++R +L+E+W+ W+
Sbjct  580  NLKRYSKKYEQEDLDVSNQVGELERKRRTQLQEEWQGWV  618



>ref|XP_010232157.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Brachypodium distachyon]
Length=718

 Score =   241 bits (615),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGRFI+LAGLKGFNGQLEF++VD+LETMAT EHFMATDI WDP
Sbjct  508  KLTTLKGKQANALFWSPAGRFIVLAGLKGFNGQLEFYNVDDLETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGR++ATA+TSVHEMENGF IWSF+GK +Y++ KDHF+QF WRPRPP  LT EKEE+I +
Sbjct  568  TGRFLATAVTSVHEMENGFQIWSFNGKQIYKVSKDHFYQFHWRPRPPSLLTPEKEEDISR  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLKKYSKKYE EDQDV  Q+ EQ+R++R +L+E+WE W+
Sbjct  628  NLKKYSKKYEQEDQDVFNQVGEQERKRRTQLQEEWEGWV  666



>ref|XP_006662084.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Oryza brachyantha]
Length=719

 Score =   241 bits (614),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLK KQANALFWSP GRFI+ AGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKSKQANALFWSPGGRFIVFAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+A+A+TSVHEMENGF IWSF GK LY++ KDHF+QF+WRPRPP  LT EKEEEI K
Sbjct  568  TGRYLASAVTSVHEMENGFQIWSFSGKQLYKVSKDHFYQFMWRPRPPSLLTAEKEEEISK  627

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NL+KYSKKYE EDQD    LSEQ+R++RK+L+E+WE W+
Sbjct  628  NLRKYSKKYEQEDQDAFNMLSEQERKRRKQLQEEWEGWV  666



>gb|EMT20627.1| Eukaryotic translation initiation factor 3 subunit B [Aegilops 
tauschii]
Length=693

 Score =   240 bits (612),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSPAGRFI+LAG++GFNGQLEFF+VDELETMAT EHFMATDI WDP
Sbjct  481  KLTTLKGKQANALFWSPAGRFIVLAGMRGFNGQLEFFNVDELETMATGEHFMATDIMWDP  540

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF+GK +Y++LKD F+QF WRPRPP  LT EKEE+I K
Sbjct  541  TGRYLATAVTSVHEMENGFQIWSFNGKQIYKVLKDQFYQFQWRPRPPSLLTPEKEEDISK  600

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE EDQDV   L E++R++R +L+E WE+W+
Sbjct  601  NLKRYSKKYEQEDQDVHHLLDEEERKRRTRLQEVWEAWV  639



>ref|XP_001770820.1| predicted protein [Physcomitrella patens]
 gb|EDQ64344.1| predicted protein [Physcomitrella patens]
Length=723

 Score =   233 bits (594),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 141/164 (86%), Gaps = 0/164 (0%)
 Frame = -2

Query  767  RGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATD  588
            +G   KL TLKG+QANAL+WSP GRFIILAGLK +NGQLEF++VD+LETMATAEHFMATD
Sbjct  505  KGRVTKLTTLKGRQANALYWSPLGRFIILAGLKAYNGQLEFYNVDDLETMATAEHFMATD  564

Query  587  IEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            ++WDPTGR+ +T++TSVH+MENGFNIWSF GKLLYR+ +D FFQFLWRPRPP  LT E E
Sbjct  565  VDWDPTGRFCSTSVTSVHQMENGFNIWSFQGKLLYRLPRDRFFQFLWRPRPPTLLTPEDE  624

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
             EI KNL+KYSKKYEA+D   SL+ +E+D + R+KL ++W+SW+
Sbjct  625  AEIAKNLRKYSKKYEADDLARSLEGTERDTENRRKLVDEWKSWV  668



>gb|AAF67758.1|AF255680_1 eIF3b [Arabidopsis thaliana]
Length=716

 Score =   231 bits (589),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 135/160 (84%), Gaps = 1/160 (1%)
 Frame = -2

Query  752  KLATLKGKQANA-LFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWD  576
            KLATLK KQA   L  +P      LAGLKGFNGQLEFF+VDELETMATAEHFMATDIEWD
Sbjct  505  KLATLKAKQAKCPLLVAPQASTSFLAGLKGFNGQLEFFNVDELETMATAEHFMATDIEWD  564

Query  575  PTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeil  396
            PTGRYVAT++T+VHEMENGF IWSF+G ++YRILKDHFFQ  WRPRP  FLT EKEEEI 
Sbjct  565  PTGRYVATSVTTVHEMENGFTIWSFNGNMVYRILKDHFFQLAWRPRPASFLTAEKEEEIA  624

Query  395  knlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            KNL+ YSK+YEAEDQDVSL LSEQDR+KR+ L E+W+ W+
Sbjct  625  KNLRNYSKRYEAEDQDVSLLLSEQDREKRRALNEEWQKWV  664



>gb|KJB47937.1| hypothetical protein B456_008G047600 [Gossypium raimondii]
Length=620

 Score =   228 bits (581),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  503  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  562

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            EWDPTGRYVATA+TSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPP FL+
Sbjct  563  EWDPTGRYVATAVTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPSFLS  617



>gb|KHN29663.1| Eukaryotic translation initiation factor 3 subunit B [Glycine 
soja]
Length=302

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 138/177 (78%), Gaps = 10/177 (6%)
 Frame = -2

Query  779  VVVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHF  600
             V    +  KL TLKGKQANALFWSPAGR+I+LAGLKGFNGQLEF++VDEL+TMATAEHF
Sbjct  62   AVNVESQVSKLTTLKGKQANALFWSPAGRYIVLAGLKGFNGQLEFYNVDELKTMATAEHF  121

Query  599  MATDIEWDPTGRYVATALTSVHEMENGF--------NIWSFHGKLLYRILKDHFFQFLWR  444
            MATDIEWDPTGRYVATA+TSVHEMENGF        +I    G L+   L      FLWR
Sbjct  122  MATDIEWDPTGRYVATAVTSVHEMENGFSMVFQWQTSISDSEGSLISGTLTSA-LDFLWR  180

Query  443  PRPPPFLTRekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            PRPP FLT EKEEEI KNLKKYS  YEAEDQDVSL LSEQ+R+K + LKEDW+ W+N
Sbjct  181  PRPPSFLTPEKEEEIAKNLKKYS-IYEAEDQDVSLPLSEQEREKCRMLKEDWDKWVN  236



>ref|XP_002986150.1| hypothetical protein SELMODRAFT_182220 [Selaginella moellendorffii]
 gb|EFJ12681.1| hypothetical protein SELMODRAFT_182220 [Selaginella moellendorffii]
Length=723

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KLATLKGKQANAL+WSPAGRFI+LAGLK +NGQLEF++VD+LETMATAEHFMATD++WDP
Sbjct  513  KLATLKGKQANALYWSPAGRFIVLAGLKAYNGQLEFYNVDDLETMATAEHFMATDVDWDP  572

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
             GRYVAT++TSVH+MENGF IWSFHGKL+Y++ +D FFQFLWRPRPP  L+ E+E EI +
Sbjct  573  AGRYVATSVTSVHQMENGFIIWSFHGKLIYKVSRDRFFQFLWRPRPPSLLSSEEEAEIFR  632

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLK+YSK+Y+ ED + S   S Q+ ++R+KL E+W  W++
Sbjct  633  NLKQYSKRYDQEDIESSRFHSTQELEQRRKLIEEWNGWLS  672



>ref|XP_002984964.1| hypothetical protein SELMODRAFT_446105 [Selaginella moellendorffii]
 gb|EFJ13839.1| hypothetical protein SELMODRAFT_446105 [Selaginella moellendorffii]
Length=723

 Score =   227 bits (578),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KLATLKGKQANAL+WSPAGRFI+LAGLK +NGQLEF++VD+LETMATAEHFMATD++WDP
Sbjct  513  KLATLKGKQANALYWSPAGRFIVLAGLKAYNGQLEFYNVDDLETMATAEHFMATDVDWDP  572

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
             GRYVAT++TSVH+MENGF IWSFHGKL+Y++ +D FFQFLWRPRPP  L+ E+E EI +
Sbjct  573  AGRYVATSVTSVHQMENGFIIWSFHGKLIYKVSRDRFFQFLWRPRPPSLLSSEEEAEIFR  632

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLK+YSK+Y+ ED + S   S Q+ ++R+KL E+W  W++
Sbjct  633  NLKQYSKRYDQEDIESSRFHSTQELEQRRKLIEEWNGWLS  672



>ref|XP_001771510.1| predicted protein [Physcomitrella patens]
 gb|EDQ63710.1| predicted protein [Physcomitrella patens]
Length=714

 Score =   226 bits (577),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 141/170 (83%), Gaps = 6/170 (4%)
 Frame = -2

Query  767  RGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATD  588
            +G   KL TLKG+QANAL+WSP GRFIILAGLK +NGQLEF++VD+LETMATAEHFMATD
Sbjct  490  KGRVTKLTTLKGRQANALYWSPLGRFIILAGLKAYNGQLEFYNVDDLETMATAEHFMATD  549

Query  587  IEWDPTGR------YVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPF  426
            ++WDPTGR      + +T++TSVH+MENGFNIWSF GKLLYR+ +D FFQFLWRPRPP  
Sbjct  550  VDWDPTGRQVKVSWFCSTSVTSVHQMENGFNIWSFQGKLLYRLPRDRFFQFLWRPRPPTL  609

Query  425  LTRekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            LT E E EI KNL+KYSKKYEA+D   SL+ +E+D + R+KL ++W+SW+
Sbjct  610  LTPEDEAEIAKNLRKYSKKYEADDLARSLEGTERDTENRRKLVDEWKSWV  659



>ref|XP_006412558.1| hypothetical protein EUTSA_v10027018mg, partial [Eutrema salsugineum]
 gb|ESQ54011.1| hypothetical protein EUTSA_v10027018mg, partial [Eutrema salsugineum]
Length=667

 Score =   217 bits (553),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 137/166 (83%), Gaps = 2/166 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILA-GLKGFNGQLEFFDVDELETMATAEHFMATD  588
            G   KL TLK KQANALFWSP G++IILA GL GFNG+LEF++VDEL TMAT E+FMATD
Sbjct  457  GRVSKLVTLKSKQANALFWSPTGKYIILADGLSGFNGKLEFYNVDELVTMATVENFMATD  516

Query  587  IEWDPTGRYVATALTS-VHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            IEWDPTGRYVATA+TS VHEMENGF IWSF GKLLY+ LK+  FQF WRPRPP  L+ +K
Sbjct  517  IEWDPTGRYVATAVTSSVHEMENGFYIWSFCGKLLYQTLKEQLFQFSWRPRPPSLLSNQK  576

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            EEE+ KNLK+Y ++YE ED DVS+ L +Q+++KR+ + E+WE W+N
Sbjct  577  EEEVEKNLKQYLERYEEEDGDVSVLLRKQEKEKRRMMIEEWEIWLN  622



>gb|EMS45026.1| Eukaryotic translation initiation factor 3 subunit B [Triticum 
urartu]
Length=688

 Score =   216 bits (551),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 8/159 (5%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQAN+LFWSPAGRFI+LAGL+GFNGQLEFF+VD+LETMA  EHFMATDI WDP
Sbjct  491  KLTTLKGKQANSLFWSPAGRFIVLAGLRGFNGQLEFFNVDDLETMARGEHFMATDIMWDP  550

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ATA+TSVHEMENGF IWSF+GK +Y+        F WRPRPP  LT EKEE+I K
Sbjct  551  TGRYLATAVTSVHEMENGFQIWSFNGKQIYK--------FQWRPRPPSLLTPEKEEDITK  602

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NLK+YSKKYE EDQDV   L E++R++R +L+E WE+W+
Sbjct  603  NLKRYSKKYEQEDQDVHHLLDEEERKRRMRLQEVWEAWV  641



>gb|KGN44088.1| hypothetical protein Csa_7G181630 [Cucumis sativus]
Length=168

 Score =   192 bits (488),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = -2

Query  620  MATAEHFMATDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRP  441
            MATAEHFMATDIEWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQF WRP
Sbjct  1    MATAEHFMATDIEWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQFAWRP  60

Query  440  RPPPFLTRekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            RPP FL+ E+EEEI KNLKKY+KKYEAEDQDVS+ LSEQDR+KRK LK+DW+ W+N
Sbjct  61   RPPSFLSPEQEEEIAKNLKKYTKKYEAEDQDVSMLLSEQDREKRKMLKDDWDKWLN  116



>ref|XP_007041117.1| Translation initiation factor 3B1 isoform 2 [Theobroma cacao]
 gb|EOX96948.1| Translation initiation factor 3B1 isoform 2 [Theobroma cacao]
Length=616

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANALFWSP GRFI+LAGLKGFNGQLEFF+VDELETMATAEHFMATDI
Sbjct  504  GRVSKLTTLKGKQANALFWSPGGRFIVLAGLKGFNGQLEFFNVDELETMATAEHFMATDI  563

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQF  453
            EWDPTGRYVAT++TSVHEMENGFN+WSF+GKLLYRILKDHFFQF
Sbjct  564  EWDPTGRYVATSVTSVHEMENGFNVWSFNGKLLYRILKDHFFQF  607



>gb|KCW52937.1| hypothetical protein EUGRSUZ_J02249 [Eucalyptus grandis]
Length=633

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQAN LFWSPAGR+IILAGLK FNGQLEF++VDELETMATAEHFMATDI
Sbjct  499  GRVSKLTTLKGKQANFLFWSPAGRYIILAGLKNFNGQLEFYNVDELETMATAEHFMATDI  558

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFL  450
            EWDPTGRYVATA+TSVHEMENGFNIWSF+GKLLYRILKDHFFQ  
Sbjct  559  EWDPTGRYVATAVTSVHEMENGFNIWSFNGKLLYRILKDHFFQVC  603



>gb|EEE51441.1| hypothetical protein OsJ_32527 [Oryza sativa Japonica Group]
Length=697

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 120/159 (75%), Gaps = 22/159 (14%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQANALFWSP GRFI+ AGLKGFNGQLEF++VDELETMAT EHFMATDI WDP
Sbjct  508  KLTTLKGKQANALFWSPGGRFIVFAGLKGFNGQLEFYNVDELETMATGEHFMATDIMWDP  567

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TG                       GK LY++ KDHFFQFLWRPRPP  LT EKE+EI K
Sbjct  568  TG----------------------SGKQLYKVSKDHFFQFLWRPRPPSLLTPEKEDEIAK  605

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            NL+KYSKKYE EDQD   QLSEQ+R++RK+L+E+WE W+
Sbjct  606  NLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQEEWEGWV  644



>ref|XP_002505347.1| eukaryotic translation initiation factor-like protein [Micromonas 
sp. RCC299]
 gb|ACO66605.1| eukaryotic translation initiation factor-like protein [Micromonas 
sp. RCC299]
Length=717

 Score =   189 bits (480),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + T+K K AN LFWSP G+ I+LAGLK  NGQ EFF+VDE+ETMA+AEHFMATD+EWDPT
Sbjct  503  IGTIKNKTANCLFWSPKGKVIVLAGLKTMNGQFEFFNVDEMETMASAEHFMATDVEWDPT  562

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GRYV TA+TSVH+MENGFN+W+F+G+LLY+  ++ F+QFLWRPR P  L+  KE EILKN
Sbjct  563  GRYVTTAVTSVHQMENGFNVWTFNGRLLYKHQRERFYQFLWRPRAPSLLSETKEAEILKN  622

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            LK YSK+++  D+ +          +++++ + W +W+
Sbjct  623  LKSYSKRFDELDESIRNAQDSHLAAEKQEVTDAWNAWL  660



>dbj|BAD94379.1| TRANSLATION INITIATION FACTOR 3 SUBUNIT 9-like protein [Arabidopsis 
thaliana]
Length=159

 Score =   174 bits (441),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  599  MATDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            MATDIEWDPTGRYVATA+TSVHEMENGF IWSF+G +LYRILKDHFFQ  WRPRPP FLT
Sbjct  1    MATDIEWDPTGRYVATAVTSVHEMENGFTIWSFNGIMLYRILKDHFFQLAWRPRPPSFLT  60

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
             EKEEEI K LKKYSKKYEAEDQDVSL LSEQDR+KRK LKE+WE W+
Sbjct  61   AEKEEEIAKTLKKYSKKYEAEDQDVSLLLSEQDREKRKALKEEWEKWV  108



>ref|XP_003060268.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55037.1| predicted protein [Micromonas pusilla CCMP1545]
Length=693

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + TLK K AN LFWSP G+ I+LAGLK  NGQ EFF+VDE+ETMA+AEHFMATD+EWDPT
Sbjct  482  IGTLKNKTANHLFWSPQGKTIVLAGLKTMNGQFEFFNVDEMETMASAEHFMATDVEWDPT  541

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GRYVATA+TSVH+MENGF++W+F+G+ LY+  ++ F+QFLWRPR P  L  EKE EI KN
Sbjct  542  GRYVATAVTSVHQMENGFHVWTFNGRQLYKHGRERFYQFLWRPRAPSLLPPEKEAEIAKN  601

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            LKKYSKK+E  D  +  +       +++ + ++W+ W
Sbjct  602  LKKYSKKFEELDDSIRSEQDSHLAAEKRAVMDEWKRW  638



>ref|XP_001421305.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99598.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=713

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 119/158 (75%), Gaps = 0/158 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + T+K K AN LFWSP GR +ILAGLK  NGQ EFFDV+ +ETMA+ EHFMATD+EWDPT
Sbjct  507  IGTVKNKTANHLFWSPNGRVVILAGLKTMNGQFEFFDVETMETMASVEHFMATDVEWDPT  566

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GR+V TA+TSVH+MENG+++W+F+GKLLY+  KD FFQFLWRPR    LT E+E +I KN
Sbjct  567  GRFVTTAVTSVHQMENGYHMWTFNGKLLYKYGKDRFFQFLWRPRAKSLLTAEQEADIEKN  626

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            +KKYSK++E  D+ +  +       +++   E W+ W+
Sbjct  627  IKKYSKRFEEIDEKIRNEADSNVASEKRATAEKWKKWV  664



>emb|CEG01790.1| Eukaryotic translation initiation factor 3 subunit B [Ostreococcus 
tauri]
Length=709

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + T+K K AN LFWSP GR +ILAGLK  NGQ EFFDVD ++TMA+ EHFMATD+EWDPT
Sbjct  503  IGTIKNKTANHLFWSPNGRVVILAGLKTMNGQFEFFDVDAMDTMASVEHFMATDVEWDPT  562

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GR+V TA+TSVH+MENG+++W+F+GKLLY+  KD FFQFLWRPR    L+ E+E +I KN
Sbjct  563  GRFVTTAVTSVHQMENGYHMWTFNGKLLYKYGKDRFFQFLWRPRGKSLLSPEQEADIEKN  622

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            +KKYSK++E  D+ +  +       +++  +E W +W+
Sbjct  623  IKKYSKRFEEIDEKIRNEADSSAASEKRIKEEKWRNWL  660



>ref|XP_002958408.1| eukaryotic translation initiation factor 3b [Volvox carteri f. 
nagariensis]
 gb|EFJ40558.1| eukaryotic translation initiation factor 3b [Volvox carteri f. 
nagariensis]
Length=699

 Score =   182 bits (462),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/165 (56%), Positives = 121/165 (73%), Gaps = 0/165 (0%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            +R   R+L  L  +  NA+ WSP GR I+LAGLK FNGQLEFF+VDE+ETMATAEHFMAT
Sbjct  487  SRLGVRELKLLDNRACNAISWSPQGRNIVLAGLKNFNGQLEFFNVDEMETMATAEHFMAT  546

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
            D+EWDPTGRYVAT ++ V +MENG N+WSF G+LLY   +D  +QF WRPR P  L  EK
Sbjct  547  DVEWDPTGRYVATIVSHVQQMENGVNVWSFAGRLLYSTQRDKLYQFSWRPRMPSLLPPEK  606

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            E EI KNLK+YSK+Y+ ED+ + +Q       +R++  +DW+ ++
Sbjct  607  EAEIAKNLKQYSKRYDEEDEQLIMQADADVLHERQRALDDWKVYV  651



>emb|CDY66663.1| BnaCnng51870D [Brassica napus]
Length=177

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = -2

Query  770  TRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMAT  591
            T G   KL TLK KQANALFWSP G+ +I+A   G NG+LEF+ VD L TMAT E+FMA 
Sbjct  3    TPGRVLKLVTLKAKQANALFWSPTGKHMIIAD--GLNGKLEFYIVDMLMTMATVENFMA-  59

Query  590  DIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRek  411
             I+WDPTGRYV T + S   ME+GF IWS +GKLLYR LK+  FQF  RPRPP  L+ +K
Sbjct  60   HIKWDPTGRYVVTVVASAV-MEDGFYIWSLYGKLLYRTLKELVFQFALRPRPPSLLSEQK  118

Query  410  eeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            E+E+ KNL+ Y ++YE ED++V   LS Q+ +KR+ ++E+WE W+N
Sbjct  119  EKEVKKNLRPYVERYEEEDKEVLDLLSRQEMEKRRVMEEEWEMWIN  164



>ref|XP_007514980.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15220.1| predicted protein [Bathycoccus prasinos]
Length=732

 Score =   182 bits (461),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 122/158 (77%), Gaps = 0/158 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            L TLK K AN LFWSP G  I+ AGLK  NGQ EFF+VDE+ETMAT EHFMATD+EWDPT
Sbjct  526  LKTLKSKTANHLFWSPNGSMIVFAGLKTMNGQFEFFNVDEMETMATCEHFMATDVEWDPT  585

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GR+V TA+T VH+MENG++IW+F+G+LLY+  ++ FFQFLWRPR    L++ +E +I KN
Sbjct  586  GRFVTTAVTGVHQMENGYHIWTFNGRLLYKQTRERFFQFLWRPRGKSLLSKAQEADIKKN  645

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            LKKYSKK+E ED+ +  Q +    + +++ KE WE+W+
Sbjct  646  LKKYSKKFEEEDEKIKNQQATMLDKAKQETKEKWEAWV  683



>gb|ABD98042.1| translation initiation factor [Striga asiatica]
Length=175

 Score =   171 bits (432),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G   KL TLKGKQANAL+WSPAGRFIILAGLKGFNGQLEF++V+ELETMA +EHFMATD+
Sbjct  83   GRVSKLITLKGKQANALYWSPAGRFIILAGLKGFNGQLEFYNVEELETMAQSEHFMATDV  142

Query  584  EWDPTGRYVATALTSVHEMENGFNIWSFHGKLL  486
            EWDPTGRYV TA+TSVHEMENGFN+WSF GKLL
Sbjct  143  EWDPTGRYVVTAVTSVHEMENGFNVWSFSGKLL  175



>ref|XP_005648006.1| eukaryotic initiation factor [Coccomyxa subellipsoidea C-169]
 gb|EIE23462.1| eukaryotic initiation factor [Coccomyxa subellipsoidea C-169]
Length=713

 Score =   181 bits (460),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + T  GKQAN + WSP G+F++L GLK  NGQLEFF  D+ E M  AEHFM T+IEWDPT
Sbjct  509  ITTQAGKQANCIHWSPQGKFLVLGGLKAMNGQLEFFSADDGEVMNAAEHFMCTNIEWDPT  568

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GRYVAT++T +H+MENGFNIW F+G LLYR+ +D FFQF WRPR P  L++E+E +++K 
Sbjct  569  GRYVATSVTHIHQMENGFNIWLFNGTLLYRVQRDQFFQFSWRPRAPTLLSKEQEADVVKR  628

Query  389  lkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            LK++SK+Y+ ED  +  +       +R+++ E+W+ W +
Sbjct  629  LKEFSKRYDEEDSKILEETDVAIVAERQRMMEEWKEWYD  667



>ref|XP_001691870.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
 gb|EDP04360.1| eukaryotic initiation factor [Chlamydomonas reinhardtii]
Length=718

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 118/160 (74%), Gaps = 0/160 (0%)
 Frame = -2

Query  755  RKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWD  576
            R+L  L+ +  NA+ WSP GR I+LAGLK FNGQLEFF+VDE+ETMATAEHFMATD+EWD
Sbjct  511  RELKMLESRACNAISWSPQGRIIVLAGLKNFNGQLEFFNVDEMETMATAEHFMATDVEWD  570

Query  575  PTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeil  396
            PTGRYVAT ++ V +MENG  IWSF G+ LY   +D  +QF WRPR P  L  EKE EI 
Sbjct  571  PTGRYVATVVSHVQQMENGVKIWSFGGRELYSSQRDKLYQFSWRPRMPSLLPAEKEAEIA  630

Query  395  knlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            KNLK+Y+K+Y+ ED+ +  Q      Q+R++  ++W+++ 
Sbjct  631  KNLKQYTKRYDEEDEQLLQQADADVLQERQRALDEWKAYC  670



>ref|XP_003083330.1| Translation initiation factor 3, subunit b (eIF-3b) (ISS), partial 
[Ostreococcus tauri]
Length=695

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            + T+K K AN LFWSP GR +ILAGLK  NGQ EFFDVD ++TMA+ EHFMATD+EWDPT
Sbjct  547  IGTIKNKTANHLFWSPNGRVVILAGLKTMNGQFEFFDVDAMDTMASVEHFMATDVEWDPT  606

Query  569  GRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilkn  390
            GR+V TA+TSVH+MENG++ W+F+GKLLY+  KD FFQFLWRPR    L+ E+E +I KN
Sbjct  607  GRFVTTAVTSVHQMENGYHKWTFNGKLLYKYGKDRFFQFLWRPRGKSLLSPEQEADIEKN  666

Query  389  lkKYSKKYEAEDQDV  345
            +KKYSK++E  D+ +
Sbjct  667  IKKYSKRFEEIDEKI  681



>ref|XP_010495540.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Camelina sativa]
Length=371

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -2

Query  602  FMATDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFL  423
            ++   IEWDPTGRYVATA+TSVHEMENGF IWSF+G LLYRILKDHFFQ  WRPRPP FL
Sbjct  211  YLDLPIEWDPTGRYVATAVTSVHEMENGFTIWSFNGNLLYRILKDHFFQLAWRPRPPSFL  270

Query  422  TRekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
            T EKE+EI KNLKKYSKKYEAEDQDVSL LSEQDR+KRK L E+WE W+
Sbjct  271  TAEKEDEIAKNLKKYSKKYEAEDQDVSLLLSEQDREKRKALNEEWEKWV  319



>gb|EEC67479.1| hypothetical protein OsI_34722 [Oryza sativa Indica Group]
Length=162

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  599  MATDIEWDPTGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            MATDI WDPTGRY+A+A+TSVHEMENGF IWSF GK LY++ KDHFFQFLWRPRPP  LT
Sbjct  1    MATDIMWDPTGRYLASAVTSVHEMENGFQIWSFSGKQLYKVSKDHFFQFLWRPRPPSLLT  60

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWM  276
             EKE+EI KNL+KYSKKYE EDQD   QLSEQ+R++RK+L+E+WE W+
Sbjct  61   PEKEDEIAKNLRKYSKKYEQEDQDAFNQLSEQERKRRKQLQEEWEGWV  108



>ref|XP_007136909.1| hypothetical protein PHAVU_009G0841001g, partial [Phaseolus vulgaris]
 gb|ESW08903.1| hypothetical protein PHAVU_009G0841001g, partial [Phaseolus vulgaris]
Length=150

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = -2

Query  563  YVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilknlk  384
            YVATA+TSVHEMENGFNIWSF+GK LYRILKDHFFQFLWRPRPP FL+ EKEEEI KNLK
Sbjct  1    YVATAVTSVHEMENGFNIWSFNGKHLYRILKDHFFQFLWRPRPPSFLSPEKEEEIAKNLK  60

Query  383  KYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            KYSKKYEAEDQDVSL LSEQ+R KR+ LKEDW+ W++
Sbjct  61   KYSKKYEAEDQDVSLLLSEQERDKRRMLKEDWDKWIH  97



>gb|ELT99648.1| hypothetical protein CAPTEDRAFT_163351 [Capitella teleta]
Length=704

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G    L TL+ +QAN LFWSP GRFI+LAGL+  +G LEF D  ++  MAT EHFMA+D+
Sbjct  490  GHVEHLNTLEKRQANHLFWSPNGRFIVLAGLRTMSGVLEFVDTLDMTVMATTEHFMASDV  549

Query  584  EWDPTGRYVATALTS-VHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVATA++   ++++N + +W+F GK+L++   + F Q LWRPRPP  LT E  
Sbjct  550  EWDPTGRYVATAVSYWAYKVDNAYWLWNFQGKILHKQQMEKFCQILWRPRPPSLLTPEHI  609

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             EI KN+KKY+ ++  ED+    ++S++  + RK + E+W +W
Sbjct  610  TEIKKNMKKYNARFAVEDKMRESKVSKEQIEARKLMNEEWNTW  652



>ref|XP_002595784.1| hypothetical protein BRAFLDRAFT_131352 [Branchiostoma floridae]
 gb|EEN51796.1| hypothetical protein BRAFLDRAFT_131352 [Branchiostoma floridae]
Length=697

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 114/163 (70%), Gaps = 1/163 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G+   L  L+ KQAN LFWSP G+F++LAGL+  NG LEF D +++  M  AEHFMATD+
Sbjct  484  GKVELLKCLEKKQANHLFWSPQGQFVVLAGLRSMNGALEFIDTNDMTVMNVAEHFMATDV  543

Query  584  EWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYV TA++   H+++N F +WSF G+LL++   D F Q LWRPRPP  LT  + 
Sbjct  544  EWDPTGRYVITAVSWWGHKVDNAFWLWSFQGRLLHKQNLDRFCQLLWRPRPPSPLTASQI  603

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            ++I KNLK+Y K++E +D+    + S++  +KR  L +D+E +
Sbjct  604  KKIKKNLKQYQKQFEIKDKMRMSKASKELVEKRHALMQDFEKY  646



>ref|XP_011398773.1| Eukaryotic translation initiation factor 3 subunit B [Auxenochlorella 
protothecoides]
 gb|KFM25877.1| Eukaryotic translation initiation factor 3 subunit B [Auxenochlorella 
protothecoides]
Length=688

 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 113/158 (72%), Gaps = 1/158 (1%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGF-NGQLEFFDVDELETMATAEHFMATDIEWDP  573
            L TL  KQA++L WSPAGRF++LAG K   NG +EF+D +++  ++  EH+MAT+++WDP
Sbjct  483  LHTLVNKQASSLHWSPAGRFLVLAGTKQTQNGLMEFWDTEDMSLLSAGEHYMATEVQWDP  542

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TGRY+ T + + +  +NG+ IWSF G+LLY++ ++ F+QF WRPRPP  L  EK++ ILK
Sbjct  543  TGRYLTTVVNAQNSTDNGYYIWSFAGQLLYKVERNRFYQFQWRPRPPTLLLAEKQKAILK  602

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            NLK YSKKY+ ED+ + +Q   +    R+K  E+W  W
Sbjct  603  NLKHYSKKYDEEDEAILMQADTEFLAAREKQMEEWREW  640



>ref|XP_005829927.1| translation initiation factor 3, subunit B [Guillardia theta 
CCMP2712]
 gb|EKX42947.1| translation initiation factor 3, subunit B [Guillardia theta 
CCMP2712]
Length=662

 Score =   150 bits (379),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 6/161 (4%)
 Frame = -2

Query  749  LATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPT  570
            L TL+ K  N LFWSP G  I+LAGLK  NG L F++VDE+E+M   EHF+ TD+ WDPT
Sbjct  458  LKTLEKKPVNELFWSPMGHHIVLAGLKNLNGMLNFYNVDEMESMNEDEHFLCTDLVWDPT  517

Query  569  GRYVATALTSVHE-MENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            GRYV T +++  + MENG+ IW+F G+   R  KD FFQFLWRPRPP  LT ++E+EI K
Sbjct  518  GRYVCTYVSAFRQPMENGYTIWNFAGRPQLRTAKDKFFQFLWRPRPPSLLTAKQEKEIRK  577

Query  392  nlkKYSKKYEAEDQDVSLQLSE----QDRQKRKKLKEDWES  282
             L +YS++Y  ED+    +L+E    ++R+ ++K  E+ E+
Sbjct  578  QLAEYSQRYTEEDRKAK-ELAETAHLREREAKRKTFEEGEA  617



>ref|XP_002930168.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ailuropoda melanoleuca]
Length=210

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = -2

Query  731  KQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPTGRYVAT  552
            +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+MA+D+EWDPTGRYV T
Sbjct  5    QQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVT  64

Query  551  ALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilknlkKYS  375
            +++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L++++ ++I K+LKKYS
Sbjct  65   SVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDLKKYS  124

Query  374  KKYEAEDQDVSLQLSEQDRQKRKKLKED  291
            K +E +D+    + S++  ++R+ + ED
Sbjct  125  KIFEQKDRLSQSKASKELVERRRTMMED  152



>ref|XP_011432969.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Crassostrea gigas]
 gb|EKC30771.1| Eukaryotic translation initiation factor 3 subunit B [Crassostrea 
gigas]
Length=701

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G+   + TL+ KQAN LFWSP G+FI+LAGL+  NG LEF D  ++  MA  EHFMATD+
Sbjct  489  GKVETIKTLERKQANHLFWSPTGQFIVLAGLRNMNGVLEFVDASDVTVMAQTEHFMATDV  548

Query  584  EWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWD TGRYV +A++   H+++NG+ IWSF G+LL +I  + F Q LWRPRPP  L+ E+ 
Sbjct  549  EWDSTGRYVVSAVSWWGHKVDNGYWIWSFQGRLLQKIQLERFCQLLWRPRPPSLLSLEQM  608

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
              I KN+KKY++++E  D+     +S +  +KR ++  +++S+
Sbjct  609  RAIKKNMKKYTEQFEVMDRLRQSNVSTEILEKRSEMMNEYKSF  651



>gb|KDD76724.1| eukaryotic translation initiation factor eIF2A [Helicosporidium 
sp. ATCC 50920]
Length=715

 Score =   146 bits (369),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 105/152 (69%), Gaps = 1/152 (1%)
 Frame = -2

Query  731  KQANALFWSPAGRFIILAGLK-GFNGQLEFFDVDELETMATAEHFMATDIEWDPTGRYVA  555
            KQA+ L WSP GR+++LAG K    G LEF+DVDE   ++  EHF  T + WDP+GRYVA
Sbjct  519  KQASTLAWSPQGRYLVLAGTKHTHGGVLEFWDVDEKALLSAGEHFGVTAVNWDPSGRYVA  578

Query  554  TALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilknlkKYS  375
            T + + + M+NGF +WSF G LLY+  +D FFQF WRPRPP  L+ E+  +I KNL++Y+
Sbjct  579  TIVDASNSMDNGFRVWSFAGALLYKFDRDRFFQFAWRPRPPTLLSNEQVADIQKNLRRYA  638

Query  374  KKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            K+YE ED+ + +    +   +R KL ++W++W
Sbjct  639  KRYEEEDEALLVAADSEFVAERNKLLDEWKTW  670



>dbj|BAK06071.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=227

 Score =   139 bits (350),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 10/108 (9%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TL G+QANALFWSPAGRFI+LAGLK  NGQ+EF+++D+LETMA AEH  ATD+ WDP
Sbjct  102  KLTTLNGRQANALFWSPAGRFIVLAGLKDRNGQMEFYNLDDLETMAVAEH-KATDVMWDP  160

Query  572  TGRYVATALTSVHEMEN---------GFNIWSFHGKLLYRILKDHFFQ  456
            TGR++AT +TSVHEM N         GF +WSF GK + ++ KD  +Q
Sbjct  161  TGRFLATVVTSVHEMGNGNSASEMGTGFQVWSFDGKQICKVSKDQLYQ  208



>gb|ELK28991.1| Eukaryotic translation initiation factor 3 subunit B [Myotis 
davidii]
Length=567

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  63   VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  122

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  123  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  182

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  183  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  229



>ref|XP_009045450.1| hypothetical protein LOTGIDRAFT_230249 [Lottia gigantea]
 gb|ESP03968.1| hypothetical protein LOTGIDRAFT_230249 [Lottia gigantea]
Length=703

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 113/163 (69%), Gaps = 1/163 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G+   L TL+ + AN LFWSP G+F++LAGL+  NG LEF D  ++ TM   EHFMATD+
Sbjct  489  GKVDLLKTLEKRVANHLFWSPTGQFLVLAGLRSMNGVLEFIDTTDMTTMNQTEHFMATDV  548

Query  584  EWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYV +A++   H+++N + IWSF G LL +   + F Q LWRPRPP  L+ +K 
Sbjct  549  EWDPTGRYVVSAVSWWGHKVDNAYWIWSFQGNLLTKQPLERFCQLLWRPRPPTLLSEKKL  608

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +EI KN+KKYS+++++ED       S++  +KR++L  ++E +
Sbjct  609  KEIKKNVKKYSQQFDSEDSQKRKTASKELLEKRQQLLTEFEDY  651



>ref|XP_006749739.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Leptonychotes weddellii]
Length=484

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  264  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  323

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  324  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  383

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKED  291
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED
Sbjct  384  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMED  426



>ref|XP_009029697.1| hypothetical protein HELRODRAFT_157973 [Helobdella robusta]
 gb|ESN92191.1| hypothetical protein HELRODRAFT_157973 [Helobdella robusta]
Length=694

 Score =   144 bits (362),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 107/163 (66%), Gaps = 1/163 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G    + T + K  N LFWSP G+FI+LAGL+  NG LEF D  ++  M  AEHFMATD+
Sbjct  479  GVVECIKTFEKKSVNHLFWSPNGQFIVLAGLRSMNGVLEFVDTQDMTVMTQAEHFMATDV  538

Query  584  EWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYVAT ++   H+++N F IW+F GK+L++   D + Q LWRPRPP  L+ E+ 
Sbjct  539  EWDPTGRYVATGVSWWGHKVDNAFWIWNFQGKILHKQTIDRYCQLLWRPRPPSLLSGEQI  598

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ KN+KKY+ ++  ED+    + S++   KR K   ++  W
Sbjct  599  KDLKKNMKKYNIQFSIEDKKRETKASKEQIDKRNKQLSEFNLW  641



>ref|XP_005698181.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Capra hircus]
Length=657

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  437  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  496

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  497  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  556

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  557  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  603



>ref|XP_006889671.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Elephantulus edwardii]
Length=542

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 111/163 (68%), Gaps = 1/163 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  322  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  381

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  382  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  441

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKED  291
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED
Sbjct  442  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMED  484



>ref|XP_003972378.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Takifugu rubripes]
Length=680

 Score =   143 bits (361),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   L     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELLKMFDKQQANSIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTLMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  LT
Sbjct  521  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPSLLT  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             ++ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  581  ADQIKMIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMEDYRRY  627



>gb|AAH07175.1| Eif3b protein, partial [Mus musculus]
Length=641

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  421  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  480

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  481  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  540

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  541  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  587



>ref|XP_006637297.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Lepisosteus oculatus]
Length=682

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 111/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  462  VKNNGKIELIKMFDKQQANSIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  521

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N F +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  522  ASDVEWDPTGRYVVTSVSWWSHKVDNAFWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  581

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  582  QEQIKLIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRTMMEDYRKY  628



>ref|XP_011376839.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Pteropus vampyrus]
Length=665

 Score =   142 bits (359),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  445  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  504

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  505  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  564

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  565  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  611



>ref|XP_007129565.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Physeter catodon]
Length=663

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  443  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  502

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  503  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  562

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  563  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  609



>gb|AAH09986.1| EIF3B protein, partial [Homo sapiens]
Length=622

 Score =   142 bits (358),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  402  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  461

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  462  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  521

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  522  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  568



>ref|XP_005883424.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Myotis brandtii]
Length=654

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  434  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  493

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  494  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  553

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  554  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  600



>ref|XP_008519592.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Equus przewalskii]
Length=684

 Score =   143 bits (360),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  464  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  523

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  524  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  583

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  584  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  630



>ref|XP_008048700.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tarsius syrichta]
Length=660

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  440  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  499

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  500  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  559

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  560  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  606



>gb|EPQ18395.1| Eukaryotic translation initiation factor 3 subunit B [Myotis 
brandtii]
Length=682

 Score =   142 bits (359),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  462  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  521

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  522  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  581

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  582  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  628



>ref|XP_007094914.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Panthera tigris altaica]
Length=664

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  444  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  503

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  504  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  563

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  564  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  610



>ref|XP_005340894.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Ictidomys tridecemlineatus]
Length=721

 Score =   143 bits (360),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  501  VKSNGKIELIKVFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  560

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  561  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  620

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  621  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  667



>ref|XP_005887389.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Bos mutus]
Length=674

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  454  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  513

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  514  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  573

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  574  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  620



>ref|XP_006915964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Pteropus alecto]
Length=684

 Score =   142 bits (359),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  464  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  523

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  524  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  583

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  584  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  630



>ref|XP_008696680.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ursus maritimus]
Length=660

 Score =   142 bits (358),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  440  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  499

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  500  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  559

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  560  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  606



>ref|XP_010830964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Bison bison bison]
Length=714

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  494  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  553

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  554  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  613

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  614  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  660



>ref|XP_005953850.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Pantholops hodgsonii]
Length=697

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  477  VKSNGKIELIKMFDKQQANTIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  536

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  537  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  596

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  597  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  643



>emb|CAF92736.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=630

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 111/169 (66%), Gaps = 1/169 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   L     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  411  VKNNGKIDLLKMFDKQQANSIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  470

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  471  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPSLLS  530

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
             ++ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  + +
Sbjct  531  ADQIKMIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMEDYRRYRD  579



>ref|XP_006108329.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Myotis lucifugus]
Length=700

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  480  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  539

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  540  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  599

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  600  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  646



>ref|XP_006796258.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Neolamprologus brichardi]
Length=532

 Score =   141 bits (355),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  313  VKNNGKIELIKMFDKQQANSIFWSPQGQFMVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  372

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  373  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  432

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             E+ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  433  IEQIKMIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMEDYRRY  479



>ref|XP_007467476.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Lipotes vexillifer]
Length=732

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  512  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  571

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  572  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  631

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  632  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  678



>ref|XP_004440982.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ceratotherium simum simum]
Length=720

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  500  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  559

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  560  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  619

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  620  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  666



>ref|XP_004066017.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Oryzias latipes]
Length=681

 Score =   142 bits (358),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  462  VKNNGKIELIKMFDKQQANSIFWSPQGQFMVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  521

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  522  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWVWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  581

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             ++ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  582  ADQIKMIKKDLKKYSKTFEQKDRLSQSKASKELVDKRRTMLEDYRRY  628



>ref|XP_006046081.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Bubalus bubalis]
Length=837

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  617  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  676

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  677  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  736

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  737  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  783



>dbj|BAG63448.1| unnamed protein product [Homo sapiens]
Length=661

 Score =   142 bits (357),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  441  VKNNGKIELIKMFDKQQANIIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  500

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  501  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  560

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  561  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  607



>ref|XP_006765559.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Myotis davidii]
Length=743

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  523  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  582

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  583  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  642

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  643  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  689



>ref|XP_007174714.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Balaenoptera acutorostrata scammoni]
Length=694

 Score =   142 bits (358),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  474  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  533

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  534  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  593

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  594  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  640



>ref|XP_005080033.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Mesocricetus auratus]
Length=800

 Score =   143 bits (360),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  580  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  639

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  640  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  699

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  700  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  746



>ref|XP_005615263.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3, subunit B [Equus caballus]
Length=742

 Score =   142 bits (359),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  522  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  581

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  582  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  641

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  642  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  688



>ref|XP_008971434.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pan paniscus]
Length=726

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  499  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  558

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  559  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  618

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  619  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  665



>ref|XP_008154277.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Eptesicus fuscus]
Length=738

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  518  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  577

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  578  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  637

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  638  QDQIKQIRKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  684



>ref|XP_006113006.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Pelodiscus sinensis]
Length=734

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   + T   +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+ 
Sbjct  514  VKNNGKIELIKTFDKQQANTIFWSPQGQFLVLAGLRSMNGALTFVDTSDCTVMNIAEHYT  573

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  574  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  633

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LK+YSK +E +D+    + S++  +KR+ + ED++ +
Sbjct  634  QDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVEKRRTMMEDFKKY  680



>ref|XP_003496346.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Cricetulus griseus]
Length=801

 Score =   142 bits (359),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  581  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  640

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  641  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  700

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  701  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  747



>ref|XP_011288807.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Felis catus]
Length=709

 Score =   142 bits (358),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  489  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  548

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  549  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  608

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  609  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  655



>gb|ERE76540.1| eukaryotic translation initiation factor 3 subunit B [Cricetulus 
griseus]
Length=801

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  581  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  640

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  641  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  700

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  701  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  747



>ref|XP_007631404.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Cricetulus griseus]
Length=768

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  548  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  607

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  608  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  667

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  668  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  714



>ref|XP_004892431.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Heterocephalus glaber]
Length=724

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  504  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  563

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  564  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  623

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K LK+YSK +E  D+    + S++  ++R+ + ED+  +
Sbjct  624  QEQIKQIKKELKRYSKIFEQNDRLSQSKASKELVERRRTMMEDFRKY  670



>ref|XP_005368038.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Microtus ochrogaster]
Length=802

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  582  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  641

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  642  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  701

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  702  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  748



>ref|XP_004672764.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Jaculus jaculus]
Length=812

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  592  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  651

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  652  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  711

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  712  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFREY  758



>ref|NP_001026810.1| eukaryotic translation initiation factor 3 subunit B [Rattus 
norvegicus]
 sp|Q4G061.1|EIF3B_RAT RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=eIF-3-eta [Rattus 
norvegicus]
 gb|AAH98728.1| Eukaryotic translation initiation factor 3, subunit 9 (eta) [Rattus 
norvegicus]
 gb|EDL89734.1| eukaryotic translation initiation factor 3, subunit 9 (eta) [Rattus 
norvegicus]
Length=797

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  577  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  636

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  637  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  696

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  697  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  743



>ref|XP_010594562.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Loxodonta africana]
Length=772

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  552  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  611

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  612  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  671

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  672  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  718



>ref|XP_008849626.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Nannospalax galili]
Length=793

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  573  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  632

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  633  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  692

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  693  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  739



>ref|NP_598677.1| eukaryotic translation initiation factor 3 subunit B [Mus musculus]
 sp|Q8JZQ9.1|EIF3B_MOUSE RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=eIF-3-eta; AltName: 
Full=eIF3 p116 [Mus musculus]
 gb|AAH31704.1| Eukaryotic translation initiation factor 3, subunit B [Mus musculus]
 dbj|BAC28445.1| unnamed protein product [Mus musculus]
 dbj|BAE39671.1| unnamed protein product [Mus musculus]
 dbj|BAE42128.1| unnamed protein product [Mus musculus]
 gb|EDL19120.1| eukaryotic translation initiation factor 3, subunit 9 (eta) [Mus 
musculus]
Length=803

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  583  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  642

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  643  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  702

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  703  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  749



>dbj|BAG62591.1| unnamed protein product [Homo sapiens]
Length=738

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  518  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  577

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  578  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  637

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  638  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  684



>ref|XP_007525166.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Erinaceus europaeus]
Length=744

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  524  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  583

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  584  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  643

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  644  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  690



>ref|XP_004617310.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Sorex araneus]
Length=766

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  546  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  605

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  606  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  665

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  666  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  712



>ref|XP_003456022.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Oreochromis niloticus]
Length=680

 Score =   141 bits (356),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELIKMFDKQQANSIFWSPQGQFMVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  521  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             E+ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  581  AEQIKMIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMEDYRRY  627



>ref|XP_002736509.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Saccoglossus kowalevskii]
Length=696

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            +VT+G+      +  K AN +FWSP G+FI+LAGL+  +G LEF D  +   M +AEHFM
Sbjct  478  LVTKGKVELQKVMDKKVANHIFWSPNGQFIVLAGLRSMSGALEFIDTSDYTLMNSAEHFM  537

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            ATD++WDPTGRYV + +    H+++N + +WSF G+LL++   D F Q LWRPRPP  L+
Sbjct  538  ATDLKWDPTGRYVVSGVRWWGHKVDNAYWVWSFQGRLLHKQTLDRFCQLLWRPRPPTLLS  597

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            + K  EI KN+K Y+K++E +D+    + S++  +KR +L E++  +
Sbjct  598  QNKLREIKKNMKSYNKQFELKDRMSQSKASKELIEKRHQLMEEFRKY  644



>ref|XP_006990812.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Peromyscus maniculatus bairdii]
Length=801

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  581  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  640

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  641  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  700

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  701  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  747



>ref|XP_003416544.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Loxodonta africana]
Length=812

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  592  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  651

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  652  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  711

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  712  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  758



>ref|XP_010641158.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Fukomys damarensis]
Length=752

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  532  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  591

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  592  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  651

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  652  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  698



>ref|XP_007467475.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Lipotes vexillifer]
Length=777

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  557  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  616

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  617  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  676

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  677  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  723



>ref|XP_008564978.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Galeopterus variegatus]
Length=748

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  528  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  587

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  588  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  647

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  648  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  694



>ref|XP_004385981.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Trichechus manatus latirostris]
Length=810

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  590  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  649

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  650  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  709

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  710  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  756



>ref|XP_006210499.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Vicugna pacos]
Length=732

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+         +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  512  VKSNGKIELTKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  571

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  572  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPSLLS  631

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  632  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  678



>ref|NP_001095826.1| eukaryotic translation initiation factor 3 subunit B [Bos taurus]
 sp|A7MB16.1|EIF3B_BOVIN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=eIF-3-eta [Bos taurus]
 gb|AAI51285.1| EIF3B protein [Bos taurus]
 tpg|DAA15122.1| TPA: eukaryotic translation initiation factor 3 subunit B [Bos 
taurus]
Length=786

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  566  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  625

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  626  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  685

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  686  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  732



>ref|XP_004394188.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Odobenus rosmarus divergens]
Length=785

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  565  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  624

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  625  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  684

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  685  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  731



>ref|XP_005549077.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Macaca fascicularis]
Length=775

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  555  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  614

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  615  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  674

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  675  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  721



>ref|XP_004459096.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Dasypus novemcinctus]
Length=824

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  604  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  663

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  664  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  723

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  724  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  770



>ref|XP_005397937.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Chinchilla lanigera]
Length=791

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  571  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  630

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  631  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  690

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  691  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  737



>ref|XP_006859850.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Chrysochloris asiatica]
Length=810

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  590  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  649

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  650  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  709

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  710  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  756



>gb|EAL23952.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa 
[Homo sapiens]
 gb|EAW87238.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_b [Homo sapiens]
Length=775

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  555  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  614

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  615  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  674

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  675  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  721



>ref|XP_536894.3| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform 1 [Canis lupus familiaris]
Length=813

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  593  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  652

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  653  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  712

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  713  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  759



>ref|XP_008282630.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Stegastes partitus]
Length=680

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELIKMFDKQQANSIFWSPQGQFMVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  521  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             ++ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  581  VDQIKMIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMEDYRRY  627



>ref|XP_003470101.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cavia porcellus]
Length=791

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  571  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  630

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  631  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  690

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  691  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  737



>ref|XP_004688115.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Condylura cristata]
Length=789

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  569  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  628

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  629  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  688

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  689  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  735



>ref|XP_007939402.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Orycteropus afer afer]
Length=812

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  592  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  651

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  652  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  711

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  712  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  758



>ref|XP_006167965.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Tupaia chinensis]
Length=791

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  571  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  630

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  631  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  690

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  691  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  737



>ref|XP_006173591.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Camelus ferus]
Length=818

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+         +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  598  VKSNGKIELTKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  657

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  658  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPSLLS  717

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  718  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  764



>ref|XP_004840481.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Heterocephalus glaber]
Length=791

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  571  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  630

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  631  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  690

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K LK+YSK +E  D+    + S++  ++R+ + ED+  +
Sbjct  691  QEQIKQIKKELKRYSKIFEQNDRLSQSKASKELVERRRTMMEDFRKY  737



>ref|XP_003470094.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Cavia porcellus]
Length=792

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  572  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  631

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  632  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  691

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  692  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  738



>gb|AAH23767.1| Eif3b protein [Mus musculus]
 gb|AAH51065.1| Eif3b protein [Mus musculus]
Length=970

 Score =   142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 113/167 (68%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  583  VKSNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  642

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  643  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  702

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  703  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRQY  749



>ref|XP_009200773.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Papio anubis]
Length=806

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  528  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  587

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  588  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  647

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  648  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  694



>ref|NP_003742.2| eukaryotic translation initiation factor 3 subunit B [Homo sapiens]
 ref|NP_001032360.1| eukaryotic translation initiation factor 3 subunit B [Homo sapiens]
 sp|P55884.3|EIF3B_HUMAN RecName: Full=Eukaryotic translation initiation factor 3 subunit 
B; Short=eIF3b; AltName: Full=Eukaryotic translation initiation 
factor 3 subunit 9; AltName: Full=Prt1 homolog; Short=hPrt1; 
AltName: Full=eIF-3-eta; AltName: Full=eIF3 p110; AltName: 
Full=eIF3 p116 [Homo sapiens]
 gb|EAL23951.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa 
[Homo sapiens]
 gb|EAW87237.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
 gb|EAW87240.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
 gb|EAW87241.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_a [Homo sapiens]
Length=814

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>ref|XP_004776427.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Mustela putorius furo]
Length=778

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  558  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  617

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  618  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  677

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  678  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  724



>ref|XP_004045092.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Gorilla gorilla gorilla]
Length=874

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  595  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  654

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  655  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  714

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  715  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  761



>ref|XP_004815751.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Mustela putorius furo]
Length=791

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  571  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  630

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  631  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  690

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  691  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  737



>ref|XP_010364964.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Rhinopithecus roxellana]
Length=814

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>gb|AAC99479.1| eukaryotic translation initiation factor [Homo sapiens]
 gb|AAH01173.1| EIF3B protein [Homo sapiens]
 gb|AAI10866.1| Eukaryotic translation initiation factor 3, subunit B [Homo sapiens]
Length=814

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>ref|XP_004269024.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Orcinus orca]
Length=786

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  566  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  625

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  626  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  685

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  686  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  732



>ref|XP_004320350.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Tursiops truncatus]
Length=792

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  572  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  631

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  632  ASDVEWDPTGRYVITSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLS  691

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  692  QDQVKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  738



>gb|EAW87239.1| eukaryotic translation initiation factor 3, subunit 9 eta, 116kDa, 
isoform CRA_c, partial [Homo sapiens]
Length=819

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  599  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  658

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  659  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  718

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  719  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  765



>ref|XP_003761584.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Sarcophilus harrisii]
Length=831

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  611  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  670

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  671  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  730

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LK+YSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  731  QDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  777



>ref|XP_002744483.2| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Callithrix jacchus]
Length=852

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  632  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  691

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  692  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  751

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  752  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  798



>ref|XP_010329908.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Saimiri boliviensis boliviensis]
Length=911

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  691  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  750

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  751  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  810

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  811  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  857



>ref|XP_010997888.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B, partial [Camelus dromedarius]
Length=780

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+         +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  560  VKSNGKIELTKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  619

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  620  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPSLLS  679

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  680  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  726



>ref|XP_003318263.2| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pan troglodytes]
Length=873

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>ref|XP_008017159.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Chlorocebus sabaeus]
Length=813

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  593  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  652

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  653  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  712

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  713  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  759



>ref|XP_004568396.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Maylandia zebra]
 ref|XP_005929352.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Haplochromis burtoni]
Length=680

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELIKMFDKQQANSIFWSPQGQFMVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  521  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             E+ + I K+LKKYSK +E +D+    + S+    KR+ + ED+  +
Sbjct  581  TEQIKMIKKDLKKYSKIFEQKDRLSQSKASKDLVDKRRAMMEDYRRY  627



>ref|XP_001086876.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B-like [Macaca mulatta]
Length=814

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>gb|AAB42010.1| Prt1 homolog [Homo sapiens]
Length=873

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>ref|XP_010964806.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Camelus bactrianus]
Length=787

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V + G+         +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  567  VKSNGKIELTKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  626

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  627  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPSLLS  686

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  687  QDQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  733



>gb|KHN29644.1| Eukaryotic translation initiation factor 3 subunit B, partial 
[Glycine soja]
Length=366

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 98/160 (61%), Gaps = 42/160 (26%)
 Frame = -2

Query  752  KLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDP  573
            KL TLKGKQAN+ FWS  G F++LAGLKG NGQLEF++VDELETMA AEHFMAT +EWDP
Sbjct  246  KLTTLKGKQANSFFWSHVGCFVVLAGLKGLNGQLEFYNVDELETMAMAEHFMATSVEWDP  305

Query  572  TGRYVATALTSVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilk  393
            TG                                          RPP  L+ EKEEE+ K
Sbjct  306  TG------------------------------------------RPPSPLSPEKEEEMSK  323

Query  392  nlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESWMN  273
            NLKKYSKKYEAEDQDVS+ L EQDR KR+ LK++    MN
Sbjct  324  NLKKYSKKYEAEDQDVSMLLREQDRNKRRMLKKNGRDCMN  363



>gb|KFM63204.1| Eukaryotic translation initiation factor 3 subunit B, partial 
[Stegodyphus mimosarum]
Length=708

 Score =   141 bits (355),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 111/162 (69%), Gaps = 1/162 (1%)
 Frame = -2

Query  764  GEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDI  585
            G    L   + KQ N LFWSP G+FI+LAGL+  +G LEF D  +   MA ++HFMATDI
Sbjct  493  GTVSLLKKFERKQCNRLFWSPNGQFIVLAGLRTMSGSLEFIDTSDFTVMAQSDHFMATDI  552

Query  584  EWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTReke  408
            EWDPTGRYV + ++  +H+++N F +W+F GKLL +   + F Q LWRPRPP  L+ EK 
Sbjct  553  EWDPTGRYVVSGISWWMHKVDNAFWLWTFQGKLLRKNDLERFCQLLWRPRPPTLLSEEKI  612

Query  407  eeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWES  282
            +EI KNLKKYS +++ +D+    + S++  +KR+KL +++ S
Sbjct  613  KEIKKNLKKYSAQFDIKDRMTLSKASKEIVEKRRKLMDEFRS  654



>ref|XP_007498394.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Monodelphis domestica]
Length=836

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  616  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  675

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  676  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  735

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +++ ++I K+LK+YSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  736  QDQIKQIKKDLKRYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  782



>ref|XP_005549076.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Macaca fascicularis]
Length=814

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  594  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  653

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  654  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  713

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  714  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  760



>ref|XP_008314516.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Cynoglossus semilaevis]
Length=680

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 109/167 (65%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+         +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELQKMFDKQQANSIFWSPQGQFLVLAGLRSLNGALAFVDTSDCTLMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  521  ASDVEWDPTGRYVVTSVSWGSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPSLLS  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             E+ + I K+LKKYSK +E +D+    + S++   KR+ + +D+  +
Sbjct  581  SEQIKNIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRAMMDDYRRY  627



>ref|XP_009240769.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Pongo abelii]
Length=879

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  600  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  659

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  660  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  719

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  720  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  766



>ref|XP_010742912.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X1 [Larimichthys crocea]
 ref|XP_010742913.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B isoform X2 [Larimichthys crocea]
Length=680

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN++FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  461  VKNNGKIELIKMFDKQQANSIFWSPQGQFLVLAGLRSMNGALAFVDTSDCTMMNIAEHYM  520

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  521  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  580

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
             ++ + I K+LKKYSK +E +D+    + S++   KR+ + ED+  +
Sbjct  581  GDQIKLIKKDLKKYSKIFEQKDRLSQSKASKELVDKRRSMMEDYRRY  627



>ref|XP_003795497.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Otolemur garnettii]
Length=816

 Score =   141 bits (356),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  596  VKNNGKIELIRMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  655

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  656  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  715

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  716  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  762



>ref|XP_003278760.2| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 3 subunit B [Nomascus leucogenys]
Length=882

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 112/167 (67%), Gaps = 1/167 (1%)
 Frame = -2

Query  776  VVTRGEFRKLATLKGKQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFM  597
            V   G+   +     +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+M
Sbjct  603  VKNNGKIELIKMFDKQQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYM  662

Query  596  ATDIEWDPTGRYVATALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLT  420
            A+D+EWDPTGRYV T+++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L+
Sbjct  663  ASDVEWDPTGRYVVTSVSWWSHKVDNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLS  722

Query  419  RekeeeilknlkKYSKKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            +E+ ++I K+LKKYSK +E +D+    + S++  ++R+ + ED+  +
Sbjct  723  QEQIKQIKKDLKKYSKIFEQKDRLSQSKASKELVERRRTMMEDFRKY  769



>ref|XP_004598208.1| PREDICTED: eukaryotic translation initiation factor 3 subunit 
B [Ochotona princeps]
Length=736

 Score =   140 bits (354),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 108/152 (71%), Gaps = 1/152 (1%)
 Frame = -2

Query  731  KQANALFWSPAGRFIILAGLKGFNGQLEFFDVDELETMATAEHFMATDIEWDPTGRYVAT  552
            +QAN +FWSP G+F++LAGL+  NG L F D  +   M  AEH+MA+D+EWDPTGRYV T
Sbjct  531  QQANTIFWSPQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVT  590

Query  551  ALT-SVHEMENGFNIWSFHGKLLYRILKDHFFQFLWRPRPPPFLTRekeeeilknlkKYS  375
            +++   H+++N + +W+F G+LL +  KD F Q LWRPRPP  L++E+ ++I K+LKKYS
Sbjct  591  SVSWWSHKVDNAYWLWTFQGRLLQKNSKDRFCQLLWRPRPPTLLSQEQIKQIKKDLKKYS  650

Query  374  KKYEAEDQDVSLQLSEQDRQKRKKLKEDWESW  279
            K +E +D+    + S++  ++R+ + ED+  +
Sbjct  651  KIFEQKDRLSQSKASKELVERRRAMMEDFRKY  682



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1534440539150