BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030N19

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613740.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    142   1e-35   Nicotiana tomentosiformis
ref|XP_009613739.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    142   2e-35   Nicotiana tomentosiformis
ref|XP_009798364.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    137   6e-34   Nicotiana sylvestris
ref|XP_009798365.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    137   7e-34   Nicotiana sylvestris
ref|XP_006344463.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    137   1e-33   Solanum tuberosum [potatoes]
ref|XP_004236257.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    136   2e-33   Solanum lycopersicum
ref|XP_010663103.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    134   2e-32   Vitis vinifera
emb|CBI14963.3|  unnamed protein product                                133   2e-32   Vitis vinifera
ref|XP_002511330.1|  ferric-chelate reductase, putative                 133   2e-32   
ref|XP_011046222.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    128   2e-30   Populus euphratica
gb|KDP31036.1|  hypothetical protein JCGZ_11412                         127   3e-30   Jatropha curcas
gb|ADR70889.1|  ferric reductase oxidase                                127   4e-30   Manihot esculenta [manioc]
ref|XP_002321628.1|  ferric reductase-like transmembrane componen...    124   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010102484.1|  Ferric reduction oxidase 8                         123   1e-28   Morus notabilis
ref|XP_008239582.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    121   4e-28   
ref|XP_007210738.1|  hypothetical protein PRUPE_ppa021696mg             120   1e-27   
ref|XP_011047810.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    120   2e-27   Populus euphratica
ref|XP_007155475.1|  hypothetical protein PHAVU_003G204400g             119   3e-27   Phaseolus vulgaris [French bean]
gb|KEH31789.1|  oxidoreductase/ferric-chelate reductase                 114   1e-25   Medicago truncatula
ref|XP_011072176.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    114   1e-25   
emb|CDP12742.1|  unnamed protein product                                112   5e-25   Coffea canephora [robusta coffee]
ref|XP_003549599.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    112   8e-25   Glycine max [soybeans]
gb|KEH31790.1|  oxidoreductase/ferric-chelate reductase                 110   1e-24   Medicago truncatula
ref|XP_011464152.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    110   3e-24   Fragaria vesca subsp. vesca
gb|EYU22175.1|  hypothetical protein MIMGU_mgv1a002211mg                109   7e-24   Erythranthe guttata [common monkey flower]
ref|XP_004515872.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    108   2e-23   
ref|XP_008373357.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    107   3e-23   
ref|XP_002318065.1|  ferric reductase-like transmembrane componen...    104   4e-22   
ref|XP_010037520.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    103   1e-21   Eucalyptus grandis [rose gum]
ref|XP_010037521.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    103   1e-21   Eucalyptus grandis [rose gum]
ref|XP_010248638.1|  PREDICTED: ferric reduction oxidase 8, mitoc...    101   3e-21   Nelumbo nucifera [Indian lotus]
gb|KDO69499.1|  hypothetical protein CISIN_1g005126mg                 97.8    3e-20   Citrus sinensis [apfelsine]
gb|KDO69498.1|  hypothetical protein CISIN_1g005126mg                 97.4    8e-20   Citrus sinensis [apfelsine]
gb|KDO69496.1|  hypothetical protein CISIN_1g005126mg                 97.4    1e-19   Citrus sinensis [apfelsine]
ref|XP_006476874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  97.4    1e-19   Citrus sinensis [apfelsine]
ref|XP_006439912.1|  hypothetical protein CICLE_v10019061mg           97.4    1e-19   Citrus clementina [clementine]
gb|KDO69497.1|  hypothetical protein CISIN_1g005126mg                 97.4    1e-19   Citrus sinensis [apfelsine]
gb|KJB59689.1|  hypothetical protein B456_009G267500                  97.1    2e-19   Gossypium raimondii
gb|KJB59688.1|  hypothetical protein B456_009G267500                  97.1    2e-19   Gossypium raimondii
ref|XP_010678863.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  96.3    2e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG18909.1|  Ferric reduction oxidase 8, mitochondrial -like p...  96.3    2e-19   Gossypium arboreum [tree cotton]
ref|XP_010678862.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  96.3    3e-19   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007036323.1|  Ferric reduction oxidase 8 isoform 3             92.8    2e-18   
ref|XP_007036322.1|  Ferric reduction oxidase 8 isoform 2             92.4    4e-18   
ref|XP_008459874.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  92.8    4e-18   
ref|XP_007036321.1|  Ferric reduction oxidase 8 isoform 1             92.4    5e-18   
ref|XP_008373358.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  91.7    9e-18   
ref|XP_007215241.1|  hypothetical protein PRUPE_ppa014585mg           90.5    2e-17   
ref|XP_004168892.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  90.5    3e-17   
ref|XP_004140645.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  90.5    3e-17   
gb|KGN46442.1|  hypothetical protein Csa_6G093620                     89.7    4e-17   Cucumis sativus [cucumbers]
ref|XP_010533458.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  87.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_010533455.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  87.8    2e-16   Tarenaya hassleriana [spider flower]
ref|XP_009613741.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  87.0    4e-16   
ref|XP_010906716.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  85.1    2e-15   Elaeis guineensis
ref|XP_009798366.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  84.3    3e-15   Nicotiana sylvestris
ref|XP_007036377.1|  Uncharacterized protein TCM_012218               79.7    6e-15   
ref|XP_008777197.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  83.2    6e-15   Phoenix dactylifera
ref|XP_006402177.1|  hypothetical protein EUTSA_v10012790mg           81.6    2e-14   Eutrema salsugineum [saltwater cress]
emb|CDY12264.1|  BnaA09g24640D                                        81.3    3e-14   Brassica napus [oilseed rape]
ref|XP_009114915.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  78.2    3e-13   Brassica rapa
ref|XP_009114914.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  78.2    3e-13   Brassica rapa
ref|XP_010255195.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  75.5    1e-12   
ref|XP_002864039.1|  ATFRO8/FRO8                                      76.3    1e-12   Arabidopsis lyrata subsp. lyrata
emb|CDY22585.1|  BnaC05g24230D                                        75.5    3e-12   Brassica napus [oilseed rape]
ref|XP_009406362.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  74.3    7e-12   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK26648.1|  hypothetical protein AALP_AA8G275500                  72.8    2e-11   Arabis alpina [alpine rockcress]
ref|XP_010442496.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  71.2    6e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010442495.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  71.2    6e-11   Camelina sativa [gold-of-pleasure]
dbj|BAB09387.1|  FRO1 and FRO2-like protein                           70.1    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199827.2|  ferric reduction oxidase 8                          70.1    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482321.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  70.1    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010482319.1|  PREDICTED: ferric reduction oxidase 8, mitoc...  70.1    2e-10   Camelina sativa [gold-of-pleasure]
ref|XP_006280085.1|  hypothetical protein CARUB_v10025968mg           65.9    3e-09   Capsella rubella
ref|XP_006852345.1|  hypothetical protein AMTR_s00049p00212370        60.5    2e-07   
ref|XP_001762405.1|  ferric reductase-like transmembrane component    57.0    3e-06   
ref|XP_002986459.1|  hypothetical protein SELMODRAFT_425399           56.2    4e-06   
ref|XP_010477584.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  54.7    2e-05   Camelina sativa [gold-of-pleasure]
gb|AAB72168.1|  unknown                                               54.3    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173715.2|  ferric reduction oxidase 3                          54.3    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185067.1|  ferric reduction oxidase 3                       53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460078.1|  PREDICTED: ferric reduction oxidase 3, mitoc...  53.1    5e-05   
ref|XP_002968520.1|  hypothetical protein SELMODRAFT_145556           52.4    8e-05   
gb|KHN34351.1|  Ferric reduction oxidase 8, mitochondrial             52.4    8e-05   Glycine soja [wild soybean]
ref|XP_010105755.1|  Ferric reduction oxidase 4                       52.4    9e-05   
ref|XP_009375514.1|  PREDICTED: ferric reduction oxidase 4-like       51.6    1e-04   Pyrus x bretschneideri [bai li]
ref|XP_002968519.1|  hypothetical protein SELMODRAFT_440376           51.6    2e-04   Selaginella moellendorffii
ref|XP_002975965.1|  hypothetical protein SELMODRAFT_416159           51.6    2e-04   
emb|CAN79355.1|  hypothetical protein VITISV_010064                   51.2    2e-04   Vitis vinifera
ref|XP_002967602.1|  hypothetical protein SELMODRAFT_10731            50.4    4e-04   
gb|AIE44287.1|  ferric reduction oxidase 6                            47.8    7e-04   Ostryopsis davidiana
ref|XP_010456303.1|  PREDICTED: ferric reduction oxidase 2-like       49.7    8e-04   
gb|AIE44289.1|  ferric reduction oxidase 6                            47.4    0.001   Ostryopsis davidiana



>ref|XP_009613740.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
Length=700

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKS++ +T SS++DL L+CSFA+AL+   L+A + RWK L +++ P ++KE   +KP  T
Sbjct  563  KKSAEQKTASSIVDLLLICSFALALISSTLVATLWRWKRLSEEIPPFSEKERKPMKP--T  620

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E+N   DQ  EIHFGARPNF+DIF++F NES+GS  GVF+CGPE+MKESVA+ C   SQ 
Sbjct  621  ESNRGFDQH-EIHFGARPNFKDIFSQFANESKGSNIGVFVCGPETMKESVAITCHQYSQT  679

Query  249  CK  244
             +
Sbjct  680  SQ  681



>ref|XP_009613739.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=703

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKS++ +T SS++DL L+CSFA+AL+   L+A + RWK L +++ P ++KE   +KP  T
Sbjct  566  KKSAEQKTASSIVDLLLICSFALALISSTLVATLWRWKRLSEEIPPFSEKERKPMKP--T  623

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E+N   DQ  EIHFGARPNF+DIF++F NES+GS  GVF+CGPE+MKESVA+ C   SQ 
Sbjct  624  ESNRGFDQH-EIHFGARPNFKDIFSQFANESKGSNIGVFVCGPETMKESVAITCHQYSQT  682

Query  249  CK  244
             +
Sbjct  683  SQ  684



>ref|XP_009798364.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Nicotiana sylvestris]
Length=703

 Score =   137 bits (346),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKSS+ +T SS++D+ L+CSFA+AL+   L+A + RWK L +++ P ++ E   +KP  T
Sbjct  566  KKSSEQKTASSIVDVLLICSFALALISSTLVATLWRWKRLSEEIPPFSETERKPMKP--T  623

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            E N   DQ  EIHFGARPNF+DIF++F NES+GS  GVF+CGPE+MKES A  C   SQ
Sbjct  624  EANKGFDQH-EIHFGARPNFKDIFSQFANESKGSNIGVFVCGPETMKESAATTCHQYSQ  681



>ref|XP_009798365.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Nicotiana sylvestris]
Length=700

 Score =   137 bits (346),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 64/119 (54%), Positives = 86/119 (72%), Gaps = 3/119 (3%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKSS+ +T SS++D+ L+CSFA+AL+   L+A + RWK L +++ P ++ E   +KP  T
Sbjct  563  KKSSEQKTASSIVDVLLICSFALALISSTLVATLWRWKRLSEEIPPFSETERKPMKP--T  620

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            E N   DQ  EIHFGARPNF+DIF++F NES+GS  GVF+CGPE+MKES A  C   SQ
Sbjct  621  EANKGFDQH-EIHFGARPNFKDIFSQFANESKGSNIGVFVCGPETMKESAATTCHQYSQ  678



>ref|XP_006344463.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Solanum 
tuberosum]
Length=699

 Score =   137 bits (344),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 64/120 (53%), Positives = 88/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKSS+ +T +SV+D+ L+CSF +AL+   L+A + RWK LR+++   ++KES A+KP  T
Sbjct  562  KKSSEQKTATSVVDILLICSFTLALISGTLVATIWRWKRLREEIPSFSEKESKAMKP--T  619

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
              N   DQ  EIH+GARPNF+DIF++  NES+GS  GVF+CGPE++KESVA  CQL S  
Sbjct  620  GANRVFDQH-EIHYGARPNFKDIFSQLANESKGSNIGVFVCGPETLKESVATTCQLISNG  678



>ref|XP_004236257.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Solanum 
lycopersicum]
Length=699

 Score =   136 bits (342),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 3/120 (3%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKS + +T +SV+D+ L+CSFA+AL+   L+A + RWK LR++    ++KES A+KP  T
Sbjct  562  KKSPEQKTATSVVDILLICSFALALISGTLVATIWRWKRLREETPSFSEKESKAMKP--T  619

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
              N   DQ  EIH+GARPNF+DIF++  NES+GS  GVF+CGPE++KESVA  CQL S  
Sbjct  620  GANRVYDQH-EIHYGARPNFKDIFSQLANESKGSSIGVFVCGPETLKESVATTCQLLSNG  678



>ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera]
Length=725

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            KSSK+++PS V D+ L+CSF +A+LC  ++A V RW+ LR+++ P++ KE  A K  L +
Sbjct  586  KSSKEKSPSWVADILLICSFIIAILCSTIVAIVLRWRKLRREIPPVSQKEGKA-KEGLMD  644

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQAC  247
            T  +  +E EIHFG RPNFQDIF++F  E+RGS  GV +CGPE+MKESVA  C  +SQ C
Sbjct  645  TRGTALEEHEIHFGGRPNFQDIFSKFPKETRGSNIGVLVCGPETMKESVASICSQTSQCC  704

Query  246  K  244
             
Sbjct  705  N  705



>emb|CBI14963.3| unnamed protein product [Vitis vinifera]
Length=703

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            KSSK+++PS V D+ L+CSF +A+LC  ++A V RW+ LR+++ P++ KE  A K  L +
Sbjct  564  KSSKEKSPSWVADILLICSFIIAILCSTIVAIVLRWRKLRREIPPVSQKEGKA-KEGLMD  622

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQAC  247
            T  +  +E EIHFG RPNFQDIF++F  E+RGS  GV +CGPE+MKESVA  C  +SQ C
Sbjct  623  TRGTALEEHEIHFGGRPNFQDIFSKFPKETRGSNIGVLVCGPETMKESVASICSQTSQCC  682

Query  246  K  244
             
Sbjct  683  N  683



>ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis]
 gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis]
Length=726

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 86/120 (72%), Gaps = 1/120 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KK +K++TPSS++D+ LL SF +A+ C   IA + RWK L+KD+  ++ ++ I L+P   
Sbjct  587  KKVAKEKTPSSIVDILLLSSFIIAVTCSTFIAIILRWKRLKKDIPSVSQRQGIFLEPSSM  646

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E   S +++ EIHFG RPNFQDIF++FTNE+ GS  GV +CGPE+MKESVA  C L SQ 
Sbjct  647  ELRGSREEQ-EIHFGGRPNFQDIFSKFTNETVGSDVGVLVCGPETMKESVASFCHLKSQG  705



>ref|XP_011046222.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Populus 
euphratica]
Length=722

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KK++K++TPSSV+DL LL SF + L C   +A++ RWK L+KD+ P++ K+  A +    
Sbjct  583  KKAAKEKTPSSVVDLLLLASFIITLACSTFLASILRWKRLKKDIPPVSPKQGKATEHGSV  642

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            ET  S  +E E+HFG RP+FQDIF++F NE+ GS  GV +CGP SMKESVA  CQL SQ 
Sbjct  643  ETR-SPVEEHELHFGGRPDFQDIFSKFPNETGGSDIGVLVCGPVSMKESVASLCQLKSQG  701



>gb|KDP31036.1| hypothetical protein JCGZ_11412 [Jatropha curcas]
Length=724

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K+ SK++T SSV+DL LL SF +A+ C   +A + RWK L+K++ P++ K+S + +P   
Sbjct  585  KELSKEKTSSSVVDLLLLASFIIAITCSTFVAIILRWKRLKKEIPPVSQKQSKSAEPNTM  644

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E   S  +E EIHFG RPNFQD+F++F NE+ GS  GV +CGPE+MKESVA  C+L SQ 
Sbjct  645  EIT-SAFEEHEIHFGGRPNFQDVFSKFLNETGGSDIGVLVCGPEAMKESVASICKLKSQG  703



>gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta]
Length=722

 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KK  KD+TPSSV+D+ LL SF +A+ C   +A + RWK L K + P++ K + + +P   
Sbjct  583  KKVPKDKTPSSVVDILLLSSFVIAIACSTFLAFILRWKRLTKSIPPVSQKRAKSTEPSQV  642

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            ET  S  ++ EIH G RPNFQDIF++F NE+ GS  GV +CGPES+KESVA  CQL SQ 
Sbjct  643  ET-MSGSEKHEIHLGGRPNFQDIFSKFRNETGGSDIGVLVCGPESIKESVASLCQLKSQG  701



>ref|XP_002321628.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEF05755.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=722

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KK++K++TPSS++DL LL SF +AL C   +A++ RWK L+KD+ P++ K+  A +    
Sbjct  583  KKAAKEKTPSSLVDLLLLASFIIALACNTFLASILRWKRLKKDIPPVSPKQGKATEHGSV  642

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E   S  +E E+HFG RP+FQDIF++F NE+ GS  GV +CGP SM ESVA  CQL SQ 
Sbjct  643  EAK-SPVEEHELHFGGRPDFQDIFSKFPNETGGSDIGVLVCGPVSMTESVASLCQLKSQG  701



>ref|XP_010102484.1| Ferric reduction oxidase 8 [Morus notabilis]
 gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis]
Length=711

 Score =   123 bits (308),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+SK++ PSSV DL ++ SF +A++C  L+A + RW+ L+++  PL +K   +  P   E
Sbjct  574  KASKEKNPSSVFDLIIIFSFVIAMICSTLLAVIVRWRRLKRETSPLVEKHVKSWLPSSIE  633

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQAC  247
               + D+  EIHF  RPNFQDIF +F  E+ GS  GV +CGPE+MKESVAL C+ +SQ  
Sbjct  634  AGGALDKH-EIHFTGRPNFQDIFTKFPTETGGSDVGVLVCGPETMKESVALFCRQNSQCF  692

Query  246  K  244
            K
Sbjct  693  K  693



>ref|XP_008239582.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Prunus 
mume]
Length=630

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  +K++TPS V+DL ++ SF +AL+C   +A V RW+ L+K +LP   K+S AL+   T
Sbjct  496  KNPTKEKTPSWVVDLLIISSFILALICSIFVALVIRWRRLKKQILPTLQKQSKALEKGST  555

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            + + + ++  EIHFG RPNF+DIFA+F +E  GS  GV +CGPE+MKESVA  CQ
Sbjct  556  QASDALEEH-EIHFGGRPNFEDIFAKFPDEKGGSDIGVLVCGPETMKESVASICQ  609



>ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
 gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica]
Length=687

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 81/115 (70%), Gaps = 1/115 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  +K++TPS V+DL ++ SF +AL+C   +A V RW+ L+K +LP   ++S AL+   T
Sbjct  553  KNPTKEKTPSWVVDLLIISSFILALICSIFVALVIRWRRLKKQILPTLQEQSKALEKGST  612

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            + + + ++  EIHFG RPNF+DIFA+F +E  GS  GV +CGPE+MKESVA  CQ
Sbjct  613  QASDALEEH-EIHFGGRPNFEDIFAKFPDEKGGSDIGVLVCGPETMKESVASVCQ  666



>ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
 ref|XP_011047811.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus 
euphratica]
Length=733

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 81/123 (66%), Gaps = 5/123 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDM---LPLADKESIALKP  439
             K+SK++TPSSV+DL LL SF +AL C   +A + RWK L+KD+    P  D E+  L  
Sbjct  592  NKASKEKTPSSVVDLLLLASFIVALACNTFLAIILRWKRLKKDIPAVSPKQDNEATELAG  651

Query  438  RLTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
             +     S  +E EIHFG RP+FQDI ++F NE+ GS  GV +CGPESMK+SVA  CQL 
Sbjct  652  SVEA--RSTVEEHEIHFGGRPDFQDILSKFPNETGGSDIGVLVCGPESMKKSVASLCQLK  709

Query  258  SQA  250
            SQ 
Sbjct  710  SQG  712



>ref|XP_007155475.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
 gb|ESW27469.1| hypothetical protein PHAVU_003G204400g [Phaseolus vulgaris]
Length=709

 Score =   119 bits (298),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -3

Query  612  GKKSS--KDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKP  439
            GK+S   K++TPS V+DL L+ +F +AL C A +A   RW+ LRK +  ++ +E  AL  
Sbjct  567  GKRSKLDKEKTPSWVVDLLLIAAFVLALACSASVAGFLRWRRLRKGIPKISHREIEALDL  626

Query  438  RLTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
               E   + +   E+HFG RPNF++IF++  NES GS  GV +CGPESMKESVALACQ  
Sbjct  627  SSAEARNALEAH-EVHFGGRPNFKEIFSKLQNESGGSNIGVLVCGPESMKESVALACQQE  685

Query  258  SQACK  244
            S+  K
Sbjct  686  SECFK  690



>gb|KEH31789.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=714

 Score =   114 bits (286),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 4/125 (3%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLP--LADKESIALKPRL  433
            K SK++TPS ++DL L+ +F +AL C ALIA V RW+ L+K +    L     + +KP  
Sbjct  571  KLSKEKTPSWIVDLLLIAAFVIALSCSALIAIVLRWRRLKKGIPKKGLTQTSQMEIKPFD  630

Query  432  TETNXSXD--QELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
              +    +  +E E+HFG RPNF+DI  +F NE+ GS  GV +CGPESMKESVA ACQ  
Sbjct  631  PSSAEPKNALEEHEVHFGGRPNFKDILGKFKNETCGSDIGVLVCGPESMKESVASACQQE  690

Query  258  SQACK  244
            S+  K
Sbjct  691  SECFK  695



>ref|XP_011072176.1| PREDICTED: ferric reduction oxidase 8, mitochondrial, partial 
[Sesamum indicum]
Length=688

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 80/118 (68%), Gaps = 1/118 (1%)
 Frame = -3

Query  612  GKKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRL  433
             KK S+ +  SS +DL LLCSFA+A+ C  L+A + RWK +++++    DK++   K   
Sbjct  563  AKKRSEQKNSSSQVDLLLLCSFAIAITCSTLLAIMIRWKRVKRELQSFTDKQNKTTKQCS  622

Query  432  TETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
               +   D E EIHFG RPNF+DIF++FT+E+ GS  GV +CGPE MKESVA AC+L+
Sbjct  623  LRASRELD-EHEIHFGGRPNFRDIFSDFTSETGGSDIGVLVCGPEPMKESVASACRLA  679



>emb|CDP12742.1| unnamed protein product [Coffea canephora]
Length=704

 Score =   112 bits (281),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 7/119 (6%)
 Frame = -3

Query  591  ETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXSX  412
            + PSS  DLFL CSF +A++C +L+A V R K + K++L  +       KP    T    
Sbjct  571  KVPSSATDLFLSCSFVIAIICSSLLAIVLRRKRVGKELLSFSGIPIETTKP----TGIGI  626

Query  411  DQEL---EIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQACK  244
            D  L   EIHFG RP+F+++F +F+NE+ GS  GVF+CGPESMKESVAL C+LSS+A +
Sbjct  627  DNTLVEHEIHFGGRPDFREVFCKFSNETEGSSVGVFVCGPESMKESVALTCKLSSRAFR  685



>ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine 
max]
 gb|KHN18418.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=711

 Score =   112 bits (280),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = -3

Query  612  GKKS--SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKP  439
            GK+S  +K++TPS V+DL L+ +F +AL   A +AA+ RW+ LRK +  ++ +E   L  
Sbjct  569  GKRSKMAKEKTPSWVVDLLLIAAFVLALAFSASVAAILRWRRLRKGIPQISHREIQPLDL  628

Query  438  RLTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
               E   + +   E+HFG RPNF+DIF +  +ES GS  GV +CGPESMKESVA ACQ  
Sbjct  629  SSAEARNALEDH-EVHFGGRPNFKDIFGKLHDESDGSNIGVLVCGPESMKESVAFACQQE  687

Query  258  SQACK  244
            S+  K
Sbjct  688  SECFK  692



>gb|KEH31790.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula]
Length=576

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 81/126 (64%), Gaps = 6/126 (5%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLP---LADKESIALKPR  436
            K SK++TPS ++DL L+ +F +AL C ALIA V RW+ L+K  +P   L     + +KP 
Sbjct  433  KLSKEKTPSWIVDLLLIAAFVIALSCSALIAIVLRWRRLKKG-IPKKGLTQTSQMEIKPF  491

Query  435  LTETNXSXD--QELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQL  262
               +    +  +E E+HFG RPNF+DI  +F NE+ GS  GV +CGPESMKESVA ACQ 
Sbjct  492  DPSSAEPKNALEEHEVHFGGRPNFKDILGKFKNETCGSDIGVLVCGPESMKESVASACQQ  551

Query  261  SSQACK  244
             S+  K
Sbjct  552  ESECFK  557



>ref|XP_011464152.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=703

 Score =   110 bits (275),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 77/124 (62%), Gaps = 1/124 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            +K++K +TPS V+DL ++CSF   L+C+  +    RW+ L+K   P+  K+   L+    
Sbjct  568  EKATKGKTPSLVVDLLIICSFIAVLICIIFVPLFIRWRRLKKQNPPVFPKQGKVLEISPA  627

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E   + ++  EIHFG RPNF++IFA+F NE  GS  GV +CGPE+MKESVA  CQ     
Sbjct  628  EARDTLEEH-EIHFGRRPNFEEIFAKFPNEIGGSDIGVLVCGPEAMKESVASICQHKCGG  686

Query  249  CKPQ  238
             K Q
Sbjct  687  LKAQ  690



>gb|EYU22175.1| hypothetical protein MIMGU_mgv1a002211mg [Erythranthe guttata]
Length=701

 Score =   109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K S  ++ SS++D  L+CSFAMA L  AL+A + RW+ L+  +   +DK+S  +K    E
Sbjct  564  KPSAQKSSSSLVDFLLMCSFAMATLSSALMAVIIRWRKLKNGLRLYSDKQSRDMKQSSVE  623

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
             +   D+  EI FG RPNF+DIFA+F + S GS  GV +CGP++MKESVA AC+
Sbjct  624  ASRDLDEH-EIRFGGRPNFRDIFAKFASNSGGSDIGVLVCGPQTMKESVASACR  676



>ref|XP_004515872.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cicer 
arietinum]
Length=714

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 82/134 (61%), Gaps = 10/134 (7%)
 Frame = -3

Query  612  GKKS--SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKP  439
            GK S  SK++TPS ++DL L+ +F +AL C  LIA + RW+ L+K + P++  E      
Sbjct  572  GKHSKLSKEKTPSWIMDLLLIAAFVLALSCSTLIAIILRWRRLKKGIPPMSQTEIKPFDL  631

Query  438  RLTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ--  265
               ET  S  +E E++FG RPNF+DI  +F NE+ GS  GV +CGPESMKES+A A Q  
Sbjct  632  SSAETK-SALEEHEVYFGGRPNFKDILGKFKNETCGSDVGVLVCGPESMKESLASAYQKE  690

Query  264  -----LSSQACKPQ  238
                 L  +  KPQ
Sbjct  691  SKCFKLGVKRTKPQ  704



>ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Malus domestica]
Length=706

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +++K++TPSS+ DL ++ SF +A+ C   +A + R + ++K + P+  K+   L+    +
Sbjct  571  EATKEKTPSSIADLLIISSFIVAITCSIFVALIVRRRRIQKLIPPILQKQGKDLEKSSIQ  630

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQAC  247
             + +  +E EIHFG RP FQDIFA+F++E+ GS  GV +CGPESMKESVA  CQ    A 
Sbjct  631  ASDAALEEHEIHFGGRPKFQDIFAKFSDETGGSDIGVMVCGPESMKESVATECQQKLGAN  690

Query  246  KPQ  238
            K Q
Sbjct  691  KKQ  693



>ref|XP_002318065.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
 gb|EEE96285.1| ferric reductase-like transmembrane component family protein 
[Populus trichocarpa]
Length=743

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 79/144 (55%), Gaps = 28/144 (19%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
             K+SK++TPSSV+DL LL SF +AL C   +A + RWK L+KD+   + K+      + T
Sbjct  583  NKASKEKTPSSVVDLLLLASFIVALACNTFVAIILRWKRLKKDIPAASPKQG----NKAT  638

Query  429  ETNXSXD-----QELEIHFGARPNFQDIF-------------------AEFTNESRGSYT  322
            E   S +     +E EIHFG RP+FQ I                      F NE+ GS  
Sbjct  639  ELVGSVEARSTVEEHEIHFGGRPDFQGIIILSFSYNSATFYYLKFLLPITFPNETGGSDI  698

Query  321  GVFICGPESMKESVALACQLSSQA  250
            GV +CGPESMKESVA  CQL SQ 
Sbjct  699  GVLVCGPESMKESVASLCQLKSQG  722



>ref|XP_010037520.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Eucalyptus grandis]
 gb|KCW49230.1| hypothetical protein EUGRSUZ_K02803 [Eucalyptus grandis]
Length=717

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = -3

Query  600  SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETN  421
            SK +TPSSV+DL LL  F ++++    +A + RW+ ++K +   + K++       +   
Sbjct  583  SKTKTPSSVVDLILLSCFVISVIVSMTVALMLRWRRIKKAVPSTSPKKAGGFTEPSSAEP  642

Query  420  XSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                QE E+H+G RPNFQDIFA+F NE+ GS  GV +CGPE MKESVA + Q +SQ 
Sbjct  643  HDPLQEHEVHYGGRPNFQDIFAKFPNEAGGSDIGVLVCGPELMKESVAKSLQQTSQG  699



>ref|XP_010037521.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Eucalyptus grandis]
Length=716

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 74/117 (63%), Gaps = 0/117 (0%)
 Frame = -3

Query  600  SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETN  421
            SK +TPSSV+DL LL  F ++++    +A + RW+ ++K +   + K++       +   
Sbjct  582  SKTKTPSSVVDLILLSCFVISVIVSMTVALMLRWRRIKKAVPSTSPKKAGGFTEPSSAEP  641

Query  420  XSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                QE E+H+G RPNFQDIFA+F NE+ GS  GV +CGPE MKESVA + Q +SQ 
Sbjct  642  HDPLQEHEVHYGGRPNFQDIFAKFPNEAGGSDIGVLVCGPELMKESVAKSLQQTSQG  698



>ref|XP_010248638.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Nelumbo 
nucifera]
Length=720

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            ++ + ++ PS V DL L+CSF +A+ C  L  A  RW+ ++K+   ++  +  + +    
Sbjct  581  ERKASEKNPSWVTDLLLICSFFIAVSCTTLALAFMRWRRMKKENFQVSQNQHKSTEAISI  640

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
            E   + ++  EIHFG RPN QDI A+F  +S GS  GV +CGPESMKESVA  C+ +SQ 
Sbjct  641  EAGDTLEEH-EIHFGKRPNLQDILAQFPTQSGGSNIGVLVCGPESMKESVASFCKKNSQG  699

Query  249  CK  244
             K
Sbjct  700  PK  701



>gb|KDO69499.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=489

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  354  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  408

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  409  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  467



>gb|KDO69498.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=575

 Score = 97.4 bits (241),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  440  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  494

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  495  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  553



>gb|KDO69496.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=672

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  537  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  591

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  592  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  650



>ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus 
sinensis]
Length=713

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  578  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  632

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  633  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  691



>ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
 gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina]
Length=713

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  578  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  632

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  633  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  691



>gb|KDO69497.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis]
Length=713

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  SK++TPS V DL +L SF +A+    L+A + RW+ L+K   P++  +  A+     
Sbjct  578  KVVSKEKTPSWVADLIILSSFIIAITGSTLMAILLRWRRLKKQTPPVSLNQGKAV-----  632

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            +     ++E EI+FG RPNF++IF+E   E+ GS  GV +CGPESMKESVA   Q  SQ
Sbjct  633  QVLGPIEEEHEINFGGRPNFEEIFSELEKETAGSDIGVLVCGPESMKESVAKTSQRKSQ  691



>gb|KJB59689.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=726

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPL-ADKESIALKPRLT  430
            K+ K+++PS V D+ ++ SF ++L C +L+A V RW+ L+K+ +PL + KE    +    
Sbjct  586  KAPKEKSPSWVADILIISSFIISLACTSLVAIVLRWRRLKKEEVPLVSSKEEKVQQLSSI  645

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSS  256
            ET    ++E E+HFG RPN +D F++F NE+ GS  GV + GPE+MKE+VA  CQ  S
Sbjct  646  ETKGVVEEEHEVHFGGRPNLKDEFSKFLNETNGSDIGVLVSGPETMKEAVASLCQQKS  703



>gb|KJB59688.1| hypothetical protein B456_009G267500 [Gossypium raimondii]
Length=727

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPL-ADKESIALKPRLT  430
            K+ K+++PS V D+ ++ SF ++L C +L+A V RW+ L+K+ +PL + KE    +    
Sbjct  587  KAPKEKSPSWVADILIISSFIISLACTSLVAIVLRWRRLKKEEVPLVSSKEEKVQQLSSI  646

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSS  256
            ET    ++E E+HFG RPN +D F++F NE+ GS  GV + GPE+MKE+VA  CQ  S
Sbjct  647  ETKGVVEEEHEVHFGGRPNLKDEFSKFLNETNGSDIGVLVSGPETMKEAVASLCQQKS  704



>ref|XP_010678863.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=646

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = -3

Query  576  VIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLA-DKESIALKPRLTE-TNXSXDQE  403
            V+DLFLLCSF +A+ C AL+A   RW+  R +++  + D +   +K    E  + +  +E
Sbjct  512  VVDLFLLCSFLIAVACSALVAIALRWRNSRSEIVSTSWDNQDEVMKISAMEGASTTTLEE  571

Query  402  LEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQACK  244
             EIH+G RP F+++  +  +E  GS  GV +CGPESMK SVALACQ   Q C+
Sbjct  572  HEIHYGGRPVFEELLHKMESEFSGSNVGVVVCGPESMKGSVALACQ---QTCR  621



>gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like protein [Gossypium 
arboreum]
Length=727

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 51/118 (43%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPL-ADKESIALKPRLT  430
            K+ K+++PS V D+ ++ SF ++L C +L+A V RW+ L+K+ +PL + KE    +    
Sbjct  587  KAPKEKSPSWVADILIISSFIISLACPSLVAIVLRWRRLKKEEVPLVSSKEEKVQQLSSI  646

Query  429  ETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSS  256
            ET    ++E E+HFG RPN +D F++F NE+ GS  GV + GPE+MKE+VA  CQ  S
Sbjct  647  ETKGVVEEEHEVHFGGRPNLEDEFSKFLNETNGSDIGVLVSGPETMKEAVASLCQQKS  704



>ref|XP_010678862.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=726

 Score = 96.3 bits (238),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (63%), Gaps = 5/113 (4%)
 Frame = -3

Query  576  VIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLA-DKESIALKPRLTE-TNXSXDQE  403
            V+DLFLLCSF +A+ C AL+A   RW+  R +++  + D +   +K    E  + +  +E
Sbjct  592  VVDLFLLCSFLIAVACSALVAIALRWRNSRSEIVSTSWDNQDEVMKISAMEGASTTTLEE  651

Query  402  LEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQACK  244
             EIH+G RP F+++  +  +E  GS  GV +CGPESMK SVALACQ   Q C+
Sbjct  652  HEIHYGGRPVFEELLHKMESEFSGSNVGVVVCGPESMKGSVALACQ---QTCR  701



>ref|XP_007036323.1| Ferric reduction oxidase 8 isoform 3 [Theobroma cacao]
 gb|EOY20824.1| Ferric reduction oxidase 8 isoform 3 [Theobroma cacao]
Length=521

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K+++PS V D+ ++ SF ++L C  L+A + RW+ ++K++  ++ +E    +   TE
Sbjct  383  KAPKEKSPSWVADILIISSFIISLACTTLVAIILRWRKVKKEIPLVSQREEKVKELGSTE  442

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            T  + + E E+HFG RPN +D+F++F NE+ GS  GV +CGPES+K +VA  CQ  SQ
Sbjct  443  TKGAVE-EHEVHFGGRPNLEDVFSKFLNETDGSNIGVLVCGPESLKRAVASLCQQKSQ  499



>ref|XP_007036322.1| Ferric reduction oxidase 8 isoform 2 [Theobroma cacao]
 gb|EOY20823.1| Ferric reduction oxidase 8 isoform 2 [Theobroma cacao]
Length=594

 Score = 92.4 bits (228),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K+++PS V D+ ++ SF ++L C  L+A + RW+ ++K++  ++ +E    +   TE
Sbjct  456  KAPKEKSPSWVADILIISSFIISLACTTLVAIILRWRKVKKEIPLVSQREEKVKELGSTE  515

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            T  + + E E+HFG RPN +D+F++F NE+ GS  GV +CGPES+K +VA  CQ  SQ
Sbjct  516  TKGAVE-EHEVHFGGRPNLEDVFSKFLNETDGSNIGVLVCGPESLKRAVASLCQQKSQ  572



>ref|XP_008459874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459875.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459876.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
 ref|XP_008459877.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Cucumis 
melo]
Length=718

 Score = 92.8 bits (229),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 71/122 (58%), Gaps = 1/122 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K +KD TPS + DL L+ SF +A+L  A++  V RW+ L+K+ L L   ++       + 
Sbjct  578  KKTKDRTPSWISDLLLMSSFTLAILSGAVVGIVLRWRRLKKENLALIQTKTGTQNAIPSS  637

Query  426  T-NXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                S  +E EI++G RPNF++IF+   +E  G+  GV  CGPE+M  SVA  C+  SQ 
Sbjct  638  VVRGSRQEEHEIYYGGRPNFKEIFSNIKHEDEGTEIGVISCGPEAMNVSVASTCKQISQG  697

Query  249  CK  244
             +
Sbjct  698  LR  699



>ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
 gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao]
Length=720

 Score = 92.4 bits (228),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 79/118 (67%), Gaps = 1/118 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K+++PS V D+ ++ SF ++L C  L+A + RW+ ++K++  ++ +E    +   TE
Sbjct  582  KAPKEKSPSWVADILIISSFIISLACTTLVAIILRWRKVKKEIPLVSQREEKVKELGSTE  641

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            T  + ++  E+HFG RPN +D+F++F NE+ GS  GV +CGPES+K +VA  CQ  SQ
Sbjct  642  TKGAVEEH-EVHFGGRPNLEDVFSKFLNETDGSNIGVLVCGPESLKRAVASLCQQKSQ  698



>ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Malus domestica]
Length=699

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +++K++TPSS+ DL ++ SF +A+ C   +A + R + ++K + P+  K+   L+    +
Sbjct  571  EATKEKTPSSIADLLIISSFIVAITCSIFVALIVRRRRIQKLIPPILQKQGKDLEKSSIQ  630

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQAC  247
             + +  +E EIHFG RP FQD       E+ GS  GV +CGPESMKESVA  CQ    A 
Sbjct  631  ASDAALEEHEIHFGGRPKFQD-------ETGGSDIGVMVCGPESMKESVATECQQKLGAN  683

Query  246  KPQ  238
            K Q
Sbjct  684  KKQ  686



>ref|XP_007215241.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
 gb|EMJ16440.1| hypothetical protein PRUPE_ppa014585mg, partial [Prunus persica]
Length=526

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 72/116 (62%), Gaps = 12/116 (10%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            K  +K++TPS V DL ++ SF +AL+C   +A +           P   K+S AL+   T
Sbjct  417  KNPTKEKTPSWVADLLIISSFILALICSIFVALIP----------PTLQKQSKALEKGST  466

Query  429  ETNXSXDQELEIHFGARPNFQ-DIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            + + + ++  EIHFG RPNF+ DIFA+F +E+ GS  GV + GPE+MKESVA  CQ
Sbjct  467  QASDALEEH-EIHFGGRPNFEADIFAKFPDETGGSDIGVLVYGPETMKESVASICQ  521



>ref|XP_004168892.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis 
sativus]
Length=716

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K +KD TPS + DL L+ SF +A+L  A++  V RW+ L+K+ L L   E+       + 
Sbjct  576  KKTKDRTPSWISDLLLMSSFTLAILSSAVVGIVLRWRRLKKENLALIQTETGTQNAIPSS  635

Query  426  T-NXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                S  +E EI++G RP F++IF+   +E  G+  GV  CGP +M  SVA AC+  SQ 
Sbjct  636  VVRGSRQEEHEIYYGGRPIFKEIFSNIKHEDEGTEIGVISCGPAAMNVSVASACKQISQG  695

Query  249  CK  244
             +
Sbjct  696  LR  697



>ref|XP_004140645.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Cucumis 
sativus]
Length=716

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K +KD TPS + DL L+ SF +A+L  A++  V RW+ L+K+ L L   E+       + 
Sbjct  576  KKTKDRTPSWISDLLLMSSFTLAILSSAVVGIVLRWRRLKKENLALIQTETGTQNAIPSS  635

Query  426  T-NXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                S  +E EI++G RP F++IF+   +E  G+  GV  CGP +M  SVA AC+  SQ 
Sbjct  636  VVRGSRQEEHEIYYGGRPIFKEIFSNIKHEDEGTEIGVISCGPAAMNVSVASACKQISQG  695

Query  249  CK  244
             +
Sbjct  696  LR  697



>gb|KGN46442.1| hypothetical protein Csa_6G093620 [Cucumis sativus]
Length=703

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 70/122 (57%), Gaps = 1/122 (1%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K +KD TPS + DL L+ SF +A+L  A++  V RW+ L+K+ L L   E+       + 
Sbjct  563  KKTKDRTPSWISDLLLMSSFTLAILSSAVVGIVLRWRRLKKENLALIQTETGTQNAIPSS  622

Query  426  T-NXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQA  250
                S  +E EI++G RP F++IF+   +E  G+  GV  CGP +M  SVA AC+  SQ 
Sbjct  623  VVRGSRQEEHEIYYGGRPIFKEIFSNIKHEDEGTEIGVISCGPAAMNVSVASACKQISQG  682

Query  249  CK  244
             +
Sbjct  683  LR  684



>ref|XP_010533458.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Tarenaya hassleriana]
Length=725

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = -3

Query  612  GKKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRK--DMLPLADKESIALKP  439
            G K +K+++PS V DL ++ S+ +AL    L+A ++  +  ++  D L ++  E    + 
Sbjct  580  GNKIAKEKSPSWVADLVIIASYFIALTIAGLLATIQHRRQRQRQRDTLNMSSAEEQKARD  639

Query  438  R-LTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQL  262
            R L E+  +   E EIH G RP+F++IF+EF  ESR S  GV +CGPESMK+SVA  C+ 
Sbjct  640  RNLIESTSAHVDEHEIHCGERPDFEEIFSEFRKESRTSNAGVLVCGPESMKQSVASMCRK  699

Query  261  SSQ  253
            +S+
Sbjct  700  TSE  702



>ref|XP_010533455.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533456.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010533457.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Tarenaya hassleriana]
Length=729

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 77/123 (63%), Gaps = 3/123 (2%)
 Frame = -3

Query  612  GKKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRK--DMLPLADKESIALKP  439
            G K +K+++PS V DL ++ S+ +AL    L+A ++  +  ++  D L ++  E    + 
Sbjct  584  GNKIAKEKSPSWVADLVIIASYFIALTIAGLLATIQHRRQRQRQRDTLNMSSAEEQKARD  643

Query  438  R-LTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQL  262
            R L E+  +   E EIH G RP+F++IF+EF  ESR S  GV +CGPESMK+SVA  C+ 
Sbjct  644  RNLIESTSAHVDEHEIHCGERPDFEEIFSEFRKESRTSNAGVLVCGPESMKQSVASMCRK  703

Query  261  SSQ  253
            +S+
Sbjct  704  TSE  706



>ref|XP_009613741.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana tomentosiformis]
Length=645

 Score = 87.0 bits (214),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 41/81 (51%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKS++ +T SS++DL L+CSFA+AL+   L+A + RWK L +++ P ++KE   +KP  T
Sbjct  566  KKSAEQKTASSIVDLLLICSFALALISSTLVATLWRWKRLSEEIPPFSEKERKPMKP--T  623

Query  429  ETNXSXDQELEIHFGARPNFQ  367
            E+N   DQ  EIHFGARPNF+
Sbjct  624  ESNRGFDQH-EIHFGARPNFK  643



>ref|XP_010906716.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Elaeis 
guineensis]
Length=703

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = -3

Query  612  GKKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWK-------CLRKDMLPLADKES  454
            GKKSS+++ PS V DL + CSF +A  C ++     RW+        L +     A+  S
Sbjct  563  GKKSSENKYPSWVNDLLVFCSFVIATSCCSVATVFLRWRKSVNNIQLLSQKYTESAEMHS  622

Query  453  IALKPRLTETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVAL  274
            + LK  L        +E EI+FG RPN  DI +E++ E   S  G+F+CGP+SM+ESVA 
Sbjct  623  MQLKGAL--------EEHEINFGRRPNLIDILSEWSAEIEESKVGIFVCGPDSMQESVAT  674

Query  273  ACQ  265
             C+
Sbjct  675  FCR  677



>ref|XP_009798366.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X3 [Nicotiana sylvestris]
Length=645

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 40/81 (49%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = -3

Query  609  KKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLT  430
            KKSS+ +T SS++D+ L+CSFA+AL+   L+A + RWK L +++ P ++ E   +KP  T
Sbjct  566  KKSSEQKTASSIVDVLLICSFALALISSTLVATLWRWKRLSEEIPPFSETERKPMKP--T  623

Query  429  ETNXSXDQELEIHFGARPNFQ  367
            E N   DQ  EIHFGARPNF+
Sbjct  624  EANKGFDQH-EIHFGARPNFK  643



>ref|XP_007036377.1| Uncharacterized protein TCM_012218 [Theobroma cacao]
 gb|EOY20878.1| Uncharacterized protein TCM_012218 [Theobroma cacao]
Length=178

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -3

Query  531  CVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXSXDQELEIHFGARPNFQDIFAE  352
            C  L+A   RW+ L+K+ +PL   ++  +K   +  +    ++ E+HFG R NF+D+F++
Sbjct  65   CTTLVAINLRWRKLKKE-IPLICLKAEKVKELSSIESKGAVEDHEVHFGGRSNFEDVFSK  123

Query  351  FTNESRGSYTGVFICGPESMKESVALACQLSSQ  253
            F NE+ GS  GV +CGPES+K +VA  CQ  SQ
Sbjct  124  FLNETDGSNIGVLVCGPESLKRAVASLCQQKSQ  156



>ref|XP_008777197.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Phoenix 
dactylifera]
Length=707

 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 67/116 (58%), Gaps = 0/116 (0%)
 Frame = -3

Query  612  GKKSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRL  433
            GKKSS+ + PS V DL +LCSF +A    ++   + RW+    ++  L+ K + + +   
Sbjct  566  GKKSSESKYPSWVNDLLVLCSFVIATSSCSVATVLLRWRKSANNVQLLSRKYTESAEMHY  625

Query  432  TETNXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            +       +E EI+FG RPN  DI +E + E   S  GVF+CGP SM+ESVA  C+
Sbjct  626  SRQLKGALEEHEINFGRRPNLIDILSELSAEIEESKVGVFVCGPYSMRESVATFCR  681



>ref|XP_006402177.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
 gb|ESQ43630.1| hypothetical protein EUTSA_v10012790mg [Eutrema salsugineum]
Length=727

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 48/121 (40%), Positives = 70/121 (58%), Gaps = 4/121 (3%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPR-LT  430
            K++K++ PS V DL ++ S+ +A+    L A + +W+   ++  P   KE +  + R  T
Sbjct  583  KTAKEKVPSWVPDLVIIVSYFIAIATGGLAATILKWRRQNREA-PRMSKEEVKPEERNFT  641

Query  429  E-TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQLSS  256
            E    +  +E EIH G RP FQ+I +EF    RG S  GV  CGPESMKE+VA  C+  S
Sbjct  642  ELIPIAHVEEHEIHIGERPEFQEILSEFGKNLRGWSSIGVLACGPESMKEAVASMCRQRS  701

Query  255  Q  253
            Q
Sbjct  702  Q  702



>emb|CDY12264.1| BnaA09g24640D [Brassica napus]
Length=706

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 43/115 (37%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = -3

Query  603  SSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE-  427
            ++K++ PS V DL ++ ++ +A+    L A + +W+  R++ L +  +E        TE 
Sbjct  563  TAKEKVPSWVPDLVIIVAYVIAMTIGGLAAIILQWRRQRRETLRMTKEEVNPQGSNFTES  622

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
            T     +E EIH G RP F++I +EF    RG S  GV +CGPESMKE+VA  C+
Sbjct  623  TPIVPIEEHEIHIGERPKFKEILSEFETSLRGWSSIGVLVCGPESMKEAVASICR  677



>ref|XP_009114915.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X2 [Brassica rapa]
Length=727

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = -3

Query  600  SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE-T  424
            +K++ PS V DL ++ ++ +A+    L A + +W+   ++ L +  +E        TE T
Sbjct  585  AKEKVPSWVPDLVIIVAYVIAMTIGGLAAIILQWRRQHRETLRMTKEEVNPQGSNFTEST  644

Query  423  NXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
                 +E EIH G RP F++I +EF    RG S  GV +CGPESMKE+VA  C+
Sbjct  645  PIVPIEEHEIHIGERPKFKEILSEFETSLRGWSSIGVLVCGPESMKEAVASICR  698



>ref|XP_009114914.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform 
X1 [Brassica rapa]
Length=728

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = -3

Query  600  SKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE-T  424
            +K++ PS V DL ++ ++ +A+    L A + +W+   ++ L +  +E        TE T
Sbjct  586  AKEKVPSWVPDLVIIVAYVIAMTIGGLAAIILQWRRQHRETLRMTKEEVNPQGSNFTEST  645

Query  423  NXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
                 +E EIH G RP F++I +EF    RG S  GV +CGPESMKE+VA  C+
Sbjct  646  PIVPIEEHEIHIGERPKFKEILSEFETSLRGWSSIGVLVCGPESMKEAVASICR  699



>ref|XP_010255195.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Nelumbo 
nucifera]
Length=364

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 1/98 (1%)
 Frame = -3

Query  594  DETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXS  415
            ++ PS V DL ++CSF +A+ C  L  A  RW+ ++K+   +   +    +    E   +
Sbjct  268  EKNPSWVTDLLIICSFFIAVSCPTLALAFMRWRRMKKENFQVTQNQHKRTEAISIEAGDT  327

Query  414  XDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGP  301
             + E +IHFG RP+ QDI A+F  +SRGS   V +CGP
Sbjct  328  LE-EHKIHFGKRPSLQDIIAQFPTQSRGSNIRVLVCGP  364



>ref|XP_002864039.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40298.1| ATFRO8/FRO8 [Arabidopsis lyrata subsp. lyrata]
Length=728

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/119 (38%), Positives = 67/119 (56%), Gaps = 7/119 (6%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKP---R  436
            K++K++ PS V DL ++ S+ +A+    L A +  W+   ++  P   KE + +KP    
Sbjct  583  KTAKEKVPSWVPDLIIIVSYVIAITIGGLAATILPWRGKHREA-PRMTKEEV-IKPGERN  640

Query  435  LTETN-XSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
             TE       +ELEIH G RP  ++I +EF    RG S  GV +CGPE+MKE VA  C+
Sbjct  641  FTELKPIPLIEELEIHTGERPKLEEIMSEFEKNLRGWSSIGVLVCGPETMKEDVASMCR  699



>emb|CDY22585.1| BnaC05g24230D [Brassica napus]
Length=725

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/115 (36%), Positives = 65/115 (57%), Gaps = 2/115 (2%)
 Frame = -3

Query  603  SSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE-  427
            ++K++ PS V DL ++ ++ +A+    L A + +W+   ++ L +  +E        TE 
Sbjct  582  TAKEKVPSWVPDLVIIVAYVIAMTIGGLAAIILQWRRQHRETLRMTKEEVNPQGRNFTES  641

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
            T     +E  IH G RP F++I +EF    RG S  GV +CGPESMKE+VA  C+
Sbjct  642  TPIVPMEEHGIHIGERPKFKEILSEFETSLRGLSSIGVLVCGPESMKEAVASICR  696



>ref|XP_009406362.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=709

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 58/114 (51%), Gaps = 1/114 (1%)
 Frame = -3

Query  585  PSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXSXDQ  406
            PS + DL LLCS A+A  C  +   + RW+    D   L+ K    L   L +      Q
Sbjct  578  PSWIGDLLLLCSLAIAASCCTVATVLSRWRKSVDDSQELSHKHH-ELAEMLPDKVHGALQ  636

Query  405  ELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQACK  244
              EI+FG RPN  D+ AE    +  S  GVF+CGP SM+E+VA  C   ++  K
Sbjct  637  THEIYFGCRPNLGDMLAEIATGTGDSEVGVFVCGPTSMQEAVASFCTRHNKRLK  690



>gb|KFK26648.1| hypothetical protein AALP_AA8G275500 [Arabis alpina]
Length=728

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K++K++ PS + D+ ++ S+ +A+    L A +  W+  +    P   KE  A+KP+  E
Sbjct  584  KTAKEKVPSWIPDVVIIVSYVIAITTGGLAATILHWR-RQHGETPRMSKE--AVKPQ--E  638

Query  426  TNXSXDQELE------IHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALAC  268
             N +   +++      IH G RP F++I + F    RG S  GV +CGPE+MKE+VA  C
Sbjct  639  KNLTKRIQIDHIEEDGIHIGERPKFEEILSAFEKNLRGWSSMGVLVCGPETMKEAVASMC  698

Query  267  QLSSQ  253
               SQ
Sbjct  699  YQRSQ  703



>ref|XP_010442496.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=737

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K++ P  V DL ++ S+ +A+    L A + +W+   ++   L+ +E    +  LTE
Sbjct  583  KTDKEKVPLWVPDLVIIVSYVIAITIGGLAATILQWRRQHREAPGLSKEEVKPEERNLTE  642

Query  426  TNXSXD-QELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALAC-QLSS  256
               +   ++ EIH G RP  ++I  EF    RG S  GV +CGPE MKE VA  C Q   
Sbjct  643  LILTAPIEDHEIHTGERPKLEEILLEFEMNLRGWSSVGVLVCGPEPMKEGVAPMCRQRRP  702

Query  255  QAC  247
            Q C
Sbjct  703  QCC  705



>ref|XP_010442495.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=743

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 3/123 (2%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K++ P  V DL ++ S+ +A+    L A + +W+   ++   L+ +E    +  LTE
Sbjct  589  KTDKEKVPLWVPDLVIIVSYVIAITIGGLAATILQWRRQHREAPGLSKEEVKPEERNLTE  648

Query  426  TNXSXD-QELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALAC-QLSS  256
               +   ++ EIH G RP  ++I  EF    RG S  GV +CGPE MKE VA  C Q   
Sbjct  649  LILTAPIEDHEIHTGERPKLEEILLEFEMNLRGWSSVGVLVCGPEPMKEGVAPMCRQRRP  708

Query  255  QAC  247
            Q C
Sbjct  709  QCC  711



>dbj|BAB09387.1| FRO1 and FRO2-like protein [Arabidopsis thaliana]
Length=713

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 7/119 (6%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPR---  436
            K++K++ PS V DL ++ S+ +A+      A + + +   K+  P   KE + +KP    
Sbjct  568  KTAKEKVPSWVPDLIIIVSYVIAISVGGFAATILQRRRKHKEA-PRMSKE-VVIKPEERN  625

Query  435  LTETN-XSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
             TE       +E EIH G RP  ++I +EF    RG S  GV +CGPES+KE+VA  C+
Sbjct  626  FTELKPIPITEEHEIHIGERPKLEEIMSEFEKNLRGWSSVGVLVCGPESVKEAVASMCR  684



>ref|NP_199827.2| ferric reduction oxidase 8 [Arabidopsis thaliana]
 sp|Q8VY13.1|FRO8_ARATH RecName: Full=Ferric reduction oxidase 8, mitochondrial; Short=AtFRO8; 
AltName: Full=Ferric-chelate reductase 8; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL66984.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AAO22815.1| putative FRO1 and FRO2 protein [Arabidopsis thaliana]
 gb|AED95905.1| ferric reduction oxidase 8 [Arabidopsis thaliana]
Length=728

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 66/119 (55%), Gaps = 7/119 (6%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPR---  436
            K++K++ PS V DL ++ S+ +A+      A + + +   K+  P   KE + +KP    
Sbjct  583  KTAKEKVPSWVPDLIIIVSYVIAISVGGFAATILQRRRKHKEA-PRMSKE-VVIKPEERN  640

Query  435  LTETN-XSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQ  265
             TE       +E EIH G RP  ++I +EF    RG S  GV +CGPES+KE+VA  C+
Sbjct  641  FTELKPIPITEEHEIHIGERPKLEEIMSEFEKNLRGWSSVGVLVCGPESVKEAVASMCR  699



>ref|XP_010482321.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=726

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 2/121 (2%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K++ PS V DL ++ S+  A+        + +W+   ++   L+ +E    +  LTE
Sbjct  583  KTDKEKVPSWVPDLVIIVSYVKAITIGGFAGKILQWRRQHREAPGLSKEEVKPEERNLTE  642

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQLSSQA  250
               +  +E EIH G RP  ++I  EF     G S  GV +CGPE MKE+VA  C+     
Sbjct  643  LILTA-EEHEIHTGGRPKLEEILLEFEKNLIGWSSVGVLVCGPEPMKEAVASMCRQRRPQ  701

Query  249  C  247
            C
Sbjct  702  C  702



>ref|XP_010482319.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like isoform 
X1 [Camelina sativa]
Length=730

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 62/121 (51%), Gaps = 2/121 (2%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K+ K++ PS V DL ++ S+  A+        + +W+   ++   L+ +E    +  LTE
Sbjct  587  KTDKEKVPSWVPDLVIIVSYVKAITIGGFAGKILQWRRQHREAPGLSKEEVKPEERNLTE  646

Query  426  TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQLSSQA  250
               +  +E EIH G RP  ++I  EF     G S  GV +CGPE MKE+VA  C+     
Sbjct  647  LILTA-EEHEIHTGGRPKLEEILLEFEKNLIGWSSVGVLVCGPEPMKEAVASMCRQRRPQ  705

Query  249  C  247
            C
Sbjct  706  C  706



>ref|XP_006280085.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
 gb|EOA12983.1| hypothetical protein CARUB_v10025968mg [Capsella rubella]
Length=723

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 62/120 (52%), Gaps = 3/120 (3%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            K++K++ PS + DL ++ S+  A+    L A   +W+  +    P   KE    +  LTE
Sbjct  580  KTAKEKVPSWIPDLVIIVSYVKAITIGGLAARFLQWR-QQHSKAPGMSKEVEPEERNLTE  638

Query  426  -TNXSXDQELEIHFGARPNFQDIFAEFTNESRG-SYTGVFICGPESMKESVALACQLSSQ  253
                +  +E EIH G RP  +++  EF    R  S  GV +CGPE MKE+VA  C+   Q
Sbjct  639  LIPVAQIEEHEIHIGERPKLEEMLWEFEKNLREWSSIGVLVCGPEPMKEAVASMCRQRPQ  698



>ref|XP_006852345.1| hypothetical protein AMTR_s00049p00212370 [Amborella trichopoda]
 gb|ERN13812.1| hypothetical protein AMTR_s00049p00212370 [Amborella trichopoda]
Length=599

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/92 (33%), Positives = 48/92 (52%), Gaps = 0/92 (0%)
 Frame = -3

Query  540  ALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXSXDQELEIHFGARPNFQDI  361
            A++C A  AA+ RW+ +R +    +       + +L E          IH+  RP+F DI
Sbjct  483  AMICSASAAALLRWQKMRNETRTTSKIHGTNTELQLLEEQTPFCDNHTIHYRQRPDFHDI  542

Query  360  FAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            F+ +  +   S   V +CGPESM++SVA  C+
Sbjct  543  FSSYEKQEGESSVRVLVCGPESMQKSVASVCR  574



>ref|XP_001762405.1| ferric reductase-like transmembrane component [Physcomitrella 
patens]
 gb|EDQ72872.1| ferric reductase-like transmembrane component [Physcomitrella 
patens]
Length=801

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -3

Query  387  GARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            G+RP FQDIF E   +  G   GV +CGPES++ESVA AC+
Sbjct  740  GSRPQFQDIFKEVAEKHDGEDVGVLVCGPESLQESVAAACR  780



>ref|XP_002986459.1| hypothetical protein SELMODRAFT_425399 [Selaginella moellendorffii]
 gb|EFJ12316.1| hypothetical protein SELMODRAFT_425399 [Selaginella moellendorffii]
Length=470

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 44/95 (46%), Gaps = 12/95 (13%)
 Frame = -3

Query  516  AAVRRWKCLRKDMLPLADKE---SIALKPRLTETNXSXDQELEIHFGARPNFQDIFAEFT  346
            A +  W C +   L L D     SI+ +  L  T+        I  G RP FQDI  E  
Sbjct  380  ATILAWNCWKGKDLHLVDAPYVGSISAEVGLKPTS--------IQVGKRPEFQDIIPE-H  430

Query  345  NESRGSYTGVFICGPESMKESVALACQLSSQACKP  241
            ++ R  Y GVF CGPE M+ESV + CQ       P
Sbjct  431  SKGRKEYVGVFACGPEGMQESVGVLCQAHKLNFHP  465



>ref|XP_010477584.1| PREDICTED: ferric reduction oxidase 3, mitochondrial-like [Camelina 
sativa]
Length=722

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 15/121 (12%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +SSK  T ++   L  L + +++++  +++A +    C +K+     D+   A  P + E
Sbjct  600  QSSKKYT-AAYKSLIYLLAISISVVATSMVAML----CNKKNYYKEKDENDDAFSPLMIE  654

Query  426  TNXSXDQELE----IHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
            T  S DQ L     IH+G RPN + +         GS  GV +CGP  M+E VA  C   
Sbjct  655  T--SPDQLLSEVTNIHYGERPNLKKLLVGLN----GSSVGVLVCGPRKMREEVANICSFG  708

Query  258  S  256
            S
Sbjct  709  S  709



>gb|AAB72168.1| unknown [Arabidopsis thaliana]
Length=693

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +SSK+ T S+   L  L + +++++  + +A +   K   K +    D    AL P + E
Sbjct  571  QSSKEYT-SAYTSLIYLLAISISVVATSTVAMLCNKKSYFKGLYQNVD----ALSPLMIE  625

Query  426  TNXSXDQEL----EIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
            +  S DQ L     IH+G RPN   +        +GS  GV +CGP  M+E VA  C   
Sbjct  626  S--SPDQLLPEFTNIHYGERPNLNKLLVGL----KGSSVGVLVCGPRKMREEVAKICSFG  679

Query  258  SQA  250
            S A
Sbjct  680  SAA  682



>ref|NP_173715.2| ferric reduction oxidase 3 [Arabidopsis thaliana]
 gb|AEE30322.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=716

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +SSK+ T S+   L  L + +++++  + +A +    C +K       +   AL P + E
Sbjct  594  QSSKEYT-SAYTSLIYLLAISISVVATSTVAML----CNKKSYFKGLYQNVDALSPLMIE  648

Query  426  TNXSXDQEL----EIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
            +  S DQ L     IH+G RPN   +        +GS  GV +CGP  M+E VA  C   
Sbjct  649  S--SPDQLLPEFTNIHYGERPNLNKLLVGL----KGSSVGVLVCGPRKMREEVAKICSFG  702

Query  258  SQA  250
            S A
Sbjct  703  SAA  705



>ref|NP_001185067.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
 sp|F4I4K7.1|FRO3_ARATH RecName: Full=Ferric reduction oxidase 3, mitochondrial; Short=AtFRO3; 
AltName: Full=Ferric-chelate reductase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE30323.1| ferric reduction oxidase 3 [Arabidopsis thaliana]
Length=717

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/123 (31%), Positives = 59/123 (48%), Gaps = 15/123 (12%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +SSK+ T S+   L  L + +++++  + +A +    C +K       +   AL P + E
Sbjct  595  QSSKEYT-SAYTSLIYLLAISISVVATSTVAML----CNKKSYFKGLYQNVDALSPLMIE  649

Query  426  TNXSXDQEL----EIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
            +  S DQ L     IH+G RPN   +        +GS  GV +CGP  M+E VA  C   
Sbjct  650  S--SPDQLLPEFTNIHYGERPNLNKLLVGL----KGSSVGVLVCGPRKMREEVAKICSFG  703

Query  258  SQA  250
            S A
Sbjct  704  SAA  706



>ref|XP_010460078.1| PREDICTED: ferric reduction oxidase 3, mitochondrial [Camelina 
sativa]
Length=722

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 58/121 (48%), Gaps = 15/121 (12%)
 Frame = -3

Query  606  KSSKDETPSSVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKPRLTE  427
            +SSK  T ++   L  L + +++++  + +A +    C +K+     D+   A  P + E
Sbjct  600  QSSKKYT-AAYKSLIYLLAISISVVSTSTVAML----CNKKNYYKEKDENDDAFSPLMIE  654

Query  426  TNXSXDQELE----IHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
            T  S DQ L     IH+G RPN + +         GS  GV +CGP  M+E VA  C   
Sbjct  655  T--SPDQLLSEVTNIHYGERPNLEKLLVGLN----GSSIGVLVCGPRKMREEVANICSFG  708

Query  258  S  256
            S
Sbjct  709  S  709



>ref|XP_002968520.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
 gb|EFJ30774.1| hypothetical protein SELMODRAFT_145556 [Selaginella moellendorffii]
Length=667

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -3

Query  399  EIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            ++H+G+RP+  D+F  +    +GS  GVF CGP  M+ +VA  CQ
Sbjct  610  QVHYGSRPHLPDVFHAYAKRLQGSKVGVFACGPVEMQRTVASQCQ  654



>gb|KHN34351.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja]
Length=442

 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -3

Query  366  DIFAEFTNESRGSYTGVFICGPESMKESVALACQLSSQACK  244
            D F +  NE  GS +GV +CGPESMKESVA ACQ  S+  K
Sbjct  383  DTFGKLRNEIGGSISGVLVCGPESMKESVAFACQQESECFK  423



>ref|XP_010105755.1| Ferric reduction oxidase 4 [Morus notabilis]
 gb|EXC05975.1| Ferric reduction oxidase 4 [Morus notabilis]
Length=1351

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 33/118 (28%), Positives = 55/118 (47%), Gaps = 27/118 (23%)
 Frame = -3

Query  570  DLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIAL-KPRLTET----------  424
            DLFL+CS      C+ L+++V    C R + +     +++ + KP  +            
Sbjct  580  DLFLVCS------CICLVSSVAFVLCKRSNAMEDKQIQNVEMSKPTTSPAARSYVAAENK  633

Query  423  ------NXSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALAC  268
                  N S  + +++HFGARP+ + I  +    S+ S  GV +CGP  M+  VA  C
Sbjct  634  ELESLPNQSLIEAIKVHFGARPDLKKILFD----SKASDVGVLVCGPRKMRHEVAKIC  687



>ref|XP_009375514.1| PREDICTED: ferric reduction oxidase 4-like [Pyrus x bretschneideri]
Length=688

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/114 (32%), Positives = 53/114 (46%), Gaps = 24/114 (21%)
 Frame = -3

Query  567  LFLLCSFAMALLCVALIAAVRRWKCLRKD-----------MLPLADKESIALKPRLTETN  421
            +FL+CS      C+ L+++V    C R+             +P  D E     P   ET 
Sbjct  574  MFLVCS------CILLVSSVTFLWCKRQQNALEGKQIQNMEVPTHDVELEGF-PHHPETL  626

Query  420  XSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQLS  259
             +  Q  ++H+GARP+ + I  E    + GS  GVF+CGP  M+  VA  C  S
Sbjct  627  IA--QATQVHYGARPDLKKILLE----AEGSDIGVFVCGPRKMRHDVAKICSSS  674



>ref|XP_002968519.1| hypothetical protein SELMODRAFT_440376 [Selaginella moellendorffii]
 gb|EFJ30773.1| hypothetical protein SELMODRAFT_440376 [Selaginella moellendorffii]
Length=718

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (7%)
 Frame = -3

Query  432  TETNXSXDQE----LEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            T TN    +E    + +H+G RP+F  +FA     +     GVF CGP SM+E VA  CQ
Sbjct  639  TMTNVGSPEESLKPVSVHYGHRPDFASVFAGLAKSTINMNVGVFACGPMSMQEGVAALCQ  698



>ref|XP_002975965.1| hypothetical protein SELMODRAFT_416159 [Selaginella moellendorffii]
 gb|EFJ22870.1| hypothetical protein SELMODRAFT_416159 [Selaginella moellendorffii]
Length=718

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 4/60 (7%)
 Frame = -3

Query  432  TETNXSXDQE----LEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALACQ  265
            T TN    +E    + +H+G RP+F  +FA     +     GVF CGP SM+E VA  CQ
Sbjct  639  TMTNVGSPEESLKPVSVHYGHRPDFASVFAGLAKSTINMNVGVFACGPMSMQEGVAALCQ  698



>emb|CAN79355.1| hypothetical protein VITISV_010064 [Vitis vinifera]
Length=497

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 35/52 (67%), Gaps = 1/52 (2%)
 Frame = -3

Query  522  LIAAVRRWKCLRKDMLPLADKESIALKPRLTETNXSXDQELEIHFGARPNFQ  367
            ++A V RW+ LR+++ P++ KE  A K  L +T  +  +E EIHFG RPNFQ
Sbjct  415  IVAIVLRWRKLRREIPPVSQKEGKA-KEGLMDTRGTALEEHEIHFGGRPNFQ  465



>ref|XP_002967602.1| hypothetical protein SELMODRAFT_10731, partial [Selaginella moellendorffii]
 gb|EFJ30949.1| hypothetical protein SELMODRAFT_10731, partial [Selaginella moellendorffii]
Length=676

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 31/54 (57%), Gaps = 1/54 (2%)
 Frame = -3

Query  399  EIHFGARPNFQDIFAEFTNESR-GSYTGVFICGPESMKESVALACQLSSQACKP  241
            ++HFG RP++ +IF E     R G   GV  CGP+ ++ESVA  C+  S    P
Sbjct  620  DVHFGCRPDYPEIFFEHARRRRKGVSVGVMACGPQQLQESVAAECKAHSLGFHP  673



>gb|AIE44287.1| ferric reduction oxidase 6, partial [Ostryopsis davidiana]
Length=139

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 50/105 (48%), Gaps = 10/105 (10%)
 Frame = -3

Query  567  LFLLCSFAMALLCVALIAAVRR-W-------KCLRKDMLPLADKESIALKPRLTETNXSX  412
            LF++C  A   +   L+  +   W       +C    M  L D E+ A K + ++ N + 
Sbjct  35   LFIICMLASVFIFGGLVVGIWHLWGRNATREECEDDRMRMLQDNETAAHKDQSSQQNLAS  94

Query  411  DQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVA  277
                  ++G+RP+F++IF   + +      GV +CGP  ++ SVA
Sbjct  95   STN--TYYGSRPDFKEIFGSLSEKWGCVDAGVIVCGPPPLQSSVA  137



>ref|XP_010456303.1| PREDICTED: ferric reduction oxidase 2-like [Camelina sativa]
Length=720

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 11/111 (10%)
 Frame = -3

Query  579  SVIDLFLLCSFAMALLCVALIAAVRRWKCLRKDMLPLADKESIALKP-----RLTETN--  421
            S++ L +LC   M     A++   +++       +   D +S  L P     R  E++  
Sbjct  597  SILYLLVLCVSIMVTSSAAVLLNKKKYNAESSKQVQNVDVQSPTLSPSSWANREIESSPK  656

Query  420  XSXDQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVALAC  268
             S  Q   +HFG RP+ +    ++  E++GS  GV +CGP+ M++ VA  C
Sbjct  657  DSLVQCTNLHFGGRPDLK----KYLLETKGSSVGVMVCGPKKMRQEVATIC  703



>gb|AIE44289.1| ferric reduction oxidase 6, partial [Ostryopsis davidiana]
Length=139

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 50/105 (48%), Gaps = 10/105 (10%)
 Frame = -3

Query  567  LFLLCSFAMALLCVALIAAVRR-W-------KCLRKDMLPLADKESIALKPRLTETNXSX  412
            LF++C  A   +   L+  +   W       +C    M  L D E+ A K + ++ N + 
Sbjct  35   LFIICMLASVFIFGGLVVGIWHLWGRNATREECEDDRMRMLQDNETAAHKDQSSQQNLAS  94

Query  411  DQELEIHFGARPNFQDIFAEFTNESRGSYTGVFICGPESMKESVA  277
                  ++G+RP+F++IF   + +      GV +CGP  ++ SVA
Sbjct  95   STN--TYYGSRPDFKEIFGSVSEKWGCVDAGVIVCGPPPLQSSVA  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 842962938660