BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030M14

Length=711
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAR83896.1|  RNA helicase PRH75                                      156   3e-43   Capsicum annuum
ref|XP_009587639.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    157   1e-40   Nicotiana tomentosiformis
ref|XP_006357902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   5e-40   Solanum tuberosum [potatoes]
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7              155   7e-40   Morus notabilis
ref|XP_009767597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    155   9e-40   Nicotiana sylvestris
ref|XP_006348047.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    154   1e-39   Solanum tuberosum [potatoes]
ref|XP_004240751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    154   1e-39   Solanum lycopersicum
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    153   4e-39   Eucalyptus grandis [rose gum]
ref|XP_011101144.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    150   3e-38   Sesamum indicum [beniseed]
ref|XP_002510890.1|  dead box ATP-dependent RNA helicase, putative      150   5e-38   Ricinus communis
ref|XP_004234150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    150   5e-38   Solanum lycopersicum
ref|XP_004172086.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    149   9e-38   
emb|CBI24488.3|  unnamed protein product                                148   9e-38   Vitis vinifera
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    149   1e-37   Cucumis melo [Oriental melon]
ref|XP_009781160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    148   2e-37   Nicotiana sylvestris
ref|XP_002269873.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    148   2e-37   Vitis vinifera
ref|XP_009628541.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    148   3e-37   Nicotiana tomentosiformis
gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg                147   4e-37   Erythranthe guttata [common monkey flower]
ref|XP_011041667.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    147   5e-37   Populus euphratica
ref|XP_004143712.1|  PREDICTED: uncharacterized protein LOC101209696    149   1e-36   
ref|XP_010275981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    147   1e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010555319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    146   1e-36   Tarenaya hassleriana [spider flower]
emb|CDP05280.1|  unnamed protein product                                145   2e-36   Coffea canephora [robusta coffee]
gb|KDP22369.1|  hypothetical protein JCGZ_26200                         145   3e-36   Jatropha curcas
ref|XP_002322430.2|  DEAD box RNA helicase family protein               144   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_007143335.1|  hypothetical protein PHAVU_007G063700g             144   1e-35   Phaseolus vulgaris [French bean]
ref|XP_008376504.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    143   1e-35   Malus domestica [apple tree]
ref|XP_009349718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   2e-35   Pyrus x bretschneideri [bai li]
ref|XP_009343503.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    142   2e-35   Pyrus x bretschneideri [bai li]
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                   142   3e-35   Citrus sinensis [apfelsine]
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg             142   5e-35   Citrus clementina [clementine]
gb|AAF40306.1|AF156667_1  RNA helicase                                  141   7e-35   Vigna radiata [mung bean]
ref|XP_008234340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    140   1e-34   Prunus mume [ume]
ref|XP_008364874.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    140   1e-34   
ref|XP_007220217.1|  hypothetical protein PRUPE_ppa002304mg             140   1e-34   Prunus persica
emb|CDX87236.1|  BnaC09g05510D                                          140   1e-34   
gb|KFK27951.1|  hypothetical protein AALP_AA8G452500                    140   2e-34   Arabis alpina [alpine rockcress]
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                      140   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                   140   2e-34   Gossypium arboreum [tree cotton]
ref|XP_003556075.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    140   2e-34   Glycine max [soybeans]
emb|CAA68194.1|  RNA helicase                                           140   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318863.2|  DEAD box RNA helicase family protein               140   2e-34   
gb|AAK62631.1|  AT5g62190/mmi9_10                                       140   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KHN15708.1|  DEAD-box ATP-dependent RNA helicase 7                   140   3e-34   Glycine soja [wild soybean]
ref|XP_011030003.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   5e-34   Populus euphratica
ref|XP_009375829.1|  PREDICTED: TMV resistance protein N-like           138   5e-34   
gb|KJB39372.1|  hypothetical protein B456_007G009400                    138   6e-34   Gossypium raimondii
ref|XP_009398738.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   8e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009346936.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    139   8e-34   
ref|XP_007038495.1|  DEAD-box ATP-dependent RNA helicase 7              139   1e-33   
ref|XP_003592391.1|  DEAD-box ATP-dependent RNA helicase                137   1e-33   Medicago truncatula
ref|XP_008780349.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    134   2e-33   
gb|KJB39369.1|  hypothetical protein B456_007G009400                    137   2e-33   Gossypium raimondii
ref|XP_009345014.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-33   
ref|XP_009345013.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    138   3e-33   
gb|KJB52898.1|  hypothetical protein B456_008G282800                    135   1e-32   Gossypium raimondii
gb|KJB52899.1|  hypothetical protein B456_008G282800                    135   1e-32   Gossypium raimondii
gb|EYU25021.1|  hypothetical protein MIMGU_mgv1a027128mg                134   1e-32   Erythranthe guttata [common monkey flower]
gb|EPS64456.1|  hypothetical protein M569_10323                         135   1e-32   Genlisea aurea
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg             134   2e-32   Eutrema salsugineum [saltwater cress]
emb|CDY16789.1|  BnaA09g05930D                                          134   3e-32   Brassica napus [oilseed rape]
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg             134   3e-32   Capsella rubella
ref|XP_004506292.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-32   Cicer arietinum [garbanzo]
ref|XP_010934579.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   3e-32   Elaeis guineensis
ref|XP_009112011.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    134   4e-32   Brassica rapa
ref|XP_011076505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    135   4e-32   
ref|XP_008812489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    134   5e-32   Phoenix dactylifera
ref|XP_003536498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    133   5e-32   Glycine max [soybeans]
gb|KHN02770.1|  DEAD-box ATP-dependent RNA helicase 7                   133   5e-32   Glycine soja [wild soybean]
ref|XP_004308148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    132   2e-31   Fragaria vesca subsp. vesca
ref|XP_009407947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    130   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496647.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   5e-31   
ref|XP_004496646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   7e-31   Cicer arietinum [garbanzo]
ref|XP_004496645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    129   1e-30   
gb|KEH26427.1|  DEAD-box ATP-dependent RNA helicase                     129   2e-30   Medicago truncatula
gb|EMT03655.1|  DEAD-box ATP-dependent RNA helicase 7                   128   3e-30   
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_004957391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   3e-30   Setaria italica
ref|XP_006660856.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    128   5e-30   Oryza brachyantha
ref|XP_002460541.1|  hypothetical protein SORBIDRAFT_02g030210          128   5e-30   Sorghum bicolor [broomcorn]
ref|XP_010693660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    127   7e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    126   2e-29   Camelina sativa [gold-of-pleasure]
sp|Q41382.1|RH7_SPIOL  RecName: Full=DEAD-box ATP-dependent RNA h...    125   3e-29   Spinacia oleracea
gb|EMS52016.1|  DEAD-box ATP-dependent RNA helicase 7                   126   3e-29   Triticum urartu
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396             125   4e-29   Arabidopsis lyrata subsp. lyrata
ref|XP_006858006.1|  hypothetical protein AMTR_s00069p00191130          125   4e-29   Amborella trichopoda
gb|EAZ45398.1|  hypothetical protein OsJ_30047                          125   5e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063702.1|  Os09g0520700                                       125   6e-29   
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                   125   6e-29   Gossypium arboreum [tree cotton]
ref|XP_009628542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   8e-29   
ref|XP_009375806.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    117   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_008670328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    124   1e-28   Zea mays [maize]
ref|XP_008652955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    123   2e-28   Zea mays [maize]
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    123   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_008652953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    123   3e-28   Zea mays [maize]
gb|EAZ09787.1|  hypothetical protein OsI_32075                          123   3e-28   Oryza sativa Indica Group [Indian rice]
tpg|DAA40575.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    121   8e-28   
ref|XP_009130201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   2e-27   Brassica rapa
gb|KJB39370.1|  hypothetical protein B456_007G009400                    120   3e-27   Gossypium raimondii
ref|XP_010940916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    120   4e-27   Elaeis guineensis
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                   109   2e-23   Citrus sinensis [apfelsine]
tpg|DAA62341.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    102   4e-22   
ref|XP_011470438.1|  PREDICTED: metalloendopeptidase OMA1, mitoch...    102   2e-21   Fragaria vesca subsp. vesca
ref|XP_010650775.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.4    3e-21   Vitis vinifera
ref|XP_008652954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    102   3e-21   
gb|KEH43757.1|  GUCT (NUC152) domain protein                          99.4    6e-21   Medicago truncatula
ref|XP_003592393.1|  DEAD-box ATP-dependent RNA helicase                100   2e-20   
emb|CAN63086.1|  hypothetical protein VITISV_043401                   98.6    6e-20   Vitis vinifera
ref|XP_008813466.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  97.4    1e-19   
gb|KCW45478.1|  hypothetical protein EUGRSUZ_L00808                   97.1    1e-19   Eucalyptus grandis [rose gum]
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027           87.0    7e-16   
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370           86.3    9e-16   
ref|XP_001760070.1|  predicted protein                                84.7    3e-15   
ref|XP_001764376.1|  predicted protein                                84.7    4e-15   
gb|KCW88483.1|  hypothetical protein EUGRSUZ_A00875                   81.3    2e-14   Eucalyptus grandis [rose gum]
gb|KIZ06880.1|  cystathionine gamma-synthase                          79.3    3e-13   Monoraphidium neglectum
ref|XP_001742267.1|  hypothetical protein                             78.2    4e-13   Monosiga brevicollis MX1
ref|XP_005645158.1|  DEAD-domain-containing protein                   76.6    2e-12   Coccomyxa subellipsoidea C-169
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835            74.7    6e-12   Chlorella variabilis
ref|XP_005854803.1|  dead deah box rna                                71.6    7e-11   Nannochloropsis gaditana CCMP526
gb|EWM21167.1|  dead deah box rna                                     71.6    7e-11   Nannochloropsis gaditana
ref|XP_001702450.1|  RNA helicase                                     71.2    1e-10   Chlamydomonas reinhardtii
ref|XP_002610327.1|  hypothetical protein BRAFLDRAFT_144535           70.9    1e-10   Branchiostoma floridae
ref|XP_011399479.1|  DEAD-box ATP-dependent RNA helicase 7            70.5    2e-10   Auxenochlorella protothecoides
ref|XP_011408715.1|  PREDICTED: nucleolar RNA helicase 2-like         66.2    2e-10   
gb|ACF80222.1|  unknown                                               62.4    1e-09   Zea mays [maize]
ref|XP_004992590.1|  DEAD box polypeptide 47 isoform 1                67.0    2e-09   Salpingoeca rosetta
ref|XP_001755110.1|  predicted protein                                62.8    4e-09   
ref|XP_011406566.1|  PREDICTED: ATP-dependent RNA helicase DDX50-...  65.5    5e-09   
emb|CEI94647.1|  hypothetical protein RMCBS344292_08852               65.1    9e-09   Rhizopus microsporus
ref|XP_004344972.1|  nucleolar RNA helicase 2                         65.1    9e-09   Capsaspora owczarzaki ATCC 30864
gb|KFH66922.1|  hypothetical protein MVEG_07447                       64.7    1e-08   Mortierella verticillata NRRL 6337
emb|CEG65973.1|  hypothetical protein RMATCC62417_02639               64.7    1e-08   Rhizopus microsporus
ref|XP_002167654.2|  PREDICTED: nucleolar RNA helicase 2-like         63.9    2e-08   Hydra vulgaris
ref|XP_009035969.1|  hypothetical protein AURANDRAFT_895              63.9    2e-08   Aureococcus anophagefferens
emb|CEI86541.1|  hypothetical protein RMCBS344292_00980               63.2    4e-08   Rhizopus microsporus
gb|AAH73332.1|  LOC398189 protein                                     61.6    1e-07   Xenopus laevis [clawed frog]
emb|CBK20101.2|  unnamed protein product                              61.6    1e-07   Blastocystis hominis
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087            61.2    2e-07   Volvox carteri f. nagariensis
gb|EJY74800.1|  DEAD/DEAH box helicase family protein                 61.2    2e-07   Oxytricha trifallax
ref|XP_007512398.1|  predicted protein                                60.5    3e-07   Bathycoccus prasinos
gb|EIE87311.1|  hypothetical protein RO3G_12022                       60.1    4e-07   Rhizopus delemar RA 99-880
emb|CDS09503.1|  hypothetical protein LRAMOSA10863                    59.7    5e-07   Lichtheimia ramosa
emb|CDW87295.1|  nucleolar rna helicase 2                             59.7    7e-07   Stylonychia lemnae
ref|XP_002112077.1|  hypothetical protein TRIADDRAFT_55752            58.9    8e-07   Trichoplax adhaerens
ref|XP_002130533.1|  PREDICTED: nucleolar RNA helicase 2              58.9    1e-06   Ciona intestinalis [sea vase]
ref|NP_001082035.1|  RNA helicase II/Gu                               58.9    1e-06   Xenopus laevis [clawed frog]
ref|XP_002167666.2|  PREDICTED: nucleolar RNA helicase 2-like         58.2    2e-06   
emb|CDH59679.1|  nucleolar rna helicase 2-like                        58.2    2e-06   Lichtheimia corymbifera JMRC:FSU:9682
dbj|GAN03042.1|  nucleolar RNA helicase 2-like isoform X2             58.2    2e-06   Mucor ambiguus
ref|XP_009837773.1|  hypothetical protein H257_12310                  57.8    2e-06   Aphanomyces astaci
ref|NP_001039224.1|  nucleolar RNA helicase 2                         57.4    3e-06   Xenopus tropicalis [western clawed frog]
gb|AAI57756.1|  LOC734085 protein                                     57.4    3e-06   Xenopus tropicalis [western clawed frog]
ref|XP_003058076.1|  predicted protein                                57.4    3e-06   Micromonas pusilla CCMP1545
gb|KFH64685.1|  hypothetical protein MVEG_09417                       57.0    4e-06   Mortierella verticillata NRRL 6337
ref|XP_002507890.1|  predicted protein                                56.6    6e-06   Micromonas commoda
gb|EPB89647.1|  hypothetical protein HMPREF1544_03579                 56.2    7e-06   Mucor circinelloides f. circinelloides 1006PhL
emb|CEP17128.1|  hypothetical protein                                 56.2    8e-06   Parasitella parasitica
gb|AAI08449.1|  LOC398188 protein                                     55.8    1e-05   Xenopus laevis [clawed frog]
sp|Q9DF36.2|DD21B_XENLA  RecName: Full=Nucleolar RNA helicase 2-B...  55.8    1e-05   Xenopus laevis [clawed frog]
ref|NP_001082033.1|  nucleolar RNA helicase 2                         55.8    1e-05   Xenopus laevis [clawed frog]
ref|XP_786504.3|  PREDICTED: nucleolar RNA helicase 2-like            55.5    2e-05   
ref|XP_009010130.1|  hypothetical protein HELRODRAFT_190040           55.1    2e-05   Helobdella robusta
ref|XP_001012258.1|  DEAD/DEAH box helicase family protein            55.1    2e-05   
gb|EAR92013.2|  DEAD/DEAH-box helicase family protein                 55.1    2e-05   Tetrahymena thermophila SB210
emb|CBJ26838.1|  DEAD box helicase                                    54.3    4e-05   Ectocarpus siliculosus
emb|CCI44343.1|  unnamed protein product                              53.9    5e-05   Albugo candida
ref|XP_008873274.1|  hypothetical protein H310_09087                  53.9    5e-05   Aphanomyces invadans
ref|XP_008657391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.6    7e-05   Zea mays [maize]
ref|XP_008678603.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  50.4    7e-05   Zea mays [maize]
gb|KDO19871.1|  hypothetical protein SPRG_14901                       53.1    7e-05   Saprolegnia parasitica CBS 223.65
ref|XP_003078811.1|  putative RNA helicase (ISS)                      53.1    8e-05   Ostreococcus tauri
ref|XP_008674116.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  51.6    9e-05   
ref|XP_001417262.1|  predicted protein                                52.8    1e-04   Ostreococcus lucimarinus CCE9901
ref|XP_008611506.1|  hypothetical protein SDRG_07451                  52.4    2e-04   Saprolegnia diclina VS20
ref|XP_008678151.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.7    2e-04   Zea mays [maize]
ref|XP_008659659.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.3    2e-04   
ref|XP_004029989.1|  hypothetical protein IMG5_169500                 52.0    2e-04   Ichthyophthirius multifiliis
ref|XP_005713628.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...  51.2    4e-04   Chondrus crispus [carageen]
ref|XP_008674113.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...  49.3    6e-04   Zea mays [maize]
emb|CCA17723.1|  DEAD/DEAH box RNA helicase putative                  50.4    7e-04   Albugo laibachii Nc14



>gb|AAR83896.1| RNA helicase PRH75 [Capsicum annuum]
Length=212

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+TSDLSPA+LLAKALAKAAGY+EIK+RSLLTSMENCVTL LE G+P++SPSFV
Sbjct  57   AAAEELLNTSDLSPAELLAKALAKAAGYSEIKTRSLLTSMENCVTLLLECGRPIFSPSFV  116

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+VL+RFL EE  ESI GLTLTADG GAVFDVS + +D F+ G K A+ V LEVV+ LPP
Sbjct  117  YSVLRRFLPEEKVESINGLTLTADGKGAVFDVSADHLDEFLAGQKTAHGVKLEVVEALPP  176

Query  350  LQEREQ  333
            LQERE+
Sbjct  177  LQEREK  182



>ref|XP_009587639.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
tomentosiformis]
Length=692

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+TSDLSPA+LLAKALAKAAGY+EIK+RSLLTSMENCVTL LE G+P++SPSFV
Sbjct  528  AAAEELLNTSDLSPAELLAKALAKAAGYSEIKTRSLLTSMENCVTLLLECGRPIFSPSFV  587

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+VL+RFL EE  ESI GLTLTADG GAVFDVS ED+D F+ G K A+ V+LEVV+ LP 
Sbjct  588  YSVLRRFLPEEKVESINGLTLTADGKGAVFDVSAEDLDDFLAGQKTAHGVNLEVVEALPQ  647

Query  350  LQEREQ  333
            LQERE+
Sbjct  648  LQEREK  653



>ref|XP_006357902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=679

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 109/125 (87%), Gaps = 0/125 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE LL+TSDLSPA+LLAKALAKAAGY+EIK+RSLLTSMENCVTL LE G+P++SPSFVY
Sbjct  519  AAEELLNTSDLSPAELLAKALAKAAGYSEIKTRSLLTSMENCVTLLLECGRPIFSPSFVY  578

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            +VL+RFL EE  ESI GLTLTADG GAVFDV+ E +D F+ G K A+ V+LEVV+ LPPL
Sbjct  579  SVLRRFLPEEKVESINGLTLTADGKGAVFDVAAEHLDEFLSGHKTAHGVNLEVVEALPPL  638

Query  347  QEREQ  333
            QERE+
Sbjct  639  QEREK  643



>ref|XP_010109082.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
 gb|EXC20882.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
Length=703

 Score =   155 bits (392),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE LLSTS LS  +LLAKALAKAAGY+EIKSRSLLTSMEN VT+ LE+G+P+Y+PS+ Y
Sbjct  523  AAEELLSTSGLSAVELLAKALAKAAGYSEIKSRSLLTSMENYVTVLLEAGRPIYTPSYAY  582

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
             VL+RFL EE AES+KGLTLTADG GAVFDV+ ED+DTF+ G + A DVSLEV+K LP L
Sbjct  583  GVLRRFLPEEKAESVKGLTLTADGRGAVFDVALEDLDTFLTGQENAADVSLEVLKALPSL  642

Query  347  QEREQ  333
            QER+Q
Sbjct  643  QERDQ  647



>ref|XP_009767597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=692

 Score =   155 bits (391),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+TSDLSPA+LLAKALAKAAGY+EIK+RSLLTSMENCVTL LE G+P++SPSFV
Sbjct  528  AAAEELLNTSDLSPAELLAKALAKAAGYSEIKTRSLLTSMENCVTLLLECGRPIFSPSFV  587

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+VL+RFL  E  ESI GLTLTADG GAVFDVS ED+D F+ G K A+ V+LEVV+ LP 
Sbjct  588  YSVLRRFLPGEKVESINGLTLTADGKGAVFDVSAEDLDQFLAGQKTAHGVNLEVVEALPQ  647

Query  350  LQEREQ  333
            LQERE+
Sbjct  648  LQEREK  653



>ref|XP_006348047.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=683

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (87%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL TS+LSPA+LLAKALAKAAGY+EIKSRSLL+SMENCVTL LE G+P++SPSF 
Sbjct  515  AAAEELLHTSELSPAELLAKALAKAAGYSEIKSRSLLSSMENCVTLLLECGRPIFSPSFA  574

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            YNVL+ FLSEE  ESIKGLTLTADG GAVFDVS +D+DTF+ G K A  VSLEVVK LP 
Sbjct  575  YNVLRGFLSEEKVESIKGLTLTADGKGAVFDVSADDLDTFLAG-KNAQGVSLEVVKELPR  633

Query  350  LQEREQ  333
            LQE++Q
Sbjct  634  LQEKDQ  639



>ref|XP_004240751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Solanum lycopersicum]
Length=683

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+TSDLSPA+LLAKALAKAAGY+EIK+RSLLTSMENCVTL LE G+P++SPSFV
Sbjct  518  AAAEELLNTSDLSPAELLAKALAKAAGYSEIKTRSLLTSMENCVTLLLECGRPIFSPSFV  577

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+ L+RFL EE  ESI GLTLTADG GAVFDV+ E +D F+ G K A+ V++EVV+ LPP
Sbjct  578  YSFLRRFLPEEKVESINGLTLTADGKGAVFDVAAEHLDEFLSGQKTAHGVNIEVVEALPP  637

Query  350  LQEREQ  333
            LQERE+
Sbjct  638  LQEREK  643



>ref|XP_010034995.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Eucalyptus 
grandis]
 gb|KCW46257.1| hypothetical protein EUGRSUZ_K00136 [Eucalyptus grandis]
Length=703

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+TS +S  +LLAKALAKA+GY+EIKSRSLL+S+EN VTL LE+G+P+Y+PSF 
Sbjct  534  SAAEQLLNTSGMSAVELLAKALAKASGYSEIKSRSLLSSLENHVTLLLEAGRPIYTPSFA  593

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL E+  ES+KGLTLTADG G VFDV+ ED+DTF+ G + A +VSLEVVKTLP 
Sbjct  594  FGVLRRFLPEDKVESVKGLTLTADGNGVVFDVAAEDLDTFLAGQENAANVSLEVVKTLPR  653

Query  350  LQEREQ  333
            LQEREQ
Sbjct  654  LQEREQ  659



>ref|XP_011101144.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Sesamum 
indicum]
Length=701

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S+LSPADLLAKALAKAAGYTEIKSRSLLTSMEN VT+ LE G+PVY+PSF 
Sbjct  530  AAAQELLDSSELSPADLLAKALAKAAGYTEIKSRSLLTSMENYVTVLLECGRPVYTPSFA  589

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL E+  ESIKGL LTADG GAVFDV+ +D+DTF+ G + A  VSLEVVK+LP 
Sbjct  590  YGVLRRFLPEDKVESIKGLALTADGKGAVFDVAAQDLDTFLAGQENAAGVSLEVVKSLPR  649

Query  350  LQEREQ  333
            LQEREQ
Sbjct  650  LQEREQ  655



>ref|XP_002510890.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF51492.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=690

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL++S LS  +LLAKALA AAGYTEIKSRSLL+SMEN VTL LE+G+P+Y+PSF 
Sbjct  513  SAAEDLLNSSGLSAVELLAKALANAAGYTEIKSRSLLSSMENHVTLLLEAGRPIYTPSFA  572

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL E+  ES+KG+TLTADG GAVFDV+  D+DTF+ G   A +VSLE++K LPP
Sbjct  573  FGVLRRFLPEDKVESVKGMTLTADGKGAVFDVAAADIDTFLAGQDNAANVSLEILKALPP  632

Query  350  LQEREQ  333
            LQE++Q
Sbjct  633  LQEKDQ  638



>ref|XP_004234150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
lycopersicum]
Length=682

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL TS+LSPA+LLAKALAKAAGY+EIKSRSLL+SMENCVTL LE G+P++SPSF 
Sbjct  521  AAAEELLHTSELSPAELLAKALAKAAGYSEIKSRSLLSSMENCVTLLLECGRPIFSPSFA  580

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            YNVL+ FL+E+  ESIKGLTLTADG GAVFDVS +D+DTF+ G K A  VSLEVV  LP 
Sbjct  581  YNVLRGFLTEDKVESIKGLTLTADGKGAVFDVSADDLDTFLAG-KNAQGVSLEVVTELPR  639

Query  350  LQEREQ  333
            LQE++Q
Sbjct  640  LQEKDQ  645



>ref|XP_004172086.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cucumis 
sativus]
 gb|KGN50393.1| hypothetical protein Csa_5G171750 [Cucumis sativus]
Length=696

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE ++++S LS  +LLAKALAK +GYTEIKSRSLLTSMEN VTL LE GKP+YSPSF 
Sbjct  514  SAAEEMVNSSTLSAVELLAKALAKLSGYTEIKSRSLLTSMENYVTLILEPGKPMYSPSFA  573

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y++L+RFL EE  ES+KG++LTADG+ AVFDV TED+D F+ G   A DVS+EV+K+LP 
Sbjct  574  YSILRRFLPEEKVESVKGMSLTADGSSAVFDVQTEDLDAFLTGQANAADVSIEVLKSLPK  633

Query  350  LQEREQ  333
            LQ+REQ
Sbjct  634  LQDREQ  639



>emb|CBI24488.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   148 bits (374),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+TS LS  +LLAKALAKA+GYTEIKSRSLL S++N VT+ LE+GKP+Y+PSF 
Sbjct  380  SAAEELLNTSGLSAVELLAKALAKASGYTEIKSRSLLASLDNHVTVLLEAGKPIYTPSFA  439

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL E+  +SIKGL LTADG GAVFDV+TED+D F+ G + A +VSLEV+K LP 
Sbjct  440  YGVLRRFLPEDKVDSIKGLALTADGNGAVFDVATEDLDAFLAGQENAANVSLEVLKALPR  499

Query  350  LQEREQ  333
            LQER+Q
Sbjct  500  LQERDQ  505



>ref|XP_008467258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis melo]
Length=698

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE ++++S LS  +LLAKALAK +GYTEIKSRSLLTSMEN VTL LE GKP+YSPSF 
Sbjct  514  SAAEEMVNSSSLSAVELLAKALAKLSGYTEIKSRSLLTSMENHVTLILEPGKPIYSPSFA  573

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y++L+RFL EE  ES+KG++LTADG  AVFDV TED+D F+ G   A DVS+EV+K+LP 
Sbjct  574  YSILRRFLPEEKVESVKGMSLTADGYSAVFDVKTEDLDAFLTGQANAADVSIEVLKSLPK  633

Query  350  LQEREQ  333
            LQ+REQ
Sbjct  634  LQDREQ  639



>ref|XP_009781160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=682

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 108/126 (86%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+TS+LSPA+LLAKALAKAAGY+EIK+RSLL+SMENCVTL LE G+P+++PSF 
Sbjct  520  AAAEELLNTSELSPAELLAKALAKAAGYSEIKTRSLLSSMENCVTLLLECGRPIFAPSFA  579

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            YNVL+RFL E+  ESIKGLTLTADG GAVFDVS +D+D F+ G K    V+LEVVK LP 
Sbjct  580  YNVLRRFLPEDKVESIKGLTLTADGKGAVFDVSADDLDMFLAG-KNTQGVNLEVVKELPR  638

Query  350  LQEREQ  333
            LQE++Q
Sbjct  639  LQEKDQ  644



>ref|XP_002269873.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Vitis vinifera]
Length=711

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+TS LS  +LLAKALAKA+GYTEIKSRSLL S++N VT+ LE+GKP+Y+PSF 
Sbjct  527  SAAEELLNTSGLSAVELLAKALAKASGYTEIKSRSLLASLDNHVTVLLEAGKPIYTPSFA  586

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL E+  +SIKGL LTADG GAVFDV+TED+D F+ G + A +VSLEV+K LP 
Sbjct  587  YGVLRRFLPEDKVDSIKGLALTADGNGAVFDVATEDLDAFLAGQENAANVSLEVLKALPR  646

Query  350  LQEREQ  333
            LQER+Q
Sbjct  647  LQERDQ  652



>ref|XP_009628541.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=691

 Score =   148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL TS+LSPA+LLAKALAKAAGY+EIK+RSLL+SMENCVTL LE G+P+++PSF 
Sbjct  529  AAAEELLHTSELSPAELLAKALAKAAGYSEIKTRSLLSSMENCVTLLLECGRPIFAPSFA  588

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            YNVL+RFL E+  ESIKGLTLTADG GAVFDVS +D+D F+ G K    V+LEVVK LP 
Sbjct  589  YNVLRRFLPEDKVESIKGLTLTADGKGAVFDVSADDLDMFLAG-KNTQGVNLEVVKELPR  647

Query  350  LQEREQ  333
            LQE++Q
Sbjct  648  LQEKDQ  653



>gb|EYU19497.1| hypothetical protein MIMGU_mgv1a002250mg [Erythranthe guttata]
Length=695

 Score =   147 bits (372),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL T DLSP DLLAKALA+A GYTE+K+RS+LTSMEN VTLHLE G+ +YSPSFV
Sbjct  527  AAAEELLKTCDLSPTDLLAKALARAVGYTEMKTRSILTSMENHVTLHLECGRAMYSPSFV  586

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL E+  ESIKGL LTADG GAVFDV++ D+D F+ G   A  V L+VVKTLP 
Sbjct  587  YGVLRRFLPEDKVESIKGLALTADGKGAVFDVASADLDIFLAGKNNAAGVELQVVKTLPS  646

Query  350  LQERE  336
            LQERE
Sbjct  647  LQERE  651



>ref|XP_011041667.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=684

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LLSTS LS  +LLAKALAKA GYTEIKSRSLL+SMEN VTL LESGKP+Y+PSF 
Sbjct  508  SAAEDLLSTSGLSAVELLAKALAKATGYTEIKSRSLLSSMENHVTLLLESGKPIYTPSFA  567

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            ++VL+R L E+  ES+ G+TLT DG GAVFDV  EDVDTF+   +    VS+EVVKTLP 
Sbjct  568  FSVLRRILPEDKVESVTGMTLTTDGNGAVFDVKKEDVDTFLAAQENGAGVSIEVVKTLPS  627

Query  350  LQEREQ  333
            LQEREQ
Sbjct  628  LQEREQ  633



>ref|XP_004143712.1| PREDICTED: uncharacterized protein LOC101209696 [Cucumis sativus]
Length=1247

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = -2

Query  710   AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
             +AAE ++++S LS  +LLAKALAK +GYTEIKSRSLLTSMEN VTL LE GKP+YSPSF 
Sbjct  1065  SAAEEMVNSSTLSAVELLAKALAKLSGYTEIKSRSLLTSMENYVTLILEPGKPMYSPSFA  1124

Query  530   YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
             Y++L+RFL EE  ES+KG++LTADG+ AVFDV TED+D F+ G   A DVS+EV+K+LP 
Sbjct  1125  YSILRRFLPEEKVESVKGMSLTADGSSAVFDVQTEDLDAFLTGQANAADVSIEVLKSLPK  1184

Query  350   LQEREQ  333
             LQ+REQ
Sbjct  1185  LQDREQ  1190



>ref|XP_010275981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Nelumbo nucifera]
Length=745

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LLSTS LS A+LLAKALAKAAGYTEIKSRSLLTSMEN  T+ LE+G+  YSPSF 
Sbjct  564  SAAEELLSTSGLSAAELLAKALAKAAGYTEIKSRSLLTSMENYATVLLETGQTFYSPSFA  623

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+VL+RFL EE  E++KGLTLTADG GAVFDV +ED+DTFI G + A +VS+EVVK LP 
Sbjct  624  YSVLRRFLPEEKVETVKGLTLTADGNGAVFDVPSEDLDTFIAGQESAANVSIEVVKALPR  683

Query  350  LQERE  336
            LQER+
Sbjct  684  LQERD  688



>ref|XP_010555319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Tarenaya hassleriana]
Length=687

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL TS LS  +LLAKALAKAAG+TEIK RSLLTSMEN VTL LE+GKP+Y+PSF +
Sbjct  518  AAKELLETSGLSAEELLAKALAKAAGFTEIKKRSLLTSMENHVTLLLEAGKPIYTPSFAF  577

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
             VL+RF+ EE  +SI+G+TLTADG GAVFDV   D+DTF+EG + A +VSL+VVK LP L
Sbjct  578  GVLRRFMPEEKVDSIEGMTLTADGMGAVFDVPQSDLDTFLEGQQNAANVSLQVVKELPRL  637

Query  347  QEREQ  333
            QEREQ
Sbjct  638  QEREQ  642



>emb|CDP05280.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL+ S+LSP +LLAKALAKAAGY+EIKSRS+LTSMEN VTL LE G+P+Y+PSF 
Sbjct  536  AAAEELLNNSNLSPVELLAKALAKAAGYSEIKSRSILTSMENHVTLLLECGRPIYTPSFA  595

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+VL+RFL EE  ESIKGL LTADG GAVFDV+ ED+D F++G + A  VSL+VVK LP 
Sbjct  596  YSVLRRFLPEEKVESIKGLALTADGKGAVFDVAAEDLDLFLKGQEGAGGVSLDVVKLLPR  655

Query  350  LQEREQ  333
            LQ+R+Q
Sbjct  656  LQDRDQ  661



>gb|KDP22369.1| hypothetical protein JCGZ_26200 [Jatropha curcas]
Length=709

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS  +LLAKALAK AGYT+IKSRSLLTSMEN VTL LE+GKP+Y+PSF 
Sbjct  531  SAAEDLLNNSGLSAVELLAKALAKTAGYTDIKSRSLLTSMENHVTLLLEAGKPIYTPSFA  590

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + +L+RFL E+  ES+KG++LTADG GAVFDV+  DVD F+ G + A +VSLEV+K LP 
Sbjct  591  FGILRRFLPEDKVESVKGMSLTADGNGAVFDVAASDVDAFLAGQENAANVSLEVLKELPS  650

Query  350  LQEREQ  333
            LQE++Q
Sbjct  651  LQEKDQ  656



>ref|XP_002322430.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF06557.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=680

 Score =   144 bits (362),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+TS LS  +LLAKALAKA GYTEIKSRSLL+SMEN VTL LESGKP+Y+PSF 
Sbjct  510  SAAEDLLNTSGLSAVELLAKALAKATGYTEIKSRSLLSSMENHVTLLLESGKPIYTPSFA  569

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            ++VL+R L E+  ES+ G+TLT DG GAVFDV  EDVD F+   +    V++EVVKTLP 
Sbjct  570  FSVLRRILPEDKVESVTGMTLTTDGNGAVFDVKKEDVDAFLAAQENGAGVNIEVVKTLPS  629

Query  350  LQEREQ  333
            LQEREQ
Sbjct  630  LQEREQ  635



>ref|XP_007143335.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
 gb|ESW15329.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
Length=713

 Score =   144 bits (363),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            A AE LL +S L+  +LLAKALAKA GYTEIK RSLLTSMEN VTL LE GKP+++PSF 
Sbjct  537  ATAEELLKSSGLTVVELLAKALAKAVGYTEIKQRSLLTSMENHVTLLLEIGKPIFTPSFA  596

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y +L+RFL EE  E++KGL+LTADG GAVFDV  E++DT++ G + A +VSLEV+K LP 
Sbjct  597  YGILRRFLPEEKVEAVKGLSLTADGNGAVFDVPVEELDTYLSGQENAANVSLEVLKALPR  656

Query  350  LQEREQ  333
            LQ+REQ
Sbjct  657  LQQREQ  662



>ref|XP_008376504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Malus domestica]
Length=686

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  520  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTILLEAGKPIYSPSFA  579

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A +VS+EV+K+LP 
Sbjct  580  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDLFLAGQENAANVSIEVLKSLPD  639

Query  350  LQERE  336
            LQE+E
Sbjct  640  LQEKE  644



>ref|XP_009349718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  517  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  576

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A +VS+EV+K+LP 
Sbjct  577  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDLFLAGQENAANVSIEVLKSLPD  636

Query  350  LQERE  336
            LQE+E
Sbjct  637  LQEKE  641



>ref|XP_009343503.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  517  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  576

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A +VS+EV+K+LP 
Sbjct  577  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDLFLAGQENAANVSIEVLKSLPD  636

Query  350  LQERE  336
            LQE+E
Sbjct  637  LQEKE  641



>gb|KDO65342.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=652

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS A+LLAKALAKA GYTEIKSRSLL+S+E+ VT+ LE+GKP+Y+PSF 
Sbjct  474  SAAEELLNNSGLSAAELLAKALAKAVGYTEIKSRSLLSSLEDHVTVVLEAGKPIYTPSFA  533

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  E +KG+ LTADG GAVFDV   D+D F  GA  A +VSLEV+K LPP
Sbjct  534  FGVLRRFLPEEKVELVKGMALTADGNGAVFDVPVADLDLFRSGADNAANVSLEVLKQLPP  593

Query  350  LQEREQ  333
            LQEREQ
Sbjct  594  LQEREQ  599



>ref|XP_006421777.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 ref|XP_006490269.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Citrus 
sinensis]
 gb|ESR35017.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 gb|KDO65343.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=695

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS A+LLAKALAKA GYTEIKSRSLL+S+E+ VT+ LE+GKP+Y+PSF 
Sbjct  517  SAAEELLNNSGLSAAELLAKALAKAVGYTEIKSRSLLSSLEDHVTVVLEAGKPIYTPSFA  576

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  E +KG+ LTADG GAVFDV   D+D F  GA  A +VSLEV+K LPP
Sbjct  577  FGVLRRFLPEEKVELVKGMALTADGNGAVFDVPVADLDLFRSGADNAANVSLEVLKQLPP  636

Query  350  LQEREQ  333
            LQEREQ
Sbjct  637  LQEREQ  642



>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
Length=713

 Score =   141 bits (356),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LL +S L+  +LLAKALAKA GYTEIK RSLLTSMEN VTL LE GKP+++PSF Y 
Sbjct  539  AEELLKSSGLTVVELLAKALAKAVGYTEIKQRSLLTSMENYVTLLLEIGKPIFTPSFAYG  598

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +L+RFL EE  E++KGL+LTADG GAVFDV  ED++T++ G + A +VSLEV+K LP LQ
Sbjct  599  ILRRFLPEEKVEAVKGLSLTADGNGAVFDVPAEDLNTYLSGQENAANVSLEVLKALPRLQ  658

Query  344  EREQ  333
            +R+Q
Sbjct  659  QRDQ  662



>ref|XP_008234340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Prunus mume]
Length=690

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL TS+LS  +LLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  519  SVAEELLKTSELSAVELLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  578

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A  VS+EV+++LP 
Sbjct  579  YGVLRRFLPEEKVESVKGMALTADGKGAVFDVAAEDLDMFLAGQENAASVSIEVLESLPN  638

Query  350  LQERE  336
            LQE+E
Sbjct  639  LQEKE  643



>ref|XP_008364874.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Malus 
domestica]
Length=683

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKPVYSPSF 
Sbjct  514  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPVYSPSFA  573

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A +VS+ V+K+LP 
Sbjct  574  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDLFLAGQENAANVSITVLKSLPD  633

Query  350  LQERE  336
            LQE+E
Sbjct  634  LQEKE  638



>ref|XP_007220217.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
 gb|EMJ21416.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
Length=690

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL TS+LS  +LLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  519  SVAEELLKTSELSAVELLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  578

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A  VS+EV+++LP 
Sbjct  579  YGVLRRFLPEEKVESVKGMALTADGKGAVFDVAAEDLDMFLAGQENAASVSIEVLESLPN  638

Query  350  LQERE  336
            LQE+E
Sbjct  639  LQEKE  643



>emb|CDX87236.1| BnaC09g05510D [Brassica napus]
Length=637

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S +S   LLAKALAK AG+TEIK RSLLTSMEN VTL  E+GKP+Y+PSFV
Sbjct  476  AAAKELLESSGVSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLLFEAGKPIYTPSFV  535

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
               LKR L E+ A SI+GLTLTADG GAVFDV+  DVD FI  A+K   VSLEVVK LP 
Sbjct  536  IGSLKRILPEDKANSIEGLTLTADGQGAVFDVAQSDVDQFISAAQKTASVSLEVVKELPK  595

Query  350  LQERE  336
            LQERE
Sbjct  596  LQERE  600



>gb|KFK27951.1| hypothetical protein AALP_AA8G452500 [Arabis alpina]
Length=683

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S +S   LLAKA+AK AG+TEIK RSLLTSMEN VTLHLE+GKP+Y+PSF 
Sbjct  519  AAAKELLESSGVSAEVLLAKAIAKTAGFTEIKKRSLLTSMENFVTLHLEAGKPMYTPSFA  578

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLP  354
            + +L+RFL E+  ESI+G+ LTADG GAVFDV   DV+ FI  G K A  VSLEVVK +P
Sbjct  579  FGILRRFLPEDKVESIQGMALTADGQGAVFDVEQSDVEHFIAAGQKNAGSVSLEVVKEMP  638

Query  353  PLQERE  336
             LQERE
Sbjct  639  KLQERE  644



>ref|NP_201025.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 sp|Q39189.2|RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Arabidopsis 
thaliana]
 dbj|BAA97183.1| RNA helicase [Arabidopsis thaliana]
 gb|AAL07216.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAP40408.1| putative DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 gb|AED97579.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
Length=671

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL TS LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+GKP+YSPSFVY
Sbjct  505  AAKELLETSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENYVTLHLEAGKPIYSPSFVY  564

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKK-AYDVSLEVVKTLPP  351
             +L+R L ++  E I+GL+LTAD TGAVFDV   D+D FI GA+K A  +SLEVVK +P 
Sbjct  565  GLLRRVLPDDKVEMIEGLSLTADKTGAVFDVKQSDLDLFIAGAQKSAGSMSLEVVKVMPK  624

Query  350  LQERE  336
            LQERE
Sbjct  625  LQERE  629



>gb|KHG06829.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=695

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            A+ LL TS LS  DLLAKALAKAAGY+EIKSRSLLTSMEN VTL LE+GKP+Y+ SFV+ 
Sbjct  521  AQELLETSGLSAQDLLAKALAKAAGYSEIKSRSLLTSMENHVTLLLEAGKPIYTLSFVFG  580

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVK-TLPPL  348
            VLKRFL EE  +S++GLTLTADG GAVFDV+ +DV+TF+ GA+ A +V+LEV+K  LPPL
Sbjct  581  VLKRFLPEEKVQSVQGLTLTADGMGAVFDVAEDDVETFLTGAENAANVNLEVLKVALPPL  640

Query  347  QERE  336
            Q+R+
Sbjct  641  QQRD  644



>ref|XP_003556075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=693

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S L   +LLAKALAKA GYTE+K RSLLTSMEN VTL LE+GKP+Y+ SF 
Sbjct  521  SAAEDLLNNSGLPVIELLAKALAKAVGYTEVKQRSLLTSMENYVTLLLETGKPIYTQSFA  580

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL EE  E++KGL++TADG G VFDV+ +D+D ++ G + A +VSLE+VKTLP 
Sbjct  581  YGVLRRFLPEEKVEAVKGLSITADGNGVVFDVAAKDLDIYLNGQENASNVSLEIVKTLPQ  640

Query  350  LQEREQ  333
            LQ+ EQ
Sbjct  641  LQQMEQ  646



>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
Length=671

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL TS LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+GKP+YSPSFVY
Sbjct  505  AAKELLETSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENYVTLHLEAGKPIYSPSFVY  564

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKK-AYDVSLEVVKTLPP  351
             +L+R L ++  E I+GL+LTAD TGAVFDV   D+D FI GA+K A  +SLEVVK +P 
Sbjct  565  GLLRRVLPDDKVEMIEGLSLTADKTGAVFDVKQSDLDLFIAGAQKSAGSMSLEVVKVMPK  624

Query  350  LQERE  336
            LQERE
Sbjct  625  LQERE  629



>ref|XP_002318863.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE97083.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=687

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE+LLSTS LS  +LLAKALAKA GYTEIKSRSLLTSM+N VTL LESGKP+Y+PSF 
Sbjct  506  SAAENLLSTSGLSAVELLAKALAKATGYTEIKSRSLLTSMDNHVTLLLESGKPIYTPSFA  565

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            ++V++R L E+  ES+ G++LTADG GAVFDV  EDVDTF+   + A  V++EVVK LP 
Sbjct  566  FSVMRRILPEDKVESVTGMSLTADGNGAVFDVKKEDVDTFLAAQENAAGVNIEVVKVLPS  625

Query  350  LQE  342
            LQE
Sbjct  626  LQE  628



>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
Length=671

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL TS LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+GKP+YSPSFVY
Sbjct  505  AAKELLETSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENYVTLHLEAGKPIYSPSFVY  564

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKK-AYDVSLEVVKTLPP  351
             +L+R L ++  E I+GL+LTAD TGAVFDV   D+D FI GA+K A  +SLEVVK +P 
Sbjct  565  GLLRRVLPDDKVEMIEGLSLTADKTGAVFDVKQSDLDLFIAGAQKSAGSMSLEVVKVMPK  624

Query  350  LQERE  336
            LQERE
Sbjct  625  LQERE  629



>gb|KHN15708.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=694

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S L   +LLAKALAKA GYTE+K RSLLTSMEN VTL LE+GKP+Y+ SF 
Sbjct  522  SAAEDLLNNSGLPVIELLAKALAKAVGYTEVKQRSLLTSMENYVTLLLETGKPIYTQSFA  581

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y VL+RFL EE  E++KGL++TADG G VFDV+ +D+D ++ G + A +VSLE+VKTLP 
Sbjct  582  YGVLRRFLPEEKVEAVKGLSITADGNGVVFDVAAKDLDIYLNGQENASNVSLEIVKTLPQ  641

Query  350  LQEREQ  333
            LQ+ EQ
Sbjct  642  LQQMEQ  647



>ref|XP_011030003.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=685

 Score =   139 bits (350),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LLSTS LS  +LLAKALAKA GYTEIKSRSLLTSMEN VTL LESGKP+++PSF 
Sbjct  506  SAAEDLLSTSGLSAVELLAKALAKATGYTEIKSRSLLTSMENHVTLLLESGKPIHTPSFA  565

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            ++V++R L E+  ES+ G++LTADG GAVFDV  EDVDTF+   + A  V++EVVK LP 
Sbjct  566  FSVMRRILPEDKVESVTGMSLTADGNGAVFDVKKEDVDTFLAAQENAAGVNIEVVKALPS  625

Query  350  LQE  342
            LQE
Sbjct  626  LQE  628



>ref|XP_009375829.1| PREDICTED: TMV resistance protein N-like [Pyrus x bretschneideri]
Length=595

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  427  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  486

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV  ED+D F+ G + A +VS+ V+K+LP 
Sbjct  487  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVVAEDLDLFLAGQENAANVSITVLKSLPY  546

Query  350  LQERE  336
            LQE+E
Sbjct  547  LQEKE  551



>gb|KJB39372.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=605

 Score =   138 bits (347),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            A+ LL TS LS  DLLAKALAKAAGY+EIKSRSLL+SMEN VTL LE+GKP+Y+ SFV+ 
Sbjct  431  AQELLETSGLSAQDLLAKALAKAAGYSEIKSRSLLSSMENHVTLLLEAGKPIYTLSFVFG  490

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKT-LPPL  348
            VLKRFL EE  +S++GLTLTADG GAVFDV+ +DV+ F+ GA+ A +V+LEV+K  LPPL
Sbjct  491  VLKRFLPEEKVQSVQGLTLTADGMGAVFDVAEDDVEAFLTGAENAANVNLEVLKNALPPL  550

Query  347  QERE  336
            Q+R+
Sbjct  551  QQRD  554



>ref|XP_009398738.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=716

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS  D+LAKALAKAAG+T+IK RSLL+SMEN VTL L++G+P+YSPSF ++
Sbjct  536  AEHLLSSSGLSAVDILAKALAKAAGFTDIKKRSLLSSMENYVTLLLQTGRPIYSPSFAFS  595

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
              +RFL ++  E +KGL+LTADGTGAVFDV  +DVD F+EG + A+ V++EV++ LPPLQ
Sbjct  596  TFRRFLPDDKIEGVKGLSLTADGTGAVFDVPADDVDAFLEGQENAHSVNIEVLEKLPPLQ  655

Query  344  EREQ  333
            +R+Q
Sbjct  656  DRDQ  659



>ref|XP_009346936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=860

 Score =   139 bits (351),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  692  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  751

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D F+ G + A +VS+ V+K+LP 
Sbjct  752  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDLFLAGQENAANVSITVLKSLPD  811

Query  350  LQERE  336
            LQE+E
Sbjct  812  LQEKE  816



>ref|XP_007038495.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
 gb|EOY22996.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
Length=1077

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 1/127 (1%)
 Frame = -2

Query  710   AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
             + A+ LL TS LS  DLLAKALAKAAGY+EIKSRSLLTSMEN VTL LE+GKP+Y+ SFV
Sbjct  891   SVAQELLETSGLSAEDLLAKALAKAAGYSEIKSRSLLTSMENHVTLLLEAGKPIYTLSFV  950

Query  530   YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKT-LP  354
             + VLKRFL EE  +S++G+TLTADG GAVFDV+ EDV+TF+ GA+ A +VSLEV+K  LP
Sbjct  951   FGVLKRFLPEEKVQSVQGMTLTADGMGAVFDVAEEDVETFLAGAENAANVSLEVLKKELP  1010

Query  353   PLQEREQ  333
              LQER+Q
Sbjct  1011  RLQERDQ  1017



>ref|XP_003592391.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62642.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=641

 Score =   137 bits (346),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS  DL AKALAKA GYTEIK RSLL+SMEN VTL LE+ KP+++P+F 
Sbjct  467  SAAEELLNNSGLSVVDLFAKALAKAVGYTEIKKRSLLSSMENYVTLLLENEKPIFTPTFA  526

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y +L+RFL EE  E++KGLT+TADG G VFDV+ ED+DT++ G +   DV LEV+K LP 
Sbjct  527  YKILRRFLPEEKVEAVKGLTITADGNGVVFDVAAEDLDTYLAGKENVSDVRLEVLKELPR  586

Query  350  LQEREQ  333
            LQ+R+Q
Sbjct  587  LQQRDQ  592



>ref|XP_008780349.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7 [Phoenix dactylifera]
Length=385

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/124 (63%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS  DLLAKALAKAAGYT+IK RSLL+SMEN  TL L +GKP+YSPSF Y+
Sbjct  241  AEQLLSSSGLSVVDLLAKALAKAAGYTDIKKRSLLSSMENYATLLLHAGKPIYSPSFAYS  300

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +L+RFL +E  E +KGL+LTADG GAVFDV  +DVD+FI G + A  +++EV++ LPPLQ
Sbjct  301  ILRRFLPDEKVERVKGLSLTADGKGAVFDVPADDVDSFIAGQENANMMNIEVLEKLPPLQ  360

Query  344  EREQ  333
            ++++
Sbjct  361  DKDR  364



>gb|KJB39369.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=697

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            A+ LL TS LS  DLLAKALAKAAGY+EIKSRSLL+SMEN VTL LE+GKP+Y+ SFV+ 
Sbjct  523  AQELLETSGLSAQDLLAKALAKAAGYSEIKSRSLLSSMENHVTLLLEAGKPIYTLSFVFG  582

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKT-LPPL  348
            VLKRFL EE  +S++GLTLTADG GAVFDV+ +DV+ F+ GA+ A +V+LEV+K  LPPL
Sbjct  583  VLKRFLPEEKVQSVQGLTLTADGMGAVFDVAEDDVEAFLTGAENAANVNLEVLKNALPPL  642

Query  347  QERE  336
            Q+R+
Sbjct  643  QQRD  646



>ref|XP_009345014.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=382

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 102/125 (82%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SME+ VT+ LE+GKP+YSPSF 
Sbjct  214  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMEDHVTVLLEAGKPIYSPSFA  273

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVF V++ED+D F+ G + A +VS+ V+K+LP 
Sbjct  274  FGVLRRFLPEEKVESVKGMALTADGNGAVFYVASEDLDLFLAGQENAANVSITVLKSLPY  333

Query  350  LQERE  336
            LQE+E
Sbjct  334  LQEKE  338



>ref|XP_009345013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=858

 Score =   138 bits (347),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS LS  DLLAKALAKAAGYTEIK RSLL+SMEN VT+ LE+GKP+YSPSF 
Sbjct  690  SVAEELLNTSGLSAVDLLAKALAKAAGYTEIKKRSLLSSMENHVTVLLEAGKPIYSPSFA  749

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL EE  ES+KG+ LTADG GAVFDV  ED+D F+ G + A +VS+ V+K+LP 
Sbjct  750  FGVLRRFLPEEKVESVKGMALTADGNGAVFDVVAEDLDLFLAGQENAANVSITVLKSLPD  809

Query  350  LQERE  336
            LQE+E
Sbjct  810  LQEKE  814



>gb|KJB52898.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=704

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GY+EIKSRSLLTSMEN VTL LE+GKP+Y+ SFV+ VLKRFL EE   S++GLTLTADG 
Sbjct  549  GYSEIKSRSLLTSMENHVTLLLEAGKPIYTLSFVFGVLKRFLPEEKVHSVQGLTLTADGM  608

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVV-KTLPPLQEREQ  333
            GAVFDV+ +DV TF+ GA+ A +V LE + K LP LQER+Q
Sbjct  609  GAVFDVAEDDVGTFLAGAENANNVRLETLKKKLPRLQERDQ  649



>gb|KJB52899.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=705

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GY+EIKSRSLLTSMEN VTL LE+GKP+Y+ SFV+ VLKRFL EE   S++GLTLTADG 
Sbjct  550  GYSEIKSRSLLTSMENHVTLLLEAGKPIYTLSFVFGVLKRFLPEEKVHSVQGLTLTADGM  609

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVV-KTLPPLQEREQ  333
            GAVFDV+ +DV TF+ GA+ A +V LE + K LP LQER+Q
Sbjct  610  GAVFDVAEDDVGTFLAGAENANNVRLETLKKKLPRLQERDQ  650



>gb|EYU25021.1| hypothetical protein MIMGU_mgv1a027128mg [Erythranthe guttata]
Length=591

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL++S LSP +LLAKALA AAGYTEIK RSLLTSMEN VT+ +E G+P+Y+ SF 
Sbjct  416  AAAEELLNSSALSPIELLAKALANAAGYTEIKRRSLLTSMENFVTVLVECGRPIYTASFA  475

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKA-YDVSLEVVKTLP  354
            Y VL+RFL EE  ES+KGL LTADG GAVFDV++ED+D FI G K A   V LEV+K+LP
Sbjct  476  YGVLRRFLPEEKVESVKGLALTADGKGAVFDVASEDLDIFIAGQKNAGGGVKLEVLKSLP  535

Query  353  PLQE  342
             LQE
Sbjct  536  RLQE  539



>gb|EPS64456.1| hypothetical protein M569_10323 [Genlisea aurea]
Length=693

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL++S+LS A+LLAKALAKAAGYTEIK+RSLL+SMEN VT+ LE G  ++SPSF 
Sbjct  510  AAAEDLLNSSELSAAELLAKALAKAAGYTEIKTRSLLSSMENYVTVVLECGSQIHSPSFA  569

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            + VL+RFL E   +SIKGL LTADG GAVFDV++E +D F+ G   A  V LEVVKTLP 
Sbjct  570  FGVLRRFLPEGKVDSIKGLALTADGRGAVFDVASEHLDAFLAGQNNAAGVRLEVVKTLPQ  629

Query  350  LQEREQ  333
            LQERE 
Sbjct  630  LQEREN  635



>ref|XP_006394423.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
 gb|ESQ31709.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
Length=679

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 96/126 (76%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL TS LS   LLAKALAK AG+TEIK RS+LTSMEN VTL LE+G+P+YSPS  
Sbjct  517  AAAKELLETSGLSAEVLLAKALAKTAGFTEIKKRSVLTSMENSVTLLLEAGRPMYSPSAA  576

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLP  354
            +  L+RFL E+   SI+GLTLTADG GAVFDV+  DVD FI  G K A  VSLEVVK LP
Sbjct  577  FTTLRRFLPEDKVNSIEGLTLTADGQGAVFDVAQSDVDLFIAAGQKNAGSVSLEVVKELP  636

Query  353  PLQERE  336
             LQERE
Sbjct  637  KLQERE  642



>emb|CDY16789.1| BnaA09g05930D [Brassica napus]
Length=635

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S +S   LLAKALAK AG+TEIK RSLL+S+EN VTL  E+GKP+Y+PSFV
Sbjct  475  AAAKELLESSGVSAEVLLAKALAKTAGFTEIKKRSLLSSLENHVTLLFEAGKPIYTPSFV  534

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            +  LKR L E+   +I+G TLTADG GAVFDV+  DVD F+  A+K   VSLE+VK LP 
Sbjct  535  FGALKRILPEDKVNTIEGFTLTADGQGAVFDVAQSDVDQFMSAAQKTASVSLEIVKELPK  594

Query  350  LQERE  336
            LQERE
Sbjct  595  LQERE  599



>ref|XP_006279587.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
 gb|EOA12485.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
Length=668

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA  LL TS LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+GKP++SPSFVY
Sbjct  505  AATELLKTSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLHLEAGKPIFSPSFVY  564

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKK-AYDVSLEVVKTLPP  351
             +L+R + E+  E I+GL+LTAD TGAVFDV   D+D F+  A+K A  +SLEVVK LP 
Sbjct  565  GMLRRNIPEDKVERIEGLSLTADKTGAVFDVVQSDLDLFLAAAQKSAGSMSLEVVKELPK  624

Query  350  LQERE  336
            LQERE
Sbjct  625  LQERE  629



>ref|XP_004506292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cicer 
arietinum]
Length=680

 Score =   134 bits (336),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 75/126 (60%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS  +LLAKALAK  GYTEIK RSLLTSMEN VTL LE GKP+++PSF 
Sbjct  513  SAAEDLLNNSGLSAVELLAKALAKCVGYTEIKKRSLLTSMENYVTLLLEGGKPMFTPSFA  572

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            +  L+RF+ E+  ++++GL LTADG GAVFDV  +D+D ++ G K A +V+L+VVK LP 
Sbjct  573  FGTLRRFIPEDKVDAVQGLALTADGQGAVFDVPAKDLDIYLNGQKNAVNVTLKVVKELPS  632

Query  350  LQEREQ  333
            LQ+RE+
Sbjct  633  LQQREE  638



>ref|XP_010934579.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=720

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS  DLLAKALAKAAGYT+IK RSLL+SMEN VTL L++GK +YSPS  ++
Sbjct  547  AEQLLSSSGLSAVDLLAKALAKAAGYTDIKKRSLLSSMENYVTLLLQAGKTIYSPSLAFS  606

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +L+RF+ +E  E +KGL+LTADGTGAVFDV  + VD FIEG + A  V++EV+K+LPPLQ
Sbjct  607  ILRRFMPDEKIEGVKGLSLTADGTGAVFDVPADHVDAFIEGQENANMVTIEVLKSLPPLQ  666

Query  344  EREQ  333
             ++Q
Sbjct  667  AKDQ  670



>ref|XP_009112011.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7-like [Brassica rapa]
Length=655

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S +S   LLAKALAK AG+TEIK RSLL+S+EN VTL  E+GKP+Y+PSFV
Sbjct  495  AAAKELLESSGVSAEVLLAKALAKTAGFTEIKKRSLLSSLENHVTLLFEAGKPIYTPSFV  554

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            +  LKR L E+   +I+G TLTADG GAVFDV+  DVD F+  A+K   VSLE+VK LP 
Sbjct  555  FGALKRILPEDKVNTIEGFTLTADGQGAVFDVAQSDVDQFMSAAQKTASVSLEIVKELPK  614

Query  350  LQERE  336
            LQERE
Sbjct  615  LQERE  619



>ref|XP_011076505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Sesamum indicum]
Length=1167

 Score =   135 bits (339),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = -2

Query  710   AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
             AAAE LL++S LSP +LLAKALAKAAGYTEIKSRSLLTSMEN VT+ L+ G+P+Y+ SF 
Sbjct  965   AAAEELLNSSVLSPTELLAKALAKAAGYTEIKSRSLLTSMENYVTVLLQCGRPIYTLSFA  1024

Query  530   YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
             Y VL+RFL EE  ESIKGL LTADG GAVFDV+  D+D F+   K A  + LE VK+LP 
Sbjct  1025  YGVLRRFLPEENVESIKGLALTADGKGAVFDVAAADLDNFLACKKNAAGIKLEEVKSLPR  1084

Query  350   LQEREQ  333
             L+ER+Q
Sbjct  1085  LRERDQ  1090



>ref|XP_008812489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=718

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 101/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS  DLLAKALAKAAGYT+IK RSLL+SMEN VTL LE+GK +YSPS  ++
Sbjct  547  AEELLSSSGLSAVDLLAKALAKAAGYTDIKKRSLLSSMENYVTLLLEAGKTIYSPSVAFS  606

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +LKRF+ +E  E +KGL+LTADG GAVFDV  +DVD FIEG + A  V++EV+K+LP LQ
Sbjct  607  ILKRFMPDEKIEGVKGLSLTADGMGAVFDVPADDVDAFIEGQENANMVTIEVLKSLPSLQ  666

Query  344  EREQ  333
            +++Q
Sbjct  667  DKDQ  670



>ref|XP_003536498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=697

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL++S L   +LLAKALAKA GYT++K RSLLTSMEN VTL LE+GKP+Y+ S+ 
Sbjct  526  SAAEELLNSSGLPVIELLAKALAKAVGYTDVKQRSLLTSMENYVTLVLETGKPIYTQSYG  585

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y++L+RFL EE  E++KGL+LTADG G VFDV  +D+D ++ G + A +V LEVVKTLP 
Sbjct  586  YSILRRFLPEEKVEAVKGLSLTADGNGVVFDVPAKDLDIYLNGQENASNVCLEVVKTLPQ  645

Query  350  LQERE  336
            LQ++E
Sbjct  646  LQQKE  650



>gb|KHN02770.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=701

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL++S L   +LLAKALAKA GYT++K RSLLTSMEN VTL LE+GKP+Y+ S+ 
Sbjct  526  SAAEELLNSSGLPVIELLAKALAKAVGYTDVKQRSLLTSMENYVTLVLETGKPIYTQSYG  585

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y++L+RFL EE  E++KGL+LTADG G VFDV  +D+D ++ G + A +V LEVVKTLP 
Sbjct  586  YSILRRFLPEEKVEAVKGLSLTADGNGVVFDVPAKDLDIYLNGQENASNVCLEVVKTLPQ  645

Query  350  LQERE  336
            LQ++E
Sbjct  646  LQQKE  650



>ref|XP_004308148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Fragaria vesca 
subsp. vesca]
Length=680

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL TS LS  DLL+KALAKAAGYT++K RSLL+SMEN VT+ LE+GKP+Y+ SF 
Sbjct  516  SVAEELLKTSGLSAVDLLSKALAKAAGYTDVKKRSLLSSMENHVTVLLEAGKPIYTASFA  575

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            Y+ L+RFL EE  ES+KG+ LT DG GAVFDV+ ED+D F+ GA  A  +S++V+ +LP 
Sbjct  576  YSALRRFLPEEKVESVKGMALTTDGKGAVFDVAAEDLDMFLRGADNAAGISIQVLDSLPS  635

Query  350  LQERE  336
            LQE+E
Sbjct  636  LQEKE  640



>ref|XP_009407947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 100/124 (81%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S+LS  DLLAKALAKA G+T+IK RSLL+SMEN VTL L++GK +YSPSF ++
Sbjct  532  AEQLLSSSELSAVDLLAKALAKAVGFTDIKKRSLLSSMENYVTLLLQTGKIIYSPSFAFS  591

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
              +RFL +E  E +KGL+LTADGTGAVFDV  +DV+ F+EG + A  VS+EV++ LPPLQ
Sbjct  592  TFRRFLPDEKIEGVKGLSLTADGTGAVFDVPADDVNAFLEGQENAQSVSIEVLEKLPPLQ  651

Query  344  EREQ  333
            + ++
Sbjct  652  DTDR  655



>ref|XP_004496647.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Cicer arietinum]
Length=582

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYTEIK RS LTSMEN VTL LE+G+P+++ +  Y +L+RFL  +  E++KGLT+TADG 
Sbjct  430  GYTEIKKRSHLTSMENYVTLLLETGRPIFTQTLAYKILRRFLPGDKVEAVKGLTITADGN  489

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV  ED+DT++ G + A DVSLEV+K LP LQ+R+Q
Sbjct  490  GVVFDVPAEDLDTYLAGKENASDVSLEVLKALPLLQQRDQ  529



>ref|XP_004496646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Cicer arietinum]
Length=631

 Score =   129 bits (325),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LL  S LS  +LLAKALAKA GYTEIK RS LTSMEN VTL LE+G+P+++ +  Y 
Sbjct  455  AEELLKNSGLSVVELLAKALAKAVGYTEIKKRSHLTSMENYVTLLLETGRPIFTQTLAYK  514

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +L+RFL  +  E++KGLT+TADG G VFDV  ED+DT++ G + A DVSLEV+K LP LQ
Sbjct  515  ILRRFLPGDKVEAVKGLTITADGNGVVFDVPAEDLDTYLAGKENASDVSLEVLKALPLLQ  574

Query  344  EREQ  333
            +R+Q
Sbjct  575  QRDQ  578



>ref|XP_004496645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Cicer arietinum]
Length=666

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYTEIK RS LTSMEN VTL LE+G+P+++ +  Y +L+RFL  +  E++KGLT+TADG 
Sbjct  514  GYTEIKKRSHLTSMENYVTLLLETGRPIFTQTLAYKILRRFLPGDKVEAVKGLTITADGN  573

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV  ED+DT++ G + A DVSLEV+K LP LQ+R+Q
Sbjct  574  GVVFDVPAEDLDTYLAGKENASDVSLEVLKALPLLQQRDQ  613



>gb|KEH26427.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=681

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS  +LLAKALAKA GYTE+K+RSLLTSME  VTL LE GKP+++PSF 
Sbjct  510  SAAEQLLNNSGLSAVELLAKALAKAVGYTEVKNRSLLTSMEGYVTLILEGGKPMFTPSFA  569

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            +  L+RF+ E+  ++++GL LTADG GAVFDV  +D+D F+   K A +VSL+V K LP 
Sbjct  570  FGTLRRFVPEDKVDAVQGLALTADGLGAVFDVPAKDLDIFLSSQKNAVNVSLKVAKELPS  629

Query  350  LQEREQ  333
            LQ+RE+
Sbjct  630  LQQREE  635



>gb|EMT03655.1| DEAD-box ATP-dependent RNA helicase 7 [Aegilops tauschii]
Length=687

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS S +S  DLLAKALAKA GYT+IK RSLL+SMEN  TLHL++G+P+Y+PSFV +
Sbjct  519  AEELLSNSSMSAVDLLAKALAKAVGYTDIKKRSLLSSMENHTTLHLQTGRPLYTPSFVIS  578

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ E+   S+ G+TLT DGT AVFDV + +V  +I+GA+ A  V+++ VK LP LQ
Sbjct  579  TLKRFMPEDRLSSLHGITLTTDGTSAVFDVPSAEVQDYIQGAENAAGVTIDEVKQLPALQ  638

Query  344  EREQ  333
            EREQ
Sbjct  639  EREQ  642



>ref|XP_010458375.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010458382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Camelina sativa]
Length=679

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA++LL +S LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+G+ +YSPS+VY
Sbjct  511  AAKNLLESSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLHLEAGREIYSPSYVY  570

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLPP  351
             +L+R L E+  E I+GL+LTAD +GAVFDV   D+D F+  G K A  +SLEVVK +P 
Sbjct  571  GMLRRVLPEDKVERIEGLSLTADKSGAVFDVVQSDLDLFLAAGQKNAGSMSLEVVKEMPK  630

Query  350  LQERE  336
            LQERE
Sbjct  631  LQERE  635



>ref|XP_010444062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=670

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 95/125 (76%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL  S LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+G+P+ SPS+VY
Sbjct  506  AAKKLLENSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLHLEAGRPIQSPSYVY  565

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLPP  351
             +L+R L E+  E I+GL+LTAD +GAVFDV   D+D F+  G K A  +SLEVVK +P 
Sbjct  566  GMLRRVLPEDKVERIEGLSLTADKSGAVFDVVQSDLDLFLAAGQKNAGSMSLEVVKEMPK  625

Query  350  LQERE  336
            LQERE
Sbjct  626  LQERE  630



>ref|XP_004957391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Setaria 
italica]
Length=708

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+SME+  TLHL++G+P++SP F + +LKRF+ EE    +KG TLT DGT
Sbjct  555  GYTDIKKRSLLSSMEDYTTLHLQTGRPMWSPGFAFTILKRFMPEEKLADVKGATLTVDGT  614

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV   DV+ +I+ A+ A  V+++ VK LPPLQEREQ
Sbjct  615  GVVFDVPAADVEDYIQAAESAAQVTIDEVKQLPPLQEREQ  654



>ref|XP_006660856.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Oryza 
brachyantha]
 gb|ABG73436.1| DEAD/DEAH box helicase family protein [Oryza brachyantha]
Length=688

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S +S ADLLAKALAKA GYT+IK RSLL+SMEN  TL L++G+ VY+P FV +
Sbjct  516  AEQLLSSSGMSAADLLAKALAKAVGYTDIKKRSLLSSMENHTTLLLQTGRSVYAPGFVLS  575

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ EE    +KG+TLTADGTGAVFDV + +V+ +I+G++ A  V++E VK LPPLQ
Sbjct  576  TLKRFMPEERLADVKGITLTADGTGAVFDVPSAEVEDYIQGSENAAMVTIEEVKQLPPLQ  635

Query  344  EREQ  333
            ER+Q
Sbjct  636  ERDQ  639



>ref|XP_002460541.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
 gb|EER97062.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
Length=711

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+SME+  TLHL++G+P++SP F + +LKRF+ EE    +KG TLTADGT
Sbjct  557  GYTDIKKRSLLSSMEDYTTLHLQTGRPMWSPGFAFTILKRFMPEEKLADVKGATLTADGT  616

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV   DV+ +I+ ++ A  V+++ VK LPPLQE+EQ
Sbjct  617  GVVFDVPAADVEDYIQASENAAQVTIDEVKQLPPLQEKEQ  656



>ref|XP_010693660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score =   127 bits (319),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE LLSTS LS  ++LAKALAKAAGY++IK RSLLT ME  VTL +ES +P+Y+PSF +
Sbjct  510  AAEELLSTSGLSAVEILAKALAKAAGYSDIKERSLLTGMEGYVTLLIESDRPMYTPSFAF  569

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            ++L+RFL EE  ES  G+ +TAD  GAVFDV  +D++TF+ G++ A +V LEVVKTLP L
Sbjct  570  SILRRFLPEEKVESAMGVAITADQNGAVFDVPVDDLETFVTGSENAANVRLEVVKTLPRL  629

Query  347  QERE  336
            QER+
Sbjct  630  QERD  633



>ref|XP_010483921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=681

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 94/125 (75%), Gaps = 1/125 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AA+ LL  S LS   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+G+P+ SPS+VY
Sbjct  509  AAKKLLENSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLHLEAGRPIQSPSYVY  568

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLPP  351
             +L+R L E+  E I+GL+LTAD +GAVFD+   D+D F+  G K    +SLEVVK +P 
Sbjct  569  GMLRRVLPEDKVERIEGLSLTADKSGAVFDIVQSDLDLFLAAGQKNPGSMSLEVVKEMPK  628

Query  350  LQERE  336
            LQERE
Sbjct  629  LQERE  633



>sp|Q41382.1|RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Spinacia 
oleracea]
 emb|CAA68193.1| RNA helicase [Spinacia oleracea]
Length=685

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE LLSTS LS  D+L+KALAKAAGY++IK RSLLT ME  VTL L++G+P Y  SF Y
Sbjct  516  AAEELLSTSGLSAVDILSKALAKAAGYSDIKERSLLTGMEGYVTLLLDAGRPFYGQSFAY  575

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
             VLKRFL    A+SI G+ LTAD +GAVFDV  +D++TF+ GA+ A  V+L+VVK LPPL
Sbjct  576  TVLKRFLPATKADSIMGVALTADKSGAVFDVPVDDLETFLVGAENAAGVNLDVVKALPPL  635

Query  347  QEREQ  333
            +E+ Q
Sbjct  636  EEKVQ  640



>gb|EMS52016.1| DEAD-box ATP-dependent RNA helicase 7 [Triticum urartu]
Length=925

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS S +S  DLLAKALAKA GYT+IK RSLL+SMEN  TLHL++G+P+Y+PSFV +
Sbjct  757  AEELLSNSSMSAVDLLAKALAKAVGYTDIKKRSLLSSMENHTTLHLQTGRPLYTPSFVIS  816

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ E+   S+ G+TLT DGT AVFDV + +V  +I+GA+    V+++ VK LP LQ
Sbjct  817  TLKRFMPEDRLSSLHGITLTTDGTSAVFDVPSAEVQDYIQGAENVAGVTIDEVKQLPALQ  876

Query  344  EREQ  333
            EREQ
Sbjct  877  EREQ  880



>ref|XP_002866477.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42736.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 1/126 (1%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
             AA+ LL +S LS   LLAKALAK AG+TEIK RSLLTSMEN VTL LE+GKP+YSPS+V
Sbjct  504  GAAKELLESSGLSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLQLEAGKPMYSPSYV  563

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLP  354
            Y +L+R L ++  E I+GL+LTAD +GAVFDV   D+  F+  G K A  +SLEVVK +P
Sbjct  564  YGLLRRVLPDDKVEQIEGLSLTADKSGAVFDVKQSDLALFLAAGQKSAGSMSLEVVKEMP  623

Query  353  PLQERE  336
             LQERE
Sbjct  624  KLQERE  629



>ref|XP_006858006.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
 gb|ERN19473.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
Length=722

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            A AE LL +  L   D++AKALAK AGYTEIK RSLLT  +N  T+HL++G+ +Y+PSF 
Sbjct  545  AKAEELLKSGGLPAVDIVAKALAKIAGYTEIKRRSLLTCQDNFTTVHLQTGRVMYTPSFA  604

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPP  351
            ++VL+RF+ EE   +IKGL+LTADG GAVFDV +ED+D F+ G + A  VS+EV+  LPP
Sbjct  605  FSVLRRFMPEEKLSAIKGLSLTADGQGAVFDVPSEDLDMFLAGQENADMVSVEVLDKLPP  664

Query  350  LQE  342
            LQE
Sbjct  665  LQE  667



>gb|EAZ45398.1| hypothetical protein OsJ_30047 [Oryza sativa Japonica Group]
Length=685

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LL++S +S  DLLAKALAKA GYT+IK RSLL+SM+N  TL L++G+ VY+  FV +
Sbjct  515  AEQLLNSSGMSAVDLLAKALAKAVGYTDIKKRSLLSSMDNHTTLLLQTGRSVYAAGFVLS  574

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ EE    +KG+T+TADGTGAVFDV + +V+ +I+GA+ A  V++E VK LPPLQ
Sbjct  575  TLKRFMPEERLADVKGITITADGTGAVFDVPSAEVEDYIQGAQNAAMVTVEEVKQLPPLQ  634

Query  344  EREQ  333
            EREQ
Sbjct  635  EREQ  638



>ref|NP_001063702.1| Os09g0520700 [Oryza sativa Japonica Group]
 sp|Q650T9.1|RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD46678.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF25616.1| Os09g0520700 [Oryza sativa Japonica Group]
Length=696

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LL++S +S  DLLAKALAKA GYT+IK RSLL+SM+N  TL L++G+ VY+  FV +
Sbjct  526  AEQLLNSSGMSAVDLLAKALAKAVGYTDIKKRSLLSSMDNHTTLLLQTGRSVYAAGFVLS  585

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ EE    +KG+T+TADGTGAVFDV + +V+ +I+GA+ A  V++E VK LPPLQ
Sbjct  586  TLKRFMPEERLADVKGITITADGTGAVFDVPSAEVEDYIQGAQNAAMVTVEEVKQLPPLQ  645

Query  344  EREQ  333
            EREQ
Sbjct  646  EREQ  649



>gb|KHG06828.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=722

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/127 (54%), Positives = 86/127 (68%), Gaps = 28/127 (22%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GY+EIKSRSLLTSMEN VTL LE+GKP+Y+ SFV+ VLKRFL EE  +S++GLTLTADG 
Sbjct  545  GYSEIKSRSLLTSMENHVTLLLEAGKPIYTLSFVFGVLKRFLPEEKVQSVQGLTLTADGM  604

Query  452  GAVFDVSTEDVDTFIEG---------------------------AKKAYDVSLEVVKT-L  357
            GAVFDV+ +DV+TF+ G                           A+ A +V+LEV+K  L
Sbjct  605  GAVFDVAEDDVETFLTGIFLRDYIVAYFLLLPCPLVHFVVILCCAENAANVNLEVLKVAL  664

Query  356  PPLQERE  336
            PPLQ+R+
Sbjct  665  PPLQQRD  671



>ref|XP_009628542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=655

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAAE LL TS+LSPA+LLAKALAKAAGY+EIK+RSLL+SMENCVTL LE G+P+++PSF 
Sbjct  529  AAAEELLHTSELSPAELLAKALAKAAGYSEIKTRSLLSSMENCVTLLLECGRPIFAPSFA  588

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI  408
            YNVL+RFL E+  ESIKGLTLTADG GAVFDV  +D+D F+
Sbjct  589  YNVLRRFLPEDKVESIKGLTLTADGKGAVFDVFADDLDMFL  629



>ref|XP_009375806.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=177

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = -2

Query  593  MENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDT  414
            MEN VT+ LE+GKP+YSPSF + VL+RFL EE  ES+KG+ LTADG GAVFDV+ ED+D 
Sbjct  1    MENHVTVLLEAGKPIYSPSFAFGVLRRFLPEEKVESVKGMALTADGNGAVFDVAAEDLDL  60

Query  413  FIEGAKKAYDVSLEVVKTLPPLQERE  336
            F+ G + A +VS+ V+K+LP LQE+E
Sbjct  61   FLAGQENAANVSITVLKSLPDLQEKE  86



>ref|XP_008670328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Zea mays]
 tpg|DAA40576.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=704

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS ADLLAKALAKA GYT+IK RSLL+SME+  TLHL++G+ ++SP F + 
Sbjct  534  AEQLLSSSTLSAADLLAKALAKAVGYTDIKKRSLLSSMEDYATLHLQTGRQMWSPGFAFT  593

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +LKRF+ EE    +KG TLTADGTG VFDV   DV+ +I+ ++ A  V+++ V+ LPPLQ
Sbjct  594  ILKRFMPEEKLADVKGATLTADGTGVVFDVPAADVEDYIQASENAAQVTIDEVQQLPPLQ  653

Query  344  EREQ  333
            E++Q
Sbjct  654  EKQQ  657



>ref|XP_008652955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Zea mays]
Length=634

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F + +LKRF+ E+    +KG TLTADGT
Sbjct  483  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFAFTILKRFMPEDKLADVKGATLTADGT  542

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV   DV+ +I+ ++ A  V+++ VK LPPLQE++Q
Sbjct  543  GVVFDVPAADVEDYIQASESAAQVTIDEVKQLPPLQEKDQ  582



>ref|XP_003578458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brachypodium 
distachyon]
Length=694

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+SMEN  TL L++G+P+Y+P F    LKRF+ E+    + G+TLTADGT
Sbjct  553  GYTDIKKRSLLSSMENYTTLQLQTGRPMYTPGFALTTLKRFMPEDKLSDVHGITLTADGT  612

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            GAVFDV + +V  +I G++ A  V+L+ VK LPPLQEREQ
Sbjct  613  GAVFDVPSAEVQDYILGSENAAMVTLDEVKQLPPLQEREQ  652



>ref|XP_008652953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 tpg|DAA62342.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=707

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F + +LKRF+ E+    +KG TLTADGT
Sbjct  556  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFAFTILKRFMPEDKLADVKGATLTADGT  615

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV   DV+ +I+ ++ A  V+++ VK LPPLQE++Q
Sbjct  616  GVVFDVPAADVEDYIQASESAAQVTIDEVKQLPPLQEKDQ  655



>gb|EAZ09787.1| hypothetical protein OsI_32075 [Oryza sativa Indica Group]
Length=685

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LL++S +S  DLLAKALAKA GYT+IK RSLL+SM+N  TL L +G+ VY+  FV +
Sbjct  515  AEQLLNSSGMSAVDLLAKALAKAVGYTDIKKRSLLSSMDNHTTLLLLTGRSVYAAGFVLS  574

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
             LKRF+ EE    +KG+T+TADGTGAVFDV + +V+ +I+GA+ A  V++E VK LPPLQ
Sbjct  575  TLKRFMPEERLADVKGITITADGTGAVFDVPSAEVEDYIQGAQNAAMVTVEEVKQLPPLQ  634

Query  344  EREQ  333
            EREQ
Sbjct  635  EREQ  638



>tpg|DAA40575.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=671

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS ADLLAKALAKA GYT+IK RSLL+SME+  TLHL++G+ ++SP F + 
Sbjct  534  AEQLLSSSTLSAADLLAKALAKAVGYTDIKKRSLLSSMEDYATLHLQTGRQMWSPGFAFT  593

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +LKRF+ EE    +KG TLTADGTG VFDV   DV+ +I+ ++ A  V+++ V+ LPPLQ
Sbjct  594  ILKRFMPEEKLADVKGATLTADGTGVVFDVPAADVEDYIQASENAAQVTIDEVQQLPPLQ  653

Query  344  ERE  336
            E++
Sbjct  654  EKQ  656



>ref|XP_009130201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brassica rapa]
Length=667

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 94/126 (75%), Gaps = 2/126 (2%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            AAA+ LL +S +S   LLAKALAK AG+TEIK RSLLTSMEN VTLHLE+G+P+YS +  
Sbjct  510  AAAKELLESSGVSAEVLLAKALAKTAGFTEIKKRSLLTSMENHVTLHLEAGRPIYSATNA  569

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFI-EGAKKAYDVSLEVVKTLP  354
            ++VL+R L ++    I+G+TLT DG GAVFDV   DVD FI  G K A  +SLEVVK +P
Sbjct  570  FSVLRRVLPDDKVNLIEGMTLTVDG-GAVFDVVQSDVDQFIAAGQKNAGSMSLEVVKEMP  628

Query  353  PLQERE  336
             LQERE
Sbjct  629  KLQERE  634



>gb|KJB39370.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=687

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 96/124 (77%), Gaps = 11/124 (9%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            A+ LL TS LS  DLLAKALAKAAGY+EIKSRSLL+SMEN VTL LE+GKP+Y+ SFV+ 
Sbjct  523  AQELLETSGLSAQDLLAKALAKAAGYSEIKSRSLLSSMENHVTLLLEAGKPIYTLSFVFG  582

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKT-LPPL  348
            VLKRFL EE  +S++GLTLTADG GAVFDV+ +DV+ F+           EV+K  LPPL
Sbjct  583  VLKRFLPEEKVQSVQGLTLTADGMGAVFDVAEDDVEAFLT----------EVLKNALPPL  632

Query  347  QERE  336
            Q+R+
Sbjct  633  QQRD  636



>ref|XP_010940916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=711

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS   LLAKALAKAAGYT+IK RSLL+S+E+ VTL L++GK +YSP+F + 
Sbjct  539  AEQLLSSSGLSAVHLLAKALAKAAGYTDIKKRSLLSSIESHVTLLLQAGKTIYSPAFAFG  598

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            +L+ FL  E  E +KGL+LTADG GAVFDV  +DV+ F  G + A   ++EV+K+LPPLQ
Sbjct  599  ILRGFLPNEKIEGVKGLSLTADGMGAVFDVPADDVNAFTGGQENANMATIEVLKSLPPLQ  658

Query  344  EREQ  333
             ++Q
Sbjct  659  CKDQ  662



>gb|KDO65344.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=620

 Score =   109 bits (272),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            +AAE LL+ S LS A+LLAKALAKA GYTEIKSRSLL+S+E+ VT+ LE+GKP+Y+PSF 
Sbjct  517  SAAEELLNNSGLSAAELLAKALAKAVGYTEIKSRSLLSSLEDHVTVVLEAGKPIYTPSFA  576

Query  530  YNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEG  402
            + VL+RFL EE  E +KG+ LTADG GAVFDV   D+D F  G
Sbjct  577  FGVLRRFLPEEKVELVKGMALTADGNGAVFDVPVADLDLFRSG  619



>tpg|DAA62341.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=317

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F + +LKRF+ E+    +KG TLTADGT
Sbjct  232  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFAFTILKRFMPEDKLADVKGATLTADGT  291

Query  452  GAVFDVSTEDVDTFIEG  402
            G VFDV   DV+ +I+G
Sbjct  292  GVVFDVPAADVEDYIQG  308



>ref|XP_011470438.1| PREDICTED: metalloendopeptidase OMA1, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=543

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 71/98 (72%), Gaps = 1/98 (1%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT + + S L SMEN +T+ LE+GKP Y+ +F Y VL+RFL +E   S+KGL LT +G 
Sbjct  416  GYTNV-NMSFLWSMENHITVLLEAGKPFYTVTFAYLVLRRFLPKEKIGSVKGLVLTTNGK  474

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
            GAVFDV+ ED+D F+ G++ A  +S++V+ +L  LQE+
Sbjct  475  GAVFDVAAEDLDMFLTGSQNAAGISIQVLDSLWSLQEK  512



>ref|XP_010650775.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Vitis 
vinifera]
 emb|CBI24691.3| unnamed protein product [Vitis vinifera]
Length=168

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE  L+TSDLS  +LLA AL KA GYTE+KSRS LT++EN VT+ LE+ KP+Y PSF Y 
Sbjct  66   AEEFLNTSDLSAVELLAMALVKAFGYTEMKSRSFLTTLENLVTVFLEARKPIYIPSFAYG  125

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTE  426
            VL+RFL +E   SI+GL  T DG GAVFDV+TE
Sbjct  126  VLRRFLPKEKVGSIQGLAFTTDGNGAVFDVATE  158



>ref|XP_008652954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=641

 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F + +LKRF+ E+    +KG TLTADGT
Sbjct  556  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFAFTILKRFMPEDKLADVKGATLTADGT  615

Query  452  GAVFDVSTEDVDTFIEG  402
            G VFDV   DV+ +I+G
Sbjct  616  GVVFDVPAADVEDYIQG  632



>gb|KEH43757.1| GUCT (NUC152) domain protein [Medicago truncatula]
Length=374

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 13/100 (13%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLLTSMEN VTL LE+ KP   P+ V             E++KGLT+TADG 
Sbjct  239  GYTDIKKRSLLTSMENYVTLLLENRKPYLYPNKV-------------EAVKGLTITADGN  285

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV+ ED+DT++ G + A  V L+V+K LP LQ+R+Q
Sbjct  286  GVVFDVAAEDLDTYLAGKEDASYVRLKVLKELPRLQQRDQ  325



>ref|XP_003592393.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=877

 Score =   100 bits (249),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 13/100 (13%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT+IK RSLLTSMEN VTL LE+ KP   P+ V             E++KGLT+TADG 
Sbjct  742  GYTDIKKRSLLTSMENYVTLLLENRKPYLYPNKV-------------EAVKGLTITADGN  788

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G VFDV+ ED+DT++ G + A  V L+V+K LP LQ+R+Q
Sbjct  789  GVVFDVAAEDLDTYLAGKEDASYVRLKVLKELPRLQQRDQ  828



>emb|CAN63086.1| hypothetical protein VITISV_043401 [Vitis vinifera]
Length=557

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYTEIKSRSLL ++EN VT+ LE+GKP+ + SFVY VL+RFL E+  ESIK L LTADG 
Sbjct  413  GYTEIKSRSLLITLENHVTVLLEAGKPICTLSFVYGVLRRFLPEDKVESIKNLALTADGN  472

Query  452  GAVFDVSTED  423
            GA+FDV+TE+
Sbjct  473  GAMFDVATEN  482



>ref|XP_008813466.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=571

 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = -2

Query  704  AESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYN  525
            AE LLS+S LS  DLLAKALAKAAGYT+IK RSLL+S+EN VTL L++GK + SP+F ++
Sbjct  454  AEQLLSSSGLSAVDLLAKALAKAAGYTDIKQRSLLSSIENYVTLLLQAGKTIDSPAFAFS  513

Query  524  VLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIE  405
            +L+R L  E    +KGL+LTADG GAVFDV  +DV+ F+E
Sbjct  514  ILRRVLPNENIGGVKGLSLTADGVGAVFDVPADDVNAFVE  553



>gb|KCW45478.1| hypothetical protein EUGRSUZ_L00808 [Eucalyptus grandis]
Length=511

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 57/77 (74%), Gaps = 0/77 (0%)
 Frame = -2

Query  563  SGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYD  384
            +G+ +Y+P +   VL+RFL E   E +KGL LT DG G VFDV+ ED+DTF+ G + A +
Sbjct  382  TGRSIYTPPYSLGVLRRFLPENKVEFVKGLILTVDGNGIVFDVAAEDLDTFLAGQENATN  441

Query  383  VSLEVVKTLPPLQEREQ  333
            VSLEVVKTLP LQER+Q
Sbjct  442  VSLEVVKTLPCLQERDQ  458



>ref|XP_002977618.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
 gb|EFJ21622.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
Length=663

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE L+S       +LLAKALAK AG TE+K RSL TS ++  TL  E  KP++S  +++
Sbjct  490  AAEQLVSDCKRPAVELLAKALAKIAGCTEVKRRSLQTSHDDATTLLFEVSKPIHSVGYIF  549

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            N L+ FLSEE + SI+ + LTADG  AVFDV +  VD F+ G   A + ++ + ++LP L
Sbjct  550  NALRGFLSEECSSSIRRMNLTADGKAAVFDVPSAMVDEFLIGNDGADNFTISIPESLPEL  609



>ref|XP_002975210.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
 gb|EFJ23995.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
Length=626

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE L+S       +LLAKALAK AG TE+K RSL TS ++  TL  E  KP++S  +++
Sbjct  453  AAEQLVSDCKRPAMELLAKALAKIAGCTEVKRRSLQTSHDDATTLLFEVSKPIHSVGYIF  512

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            N L+ FLSEE + SI+ + LTADG  AVFDV +  VD F+ G   A + ++ + + LP L
Sbjct  513  NALRGFLSEECSSSIRRMNLTADGKAAVFDVPSAMVDEFLIGNDGADNFTISIPEALPEL  572



>ref|XP_001760070.1| predicted protein [Physcomitrella patens]
 gb|EDQ75195.1| predicted protein [Physcomitrella patens]
Length=657

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -2

Query  707  AAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVY  528
            AAE L+ +S L   D+LAKA+AK +G TE+K RSLLTS ++  TL L++   +YSP++ +
Sbjct  491  AAEDLVKSSGLPVLDVLAKAIAKISGQTELKRRSLLTSHDDATTLMLKANTKMYSPTYAF  550

Query  527  NVLKRFLSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            N L+++L EET   ++ + LT D TGAVFDV +  V+ FI   ++  + ++EV+  LP L
Sbjct  551  NCLRKYLPEETVNEVRRMNLTTDCTGAVFDVPSRSVEEFI-AEQEGENFTVEVLDALPEL  609

Query  347  Q  345
            Q
Sbjct  610  Q  610



>ref|XP_001764376.1| predicted protein [Physcomitrella patens]
 gb|EDQ70930.1| predicted protein [Physcomitrella patens]
Length=689

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G TE+K RSLLTS ++  TL L++   +YSP++ +N L++FL E     ++ + LT DG 
Sbjct  545  GQTELKRRSLLTSHDDSTTLILKANTSMYSPTYAFNCLRKFLPETIINEVRRMNLTVDGK  604

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQ  345
            GAVFDV +++VD FI   ++  + ++EV+  LP LQ
Sbjct  605  GAVFDVPSKNVDEFI-AEQEGENFTVEVLDALPELQ  639



>gb|KCW88483.1| hypothetical protein EUGRSUZ_A00875 [Eucalyptus grandis]
Length=435

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = -2

Query  710  AAAESLLSTsdlspadllakalakaAGYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            + AE LL+TS +S  +LLAKALAKA+GY+EIKSRSLL+S+EN VTL LE+G+P+Y+PS+ 
Sbjct  354  SVAEQLLNTSGMSVVELLAKALAKASGYSEIKSRSLLSSLENHVTLLLETGRPIYTPSYA  413

Query  530  YNVLKRFLSEETAESIKGLT  471
            ++VL+RFL E+  E +KGLT
Sbjct  414  FSVLRRFLPEDKVEFVKGLT  433



>gb|KIZ06880.1| cystathionine gamma-synthase [Monoraphidium neglectum]
Length=1211

 Score = 79.3 bits (194),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 61/105 (58%), Gaps = 6/105 (6%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G+TE+K+RSLLT+ +   TL    GK    P +VYN L+R L+++  E ++ +TLT DG 
Sbjct  628  GHTELKARSLLTAQDGFTTLLYRQGKSEIRPGYVYNFLRRHLADDVVEEVRRVTLTEDGC  687

Query  452  GAVFDVSTEDVDTFIEGA------KKAYDVSLEVVKTLPPLQERE  336
             AVFDV T+ V   +  A      + A    +  + TLPPL+ RE
Sbjct  688  AAVFDVPTQHVAAMLAKATAPPVEEDAAAEGVRAITTLPPLKLRE  732



>ref|XP_001742267.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ92505.1| predicted protein [Monosiga brevicollis MX1]
Length=591

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 61/99 (62%), Gaps = 0/99 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G TEIK+RSLL+SM +  TLH++    + +  FV+ +++++  E+    IKGL L  D  
Sbjct  430  GATEIKTRSLLSSMADYTTLHIKVETEIRTKGFVWTLIRKYFPEDAHNEIKGLRLQKDKQ  489

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQERE  336
            G+VFDV T+ VD  +     +  V++EV K LP L+ +E
Sbjct  490  GSVFDVPTKMVDGIMAAWNDSPTVTMEVCKELPELEAQE  528



>ref|XP_005645158.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20614.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=698

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 58/99 (59%), Gaps = 11/99 (11%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G++ I++RSLLT+ E+  TL   +G+ +  P FV+  L+R LS+E  E IKG+TLT DG 
Sbjct  539  GFSSIRARSLLTAHEDYTTLQFHAGQEIQRPGFVFTSLRRHLSDEVVEQIKGITLTTDGK  598

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQERE  336
             A+FDV +        G  + Y   L    TLP L+ RE
Sbjct  599  SAIFDVPS--------GIAQPY---LTQPATLPELKARE  626



>ref|XP_005849733.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
 gb|EFN57631.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
Length=608

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 59/105 (56%), Gaps = 5/105 (5%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEE-TAESIKGLTLTADG  456
            G+ E++ RSLLT+ E+  TL   S  PV  P  V+  L++ + EE T E  K +TLTADG
Sbjct  439  GHVEMRPRSLLTAHEDFTTLRFVSPWPVEKPGQVFGFLRKHMHEEETVEEAKRMTLTADG  498

Query  455  TGAVFDVSTEDVDTFIEGAKK----AYDVSLEVVKTLPPLQEREQ  333
             GAVFDV T     F+    K         L+V  +LP L+EREQ
Sbjct  499  LGAVFDVPTSLAKEFLAKCGKNEGTRATAHLQVATSLPELKEREQ  543



>ref|XP_005854803.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
 gb|EKU21559.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
Length=737

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = -2

Query  632  GYT-EIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+T E++SRSLL++ ++ VT   ++ +P+ S  +V+  L+  L +E  E I+G+ LTAD 
Sbjct  581  GHTKELRSRSLLSNSDDYVTCQFQADQPIMSTGYVWTALRNALPQEVTEDIRGMQLTADN  640

Query  455  TGAVFDVSTEDVDTFIEGAKKAYDVS--LEVVKTLPPLQE  342
            TGAVFDV ++ + T +   K+A + +  L V KTLP +++
Sbjct  641  TGAVFDVPSKYMKTSM---KRAVEENPFLTVCKTLPEIKQ  677



>gb|EWM21167.1| dead deah box rna [Nannochloropsis gaditana]
Length=737

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 66/100 (66%), Gaps = 6/100 (6%)
 Frame = -2

Query  632  GYT-EIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+T E++SRSLL++ ++ VT   ++ +P+ S  +V+  L+  L +E  E I+G+ LTAD 
Sbjct  581  GHTKELRSRSLLSNSDDYVTCQFQADQPIMSTGYVWTALRNALPQEVTEDIRGMQLTADN  640

Query  455  TGAVFDVSTEDVDTFIEGAKKAYDVS--LEVVKTLPPLQE  342
            TGAVFDV ++ + T +   K+A + +  L V KTLP +++
Sbjct  641  TGAVFDVPSKYMKTSM---KRAVEENPFLTVCKTLPEIKQ  677



>ref|XP_001702450.1| RNA helicase [Chlamydomonas reinhardtii]
 gb|EDO96945.1| RNA helicase [Chlamydomonas reinhardtii]
Length=737

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 62/101 (61%), Gaps = 3/101 (3%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESG-KPVYSPSFVYNVLKR--FLSEETAESIKGLTLTA  462
            GY  +K+RSLLT+ ++C TL  E     + +P  V+  L++   L E   + +K +T+TA
Sbjct  547  GYKVMKARSLLTAHDDCTTLLFECADHTIENPGSVWGHLRKTCRLDEGLLDQVKRMTVTA  606

Query  461  DGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
            DG GAVFDV +E V  F+E A++   ++L +  +LP L+ R
Sbjct  607  DGKGAVFDVPSEHVQAFLEAAEEKRGITLTLPSSLPELKVR  647



>ref|XP_002610327.1| hypothetical protein BRAFLDRAFT_144535 [Branchiostoma floridae]
 gb|EEN66337.1| hypothetical protein BRAFLDRAFT_144535, partial [Branchiostoma 
floridae]
Length=655

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G +EIK RSLL + E   T+   + +PV    + +  +KR   E+  ++++G+T+  +  
Sbjct  525  GSSEIKKRSLLNADEGFTTMLFHTDRPVRGKGYFWTAIKRRFGEDIDQNVRGMTMFTNNK  584

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
            G  FDV +   D F++  + +YD  LEV   LP L++R
Sbjct  585  GVAFDVPSSMEDQFVDTFQGSYDSRLEVATELPDLEQR  622



>ref|XP_011399479.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
 gb|KFM26541.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
Length=764

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 44/111 (40%), Positives = 60/111 (54%), Gaps = 13/111 (12%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT ++ RSL+T+ E+  TL L +  PV  P  V+ VL++ L E + E +K +TLT+DG 
Sbjct  485  GYTALRPRSLITAHEDYTTLRLAAAFPVDKPGQVFGVLRKALPEASVEEVKSMTLTSDGK  544

Query  452  GAVFDVSTEDVDTF-----------IEGAKKAYDVSLEVVKTLPPLQEREQ  333
            GAVFDV    V  F           +  AK    VS     TLP + ERE+
Sbjct  545  GAVFDVPAALVQAFKQALPEPEGGDVGAAKNGAFVSQP--STLPEVVERER  593



>ref|XP_011408715.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Amphimedon 
queenslandica]
Length=148

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G+TE+ +RSLLTS +   T      + V SP + +N+++R   EE   S++G+ L +D  
Sbjct  39   GFTELTARSLLTSEKGYTTFMFSGEQEVRSPGYFWNIVERLFGEEARRSVRGMRLCSDNK  98

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
              VFD+ +     F      +  +++ + +TLP L+ R
Sbjct  99   SVVFDLPSNTAKQFESSCGTSKGITISIPQTLPELKPR  136



>gb|ACF80222.1| unknown [Zea mays]
Length=73

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -2

Query  509  LSEETAESIKGLTLTADGTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQERE  336
            + EE    +KG TLTADGTG VFDV   DV+ +I+ ++ A  V+++ V+ LPPLQE++
Sbjct  1    MPEEKLADVKGATLTADGTGVVFDVPAADVEDYIQASENAAQVTIDEVQQLPPLQEKQ  58



>ref|XP_004992590.1| DEAD box polypeptide 47 isoform 1 [Salpingoeca rosetta]
 gb|EGD74945.1| DEAD box polypeptide 47 isoform 1 [Salpingoeca rosetta]
Length=711

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (55%), Gaps = 0/99 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL+S+E     HL +   +   +FV++VL   L  E  E+++G+ L  D  
Sbjct  548  GSTTIKGRSLLSSLEGFTAFHLTTDTEIRGKAFVFSVLGHHLPREVREAVRGIRLQKDRM  607

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQERE  336
            GAVFD+ +  + T  +      ++ L V + LP LQE +
Sbjct  608  GAVFDLPSSMMKTIKDNWSDTPNLRLTVAEKLPELQEEQ  646



>ref|XP_001755110.1| predicted protein [Physcomitrella patens]
 gb|EDQ80054.1| predicted protein, partial [Physcomitrella patens]
Length=147

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 47/76 (62%), Gaps = 0/76 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G TE+K RSLLT  +N   L L+    +YS  + +N L++FL + T   ++ + LT DG 
Sbjct  58   GQTELKRRSLLTLHDNSTILTLKVNTSIYSSMYAFNCLQKFLPKITINKVRHMNLTIDGK  117

Query  452  GAVFDVSTEDVDTFIE  405
              VFD+ +++++ FI+
Sbjct  118  IVVFDIPSKNIEEFID  133



>ref|XP_011406566.1| PREDICTED: ATP-dependent RNA helicase DDX50-like [Amphimedon 
queenslandica]
Length=371

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G+TE+ +RSLLTS +   T      + V SP + +N+++R   EE   S++G+ L +D  
Sbjct  234  GFTELTARSLLTSEKGYTTFMFSGEQEVRSPGYFWNIVERLFGEEARRSVRGMRLCSDNK  293

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
              VFD+ +     F      +  +++ + +TLP L+ R
Sbjct  294  SVVFDLPSNTAKQFESSCGTSKGITVSIPQTLPELKPR  331



>emb|CEI94647.1| hypothetical protein RMCBS344292_08852 [Rhizopus microsporus]
Length=694

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLLTS E   TL  +    +  P ++ N++ R   E   + +KG  +T D 
Sbjct  531  GYHQGVPSRSLLTSQEGQTTLLAQISYAIQHPGYIRNIITREYPELGYDDVKGWRMTQDS  590

Query  455  TGAVFDVS------TEDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+       TED +  + G +  A +++L   K+LPPLQ+RE
Sbjct  591  MGVVFDIKSSRCEVTEDGEVLLVGRRWTARNITLSAPKSLPPLQDRE  637



>ref|XP_004344972.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE95811.1| nucleolar RNA helicase 2 [Capsaspora owczarzaki ATCC 30864]
Length=793

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G  EIK+RSLL+SME  VT  ++    V  PSF ++++ R L      +++G+ L  D T
Sbjct  626  GVFEIKTRSLLSSMEGYVTFCIQLTYDVRGPSFFWSIIDRHLPPNVRPALRGMRLFKDHT  685

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQE  342
            GA FD  ++ VDT  E         + V  TLP L E
Sbjct  686  GAAFDCPSDVVDTIKEHWVDQPTTKIYVATTLPDLVE  722



>gb|KFH66922.1| hypothetical protein MVEG_07447 [Mortierella verticillata NRRL 
6337]
Length=687

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 8/105 (8%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY+  ++ RSLLT+ E   TL       + +P +V N+L R     ++E IKG+ +T D 
Sbjct  556  GYSAGVQVRSLLTAAEGFKTLMFRLSHEIQNPGYVRNILSRNYPNLSSEDIKGMRMTKDM  615

Query  455  TGAVFDVSTEDV----DTFIEGAKKAYD---VSLEVVKTLPPLQE  342
             G VFDV+   V    DT   G  K  D   + LEVV TLP L+E
Sbjct  616  MGVVFDVTASKVQVNGDTITMGGNKWTDLDHIKLEVVSTLPELEE  660



>emb|CEG65973.1| hypothetical protein RMATCC62417_02639 [Rhizopus microsporus]
Length=674

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLLTS E   TL  +    +  P ++ N++ R   E   + +KG  +T D 
Sbjct  510  GYHQGVPSRSLLTSQEGQTTLLAQISYAIQHPGYIRNIITREYPELGYDDVKGWRMTQDS  569

Query  455  TGAVFDVS------TEDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+       TED +  + G +  A +++L   K+LPPLQ+RE
Sbjct  570  MGVVFDIKSSRCEVTEDGEVLLVGRRWTARNITLSAPKSLPPLQDRE  616



>ref|XP_002167654.2| PREDICTED: nucleolar RNA helicase 2-like [Hydra vulgaris]
Length=685

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 53/97 (55%), Gaps = 0/97 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G TE+ +RSLLTS +   T  ++    + +P+ ++N+L+R+  +E    IKG+ +  D  
Sbjct  487  GTTELANRSLLTSRKGYTTYLMKQPVQLRNPTLIWNILRRYFDDEFIAGIKGMRMCQDKL  546

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQE  342
            G VFDV TE +    E  K     +LE +  LP L E
Sbjct  547  GCVFDVPTEKISVIKEVWKGDRYATLEKLSKLPDLIE  583



>ref|XP_009035969.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
 gb|EGB09312.1| hypothetical protein AURANDRAFT_895, partial [Aureococcus anophagefferens]
Length=591

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 57/104 (55%), Gaps = 15/104 (14%)
 Frame = -2

Query  632  GYTEIK--SRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTAD  459
            GY   K   RSLLT+ E+ VT H  +G P++S S+V+N L+R L  E  +++K + L A+
Sbjct  464  GYERGKPADRSLLTNSEHYVTCHYAAGLPIHSISYVWNFLRRELKPEVCDALKAMQLVAE  523

Query  458  GTGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKT----LPPLQER  339
            G GAVFD            + KA  V L+ V      LP L+ER
Sbjct  524  GDGAVFDAPA---------SAKADLVGLDGVSVDIDDLPKLKER  558



>emb|CEI86541.1| hypothetical protein RMCBS344292_00980 [Rhizopus microsporus]
Length=674

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLLTS E   TL  +    +  P ++ N++ R   E   + +KG  +T D 
Sbjct  510  GYHQGVPSRSLLTSQEGQTTLLAQISYAIQHPGYIRNIITREYPELGYDDVKGWRMTQDS  569

Query  455  TGAVFDVST------EDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+ +      ED +  + G +  A +++L   K+LPPLQ+RE
Sbjct  570  MGVVFDIKSSRCEVKEDGEVLLVGRRWTARNITLSAPKSLPPLQDRE  616



>gb|AAH73332.1| LOC398189 protein [Xenopus laevis]
Length=727

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL     CVT+ L+S  P++S S+ +  +K  L ++    I  + L  D  
Sbjct  582  GATSIKQRSLLNMEAGCVTITLKSSVPIHSLSYAWQSIKEQLGDDVDSKIHRMCLLKDSM  641

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +E++++  E           V   LP +QE E+
Sbjct  642  GVCFDVRSENLESMQERWTDTKQWQFTVATELPAIQESER  681



>emb|CBK20101.2| unnamed protein product [Blastocystis hominis]
Length=553

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  629  YTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTG  450
            + ++K+RS+LTS E  VT+  +S  P  + S+V+  L+R+  E+   SIK  T+T D  G
Sbjct  467  FGKMKTRSILTSNEGFVTVMYQSLNPFRTVSYVWGALRRYFPEDVVTSIKANTMTKDERG  526

Query  449  AVFDVSTEDVDTF  411
            AVFDV  E +  F
Sbjct  527  AVFDVPEEHIQLF  539



>ref|XP_002955657.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
 gb|EFJ43297.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
Length=727

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 2/101 (2%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLES-GKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY E+K+RSLLT+ ++C TL        + SPS V +V   F      + +K +T+TAD 
Sbjct  545  GYKEMKARSLLTAHDDCTTLLFTCEDHTIESPSSV-SVCLCFSVVCNPQQVKRMTVTADS  603

Query  455  TGAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
             GAVFDV +E   TF++ A+    +S+ +  +LP L+ R +
Sbjct  604  KGAVFDVPSELAQTFLDAAEGKRGISVTLPSSLPELKPRPE  644



>gb|EJY74800.1| DEAD/DEAH box helicase family protein [Oxytricha trifallax]
Length=795

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 54/96 (56%), Gaps = 5/96 (5%)
 Frame = -2

Query  614  SRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVFDV  435
            SRS+LT  EN VT+ ++   P  S SFV+++LKR L++     I+G+ +  D  G VFDV
Sbjct  544  SRSVLTGQENYVTIEMKFDNPFNSVSFVWSILKRHLTDSIVNGIRGMRMFKDLKGVVFDV  603

Query  434  STEDVDTFIE-----GAKKAYDVSLEVVKTLPPLQE  342
            + + ++ F +       +K  D  +   K LP L+E
Sbjct  604  TDDSIEKFEDVFNHLATEKRVDFHVGRAKELPELKE  639



>ref|XP_007512398.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16998.1| predicted protein [Bathycoccus prasinos]
Length=689

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGK-PVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+ E++ RSLLTS     TL L +G   + +P++V+N LK+ L E+  + I  LTL+ D 
Sbjct  526  GHGELRQRSLLTSTAGSTTLILSAGGTEIRTPTYVWNFLKQRLPEDEVQ-INRLTLSQDN  584

Query  455  TGAVFDVSTEDVDTFI---EGAKKAYDVSLEVVKTLPPLQEREQ  333
              AVFDV  +  D +    E +     +++EV + LP L +R Q
Sbjct  585  LKAVFDVPAKLADKYCGLSENSSGRSAITIEVCEELPELSQRPQ  628



>gb|EIE87311.1| hypothetical protein RO3G_12022 [Rhizopus delemar RA 99-880]
Length=665

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 58/107 (54%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLLTS E   TL L+    +  P +V N++ R   E   + +KG  +T D 
Sbjct  505  GYHQGVPSRSLLTSQEGQTTLLLQLSYTIQHPGYVRNIISREYPELGYDDVKGWRMTEDS  564

Query  455  TGAVFDVST------EDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+ +      ED +  + G    A++++L   K+LP LQ+R+
Sbjct  565  MGVVFDIKSSRCEVKEDGEVLLVGRPWTAHNITLSAPKSLPTLQDRD  611



>emb|CDS09503.1| hypothetical protein LRAMOSA10863 [Absidia idahoensis var. thermophila]
Length=681

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 59/109 (54%), Gaps = 9/109 (8%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLL++ME   TL  +  + +  P +V +++KR   E   E  +   +T+D 
Sbjct  516  GYHQGVPSRSLLSAMEGFTTLMFQIDREIQHPGYVRSIIKREFPELGYEDCRAWRMTSDY  575

Query  455  TGAVFDVSTEDVDTFIEG----AKKAYD----VSLEVVKTLPPLQEREQ  333
             G VFDV +  V+   +G    A + Y+    VSL  +K LP L EREQ
Sbjct  576  CGVVFDVVSSKVEVKEDGQVLLAGRPYNGNRGVSLVSLKELPELAEREQ  624



>emb|CDW87295.1| nucleolar rna helicase 2 [Stylonychia lemnae]
Length=1060

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 5/98 (5%)
 Frame = -2

Query  620  IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVF  441
            + +RSLLT  EN VT  ++      S SFV+ +LKR+L +    SI+G+ +  D  G VF
Sbjct  817  MSTRSLLTGQENYVTAEIKLNNAFNSLSFVWGILKRYLPDGMVNSIRGMRMFKDNKGVVF  876

Query  440  DVSTEDVDTFIEGAK-----KAYDVSLEVVKTLPPLQE  342
            DV  + +  F +  K     K  D  + + K LP L+E
Sbjct  877  DVPDDSIAKFEDTFKHLFDEKKIDFHVGITKELPDLKE  914



>ref|XP_002112077.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
 gb|EDV26044.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
Length=633

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 50/95 (53%), Gaps = 0/95 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            GYT I +RSLL+S E   T  + S     S S+++ V++  LS      ++G+ +  D  
Sbjct  484  GYTSITNRSLLSSREGFTTYVMRSQWEFRSVSYMWKVIEVELSSAIKAEVRGMRMCKDKK  543

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
            G VFD+ +   DT  E  K A ++ L++   LP L
Sbjct  544  GVVFDLPSNLCDTVKENWKNARNIELDIADALPEL  578



>ref|XP_002130533.1| PREDICTED: nucleolar RNA helicase 2 [Ciona intestinalis]
Length=672

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/98 (32%), Positives = 55/98 (56%), Gaps = 0/98 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G +++KSRSLL +  +  T HL++   +    FV++ +++ L +   + I G+ LTAD  
Sbjct  527  GASDLKSRSLLNAQADFTTWHLQTQYEIRFAGFVFSTMEQILGKHIRDKIVGMRLTADKL  586

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQER  339
            GAVFD+  E  +   +  + +  ++L+    LP L ER
Sbjct  587  GAVFDLPNECTEEIDQSWEDSPTLTLKPCDDLPELTER  624



>ref|NP_001082035.1| RNA helicase II/Gu [Xenopus laevis]
 sp|Q9DF35.2|DD21A_XENLA RecName: Full=Nucleolar RNA helicase 2-A; AltName: Full=DEAD 
box protein 21-A; AltName: Full=Gu-alpha-A; AltName: Full=Nucleolar 
RNA helicase Gu-A; Short=xGu-1; AltName: Full=Nucleolar 
RNA helicase II-A; AltName: Full=RH II/Gu-A [Xenopus laevis]
 gb|AAG22819.2|AF302423_1 RNA helicase II/Gu [Xenopus laevis]
Length=759

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL     C T+ L+S  P++S S+ +  +K  L ++    I  + L  D  
Sbjct  614  GATSIKQRSLLNMEAGCDTITLKSSVPIHSLSYAWQSIKEQLGDDVDSKIHRMCLLKDSM  673

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +E++++  E           V   LP +QE E+
Sbjct  674  GVCFDVRSENLESMQERWTDTKQWQFTVATELPAIQESER  713



>ref|XP_002167666.2| PREDICTED: nucleolar RNA helicase 2-like [Hydra vulgaris]
Length=543

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (52%), Gaps = 0/97 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G TEI +RS+LTS     T  ++    + S   +++ L+R+  +   +SIKG+ +  D  
Sbjct  391  GTTEIVNRSMLTSQPGYTTYLMKQNLELRSTGLIWHTLRRYFDQTFIDSIKGMRICKDKL  450

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQE  342
            G VFDV TE +    E  K     +LE +  LP L E
Sbjct  451  GCVFDVPTESIKVIEECWKGDKFSTLEPITELPELME  487



>emb|CDH59679.1| nucleolar rna helicase 2-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=684

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 9/109 (8%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLL++ME   TL  +  + +  P +V +++KR   E   E  +   +T+D 
Sbjct  516  GYHQGVPSRSLLSAMEGFTTLMFQIDREIQHPGYVRSIIKREFPELGYEDCRAWRMTSDY  575

Query  455  TGAVFDVSTEDVDTFIEG----AKKAYD----VSLEVVKTLPPLQEREQ  333
             G VFD  +  V+   +G    A + Y+    VSL  +K LP L EREQ
Sbjct  576  CGVVFDCVSSKVEVKEDGQVWLAGRPYNGNRGVSLVSLKELPELAEREQ  624



>dbj|GAN03042.1| nucleolar RNA helicase 2-like isoform X2 [Mucor ambiguus]
Length=705

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLL+S E   TL ++    +  P +V N+L R   E   + +K   +T D 
Sbjct  524  GYHQGVPSRSLLSSQEGQTTLLMQLTYTIQHPGYVRNILNREYPELGYDDLKSWRMTQDS  583

Query  455  TGAVFDVST------EDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+++      ED    + G     ++++L    TLPPLQER+
Sbjct  584  MGVVFDINSSKCEVQEDGTVLLAGRPWTTHNITLTAPSTLPPLQERD  630



>ref|XP_009837773.1| hypothetical protein H257_12310 [Aphanomyces astaci]
 gb|ETV72987.1| hypothetical protein H257_12310 [Aphanomyces astaci]
Length=683

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 4/101 (4%)
 Frame = -2

Query  632  GYTEIKSR-SLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GYT    + SLLT   + VT+  ES  P+Y+  +V+N + R + EE A +IK + LTAD 
Sbjct  531  GYTRPTPQASLLTGAPDMVTVLFESTNPIYAKGYVWNAVNRDIPEEFAGAIKNMQLTADS  590

Query  455  TGAVFDVSTEDVDTFIEGAKK---AYDVSLEVVKTLPPLQE  342
             GA F++    +    E  KK    +     + + LP +QE
Sbjct  591  MGACFELPLAGLPLLEELMKKDQGDFKCPYSIPRALPTMQE  631



>ref|NP_001039224.1| nucleolar RNA helicase 2 [Xenopus (Silurana) tropicalis]
 emb|CAJ82454.1| novel GUCT (NUC152) domain containing DEAD/DEAH box helicase 
[Xenopus (Silurana) tropicalis]
Length=755

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL      VT+ L+S   +++ S+ +  +K  L E+    I  + L  D  
Sbjct  614  GATSIKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSM  673

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +E++ +  EG K        V   LP +QE E+
Sbjct  674  GVCFDVRSENLQSMQEGWKDTRRWQFTVATELPAIQESER  713



>gb|AAI57756.1| LOC734085 protein [Xenopus (Silurana) tropicalis]
Length=758

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 49/100 (49%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL      VT+ L+S   +++ S+ +  +K  L E+    I  + L  D  
Sbjct  614  GATSIKQRSLLNMEAGYVTITLKSSVQIHNLSYAWRSIKEQLGEDIDSKIHRMCLLKDSM  673

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +E++ +  EG K        V   LP +QE E+
Sbjct  674  GVCFDVRSENLQSMQEGWKDTRRWQFTVATELPAIQESER  713



>ref|XP_003058076.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=748

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGK--PVYSPSFVYNVLKRFLSEETAESIKGLTLTAD  459
            G+ E+++RSLLTS     TL   +G    + +P++V+N L++ L E   + I+ LTL AD
Sbjct  575  GHGELRTRSLLTSHTGQTTLLFAAGGTTEIRTPTYVWNFLRQRLDESDLQ-IRRLTLCAD  633

Query  458  GTGAVFDVSTEDVDTF  411
              GAVFDV +E  D F
Sbjct  634  SKGAVFDVPSELADKF  649



>gb|KFH64685.1| hypothetical protein MVEG_09417 [Mortierella verticillata NRRL 
6337]
Length=487

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 8/103 (8%)
 Frame = -2

Query  620  IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVF  441
            +++RSL+++ E   T+       +    +V N+L R   +   E +KG+ +T D  G VF
Sbjct  336  VRARSLMSATEGFTTMVFRLSHEIQHSGYVRNILTRNFPKLGYEDVKGMRMTKDMMGVVF  395

Query  440  DVSTE-----DVDTFIEGAKKAYD---VSLEVVKTLPPLQERE  336
            DV +E     D +  I    K  D   + LEV KTLP L++R+
Sbjct  396  DVVSEKLEVDDKENIILAGSKWVDLDNIQLEVAKTLPELEQRQ  438



>ref|XP_002507890.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69148.1| predicted protein [Micromonas sp. RCC299]
Length=631

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 5/104 (5%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGK--PVYSPSFVYNVLKRFLSEETAESIKGLTLTAD  459
            G+ E++ RSLLTS     TL   +G    + +P++V+N LK+ + E+  + ++ LTL AD
Sbjct  474  GHGELRQRSLLTSHTGQTTLLFTAGNNTEIRTPTYVWNFLKQRMDEKDIQ-LRRLTLQAD  532

Query  458  GTGAVFDVSTEDVDTF--IEGAKKAYDVSLEVVKTLPPLQEREQ  333
              GAVFDV +E  + F  +   K    +++ V + LP L  + Q
Sbjct  533  SKGAVFDVPSELQEKFLALSDTKGPTPITISVCEELPELVMKPQ  576



>gb|EPB89647.1| hypothetical protein HMPREF1544_03579 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=704

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 57/107 (53%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLL+S E   TL L+    +  P +V N+L R   E   + +KG  +T D 
Sbjct  526  GYHQGVPSRSLLSSQEGLTTLLLQLTYTIQHPGYVRNILNREYPELGYDDLKGWRMTQDS  585

Query  455  TGAVFDVSTEDVDTFIEG----AKKAY---DVSLEVVKTLPPLQERE  336
             G VFD+S    +   +G    A + +   +++L    TLPPLQER+
Sbjct  586  MGVVFDISCSKCEVQEDGTVLLAGRPWTSNNITLTAPSTLPPLQERD  632



>emb|CEP17128.1| hypothetical protein [Parasitella parasitica]
Length=708

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 56/107 (52%), Gaps = 8/107 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY + + SRSLL+S E   TL ++    +  P +V N+L R   E   + +K   +T D 
Sbjct  529  GYHQGVPSRSLLSSQEGQTTLLMQLTYTIQHPGYVRNILNREYPELGYDDLKSWRMTQDS  588

Query  455  TGAVFDVST------EDVDTFIEGAK-KAYDVSLEVVKTLPPLQERE  336
             G VFD+++      ED    + G    +++++L    TLP LQERE
Sbjct  589  MGVVFDINSSKCEVQEDGTVLLAGRPWTSHNITLTAPSTLPALQERE  635



>gb|AAI08449.1| LOC398188 protein [Xenopus laevis]
Length=768

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL      +T+ L+S  P+++ S+ +  +K  L E+    I  + L  D  
Sbjct  624  GATSIKQRSLLNMEAGYMTITLKSSVPIHNLSYAWRSIKEQLGEDVDSKIHRMCLLKDSM  683

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +ED+ +  E           +   LP +QE E+
Sbjct  684  GVCFDVRSEDLQSMQESWSDTRRWQFTITTELPEIQESER  723



>sp|Q9DF36.2|DD21B_XENLA RecName: Full=Nucleolar RNA helicase 2-B; AltName: Full=DEAD 
box protein 21-B; AltName: Full=Gu-alpha-B; AltName: Full=Nucleolar 
RNA helicase Gu-B; Short=xGu-2; AltName: Full=Nucleolar 
RNA helicase II-B; AltName: Full=RH II/Gu-B [Xenopus laevis]
Length=800

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL      +T+ L+S  P+++ S+ +  +K  L E+    I  + L  D  
Sbjct  656  GATSIKQRSLLNMEAGYMTITLKSSVPIHNLSYAWRSIKEQLGEDVDSKIHRMCLLKDSM  715

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +ED+ +  E           +   LP +QE E+
Sbjct  716  GVCFDVRSEDLQSMQESWSDTRRWQFTITTELPEIQESER  755



>ref|NP_001082033.1| nucleolar RNA helicase 2 [Xenopus laevis]
 gb|AAG22818.1|AF302422_1 RNA helicase II/Gu [Xenopus laevis]
Length=800

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T IK RSLL      +T+ L+S  P+++ S+ +  +K  L E+    I  + L  D  
Sbjct  656  GATSIKQRSLLNMEAGYMTITLKSSVPIHNLSYAWRSIKEQLGEDVDSKIHRMCLLKDSM  715

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
            G  FDV +ED+ +  E           +   LP +QE E+
Sbjct  716  GVCFDVRSEDLQSMQESWSDTRRWQFTITTELPEIQESER  755



>ref|XP_786504.3| PREDICTED: nucleolar RNA helicase 2-like [Strongylocentrotus 
purpuratus]
Length=751

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGT  453
            G T +K+RSLLT+ E   T  LE+   +     V+  L R++  ++  +IKG+ L  D T
Sbjct  555  GSTAMKTRSLLTAEEGKTTFLLETQSQLMDIGDVFKTLGRYIDRDSRNAIKGIRLCKDQT  614

Query  452  GAVFDVSTEDVDTFIEGAKKAYDVSLEVVKTLPPL  348
             AVFDVS +  D  +   +   +  L +   LP L
Sbjct  615  AAVFDVSDDHKDYLLSLWQDTSEAQLTIATELPEL  649



>ref|XP_009010130.1| hypothetical protein HELRODRAFT_190040 [Helobdella robusta]
 gb|ESO11642.1| hypothetical protein HELRODRAFT_190040 [Helobdella robusta]
Length=820

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 58/102 (57%), Gaps = 9/102 (9%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVT-LHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G  EIK RSLL+S E  VT L+  SG+ +   S+V+N L + ++++  E+I G+    D 
Sbjct  674  GNQEIKQRSLLSSREGMVTFLYRTSGEEIRYMSYVWNALGKCINQDMKEAINGMRFCKDR  733

Query  455  TGAVFDVSTEDVDT----FIEGAKKAYDVSLEVVKTLPPLQE  342
             G  FD++ +        +++G    +D +L+  +TLP L++
Sbjct  734  MGVAFDIAADKASQLESLWVDG---KHD-TLKRTETLPELEQ  771



>ref|XP_001012258.1| DEAD/DEAH box helicase family protein [Tetrahymena thermophila]
Length=744

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 10/105 (10%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+TE +K RSLL  +E  VT  + +        +++  +K     E  + IKG+   AD 
Sbjct  508  GFTEKMKQRSLLCCLEGYVTYIVRTPSEFRGLGYIWGWVKNNFPAECTDRIKGMKKFADN  567

Query  455  TGAVFDVSTEDVDTF-------IEGAKKAYDVSLEVVKTLPPLQE  342
             GAVFDV+ ED + F        EG K+   + LEV  T+P ++E
Sbjct  568  KGAVFDVAEEDKEVFDAYINELAEGTKQG--LELEVATTIPEIEE  610



>gb|EAR92013.2| DEAD/DEAH-box helicase family protein [Tetrahymena thermophila 
SB210]
Length=724

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 10/105 (10%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+TE +K RSLL  +E  VT  + +        +++  +K     E  + IKG+   AD 
Sbjct  508  GFTEKMKQRSLLCCLEGYVTYIVRTPSEFRGLGYIWGWVKNNFPAECTDRIKGMKKFADN  567

Query  455  TGAVFDVSTEDVDTF-------IEGAKKAYDVSLEVVKTLPPLQE  342
             GAVFDV+ ED + F        EG K+   + LEV  T+P ++E
Sbjct  568  KGAVFDVAEEDKEVFDAYINELAEGTKQG--LELEVATTIPEIEE  610



>emb|CBJ26838.1| DEAD box helicase [Ectocarpus siliculosus]
Length=694

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (55%), Gaps = 7/99 (7%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G TE +  RSLL++ E  VT+   S  P+   ++ +  +++ LS   A++I+G+ L+ DG
Sbjct  587  GRTEAMPVRSLLSNSEGHVTIIFRSDHPIEYMAYCWTAIRKVLSSAAADNIRGMQLSEDG  646

Query  455  TGAVFDVSTEDVDTFIEGAKKAYDVS--LEVVKTLPPLQ  345
               VFDV  E     +EG +   +    L++   LPPL+
Sbjct  647  LACVFDVPEE----HMEGVRDVCEREDWLDICTELPPLK  681



>emb|CCI44343.1| unnamed protein product [Albugo candida]
Length=649

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 50/99 (51%), Gaps = 4/99 (4%)
 Frame = -2

Query  626  TEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGA  447
            T  +  S+++   + VT+   S K + +  +V+N L R    ETA +IK LT+T D  GA
Sbjct  519  TPPRPHSIMSGAPDYVTVLFSSSKEIRAKGYVWNALNRDFDPETASNIKQLTITQDSYGA  578

Query  446  VFDV---STEDVDTFIE-GAKKAYDVSLEVVKTLPPLQE  342
             FD+   S E +   I+   K  Y     +  TLP LQ+
Sbjct  579  CFDLPSNSREKLQEIIDTSGKDQYKCPYSIPTTLPKLQQ  617



>ref|XP_008873274.1| hypothetical protein H310_09087 [Aphanomyces invadans]
 gb|ETV98399.1| hypothetical protein H310_09087 [Aphanomyces invadans]
Length=675

 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = -2

Query  632  GYTEIKSR-SLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GYT    + SLL+   + VT+  ES  P+ +  +V+N + R + EE A  IK + LTAD 
Sbjct  526  GYTRPTPQASLLSGAPDMVTVLFESSNPIRAKGYVWNAVNRDIPEEFASGIKNMQLTADA  585

Query  455  TGAVFDVSTEDVDTFIEGAKKA----YDVSLEVVKTLPPLQE  342
             GA F++    +   +EG  K     +     + ++LP +QE
Sbjct  586  LGACFELPLAGL-PHLEGLMKKEQGEFKCPYSIPRSLPTMQE  626



>ref|XP_008657391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Zea mays]
Length=182

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSFV  531
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F 
Sbjct  145  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGFA  178



>ref|XP_008678603.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Zea mays]
Length=121

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSF  534
            GYT++K RSLL+S+E+  TLHL++G+P++SP F
Sbjct  84   GYTDLKKRSLLSSLEDYSTLHLQTGRPMWSPGF  116



>gb|KDO19871.1| hypothetical protein SPRG_14901 [Saprolegnia parasitica CBS 223.65]
Length=648

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 47/96 (49%), Gaps = 4/96 (4%)
 Frame = -2

Query  608  SLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGAVFDVST  429
            SLL+   +  T+  ES   + +  +V+N + R + EE A+ IK + LTAD  GA FD+  
Sbjct  513  SLLSGSPDLTTILFESANVIRAKGYVWNAVNRDIPEEFAKDIKSMQLTADSMGACFDLPN  572

Query  428  EDV----DTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
              +    D        +Y     + KTLP +QE  Q
Sbjct  573  AGLKVIEDLIAAKDSSSYGCPYSIPKTLPKMQELPQ  608



>ref|XP_003078811.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL51691.1| Helicase, C-terminal [Ostreococcus tauri]
Length=693

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 6/105 (6%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHL-ESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+ E++ RSLLTS     TL    +G  + +P++V+N L++ + E   + ++ LTL+ D 
Sbjct  526  GHGELRQRSLLTSHSGQTTLLFTANGVDIRTPTYVWNFLRQRMDESELQ-LRRLTLSMDN  584

Query  455  TGAVFDVSTEDVDTFIEGAKKAYD----VSLEVVKTLPPLQEREQ  333
              AVFDV +E  D F+  ++ A      V++     LP L +R Q
Sbjct  585  KAAVFDVPSELADKFVALSEPATSGKTAVTIIECAELPELSQRPQ  629



>ref|XP_008674116.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=196

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSF  534
            GYT+IK RSLL+S+E+  TLHL++G+P++SP F
Sbjct  159  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGF  191



>ref|XP_001417262.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95555.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=654

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGK-PVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+ E++ RSLLTS     TL   +G+  + +P++V+N L++ + E   + ++ LTL+ D 
Sbjct  528  GHGELRQRSLLTSHSGQTTLLFTAGETQIRTPTYVWNFLRQRMDENDLQ-LRRLTLSVDN  586

Query  455  TGAVFDVSTEDVDTF  411
              AVFDV +E  D F
Sbjct  587  MAAVFDVPSELADKF  601



>ref|XP_008611506.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
 gb|EQC35222.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
Length=662

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 5/105 (5%)
 Frame = -2

Query  632  GYTEIKSR-SLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            G+T+  ++ SLL+   +  T+  ES   + +  +V+N + R + EE A+ IK + LTAD 
Sbjct  517  GHTKPPAKASLLSGSPDLTTVLFESSNVIRAKGYVWNAVNRDIPEEFAKDIKSMQLTADS  576

Query  455  TGAVFDVSTEDV----DTFIEGAKKAYDVSLEVVKTLPPLQEREQ  333
             GA FD+    +    D        +Y     + KTLP +QE  Q
Sbjct  577  MGACFDLPNAGLKVIEDLIAAKDSSSYGCPYSLPKTLPKMQELPQ  621



>ref|XP_008678151.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=121

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSF  534
            GYT+IK RSLL+ +E+  TLHL++G+P++SP F
Sbjct  84   GYTDIKKRSLLSFLEDYSTLHLQTGRPMWSPGF  116



>ref|XP_008659659.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Zea mays]
Length=123

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSP  540
            GYT+IK RSLL+S+E+  TLHL++G+P++SP
Sbjct  84   GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSP  114



>ref|XP_004029989.1| hypothetical protein IMG5_169500 [Ichthyophthirius multifiliis]
 gb|EGR28753.1| hypothetical protein IMG5_169500 [Ichthyophthirius multifiliis]
Length=727

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 10/105 (10%)
 Frame = -2

Query  632  GYTE-IKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADG  456
            GY E +K RSLL  +E   T  +++   +    +++N LK     E  + +KG+   AD 
Sbjct  507  GYIEGVKQRSLLCCLEGYCTYIVKAPHEIRGLGYIWNWLKSNFDIEVVDRVKGMKKCADS  566

Query  455  TGAVFDVSTEDVDTFIE-------GAKKAYDVSLEVVKTLPPLQE  342
             GAVFDV+  D+  F E       GAKK   + LE    +P L++
Sbjct  567  LGAVFDVAESDIVKFEEYIQNIADGAKKG--LLLEKATVMPKLED  609



>ref|XP_005713628.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-like, putative [Chondrus 
crispus]
 emb|CDF33809.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-like, putative [Chondrus 
crispus]
Length=740

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 4/101 (4%)
 Frame = -2

Query  632  GYT--EIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTAD  459
            GYT    KSRSLL+  ++C        +   S    +++L+R +  + A  +KG+ L  D
Sbjct  568  GYTADRFKSRSLLSCFQDCTAAIFCGSQGFESSGHAWSMLRRVIGGDIAAEMKGMQLCKD  627

Query  458  GTGAVFDVSTEDVDTFIEGAKKAYD-VSLEV-VKTLPPLQE  342
             + AVFDV    V   ++ A+   D  ++E+ ++TLP L+E
Sbjct  628  RSKAVFDVPERQVKRLVKAAQDLPDGFTVELAMETLPELEE  668



>ref|XP_008674113.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 ref|XP_008674114.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 ref|XP_008674115.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
Length=198

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  632  GYTEIKSRSLLTSMENCVTLHLESGKPVYSPSF  534
            GYT+IK RSLL+S+E+  TLHL++G+P++SP  
Sbjct  159  GYTDIKKRSLLSSLEDYSTLHLQTGRPMWSPGL  191



>emb|CCA17723.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
 emb|CCA18369.1| DEAD/DEAH box RNA helicase putative [Albugo laibachii Nc14]
Length=660

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/101 (30%), Positives = 52/101 (51%), Gaps = 4/101 (4%)
 Frame = -2

Query  626  TEIKSRSLLTSMENCVTLHLESGKPVYSPSFVYNVLKRFLSEETAESIKGLTLTADGTGA  447
            T  +  SL++   + VT+   S K + +  +V+N L R    E A +IK LT+T D  GA
Sbjct  535  TPPRPHSLMSGTPDYVTVLFTSSKEIRAKGYVWNALNRDFDPEVANNIKQLTITQDSYGA  594

Query  446  VFDV---STEDVDTFIEGAKK-AYDVSLEVVKTLPPLQERE  336
             FD+   + E +   +  +++  Y+    +  TLP LQ+ +
Sbjct  595  CFDLPMSAREKLQEIMSSSQQDRYNCPYSIPTTLPKLQQSQ  635



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1233376381380