BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030M05

Length=690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    376   1e-126   Elaeis guineensis
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     375   3e-126   Sesamum indicum [beniseed]
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    375   3e-126   Oryza brachyantha
gb|KJB54391.1|  hypothetical protein B456_009G074800                    368   4e-126   Gossypium raimondii
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                373   4e-126   Erythranthe guttata [common monkey flower]
gb|KJB83533.1|  hypothetical protein B456_013G252200                    371   2e-125   Gossypium raimondii
ref|NP_001265946.1|  Hop-interacting protein THI032                     373   2e-125   Solanum lycopersicum
gb|KJB54393.1|  hypothetical protein B456_009G074800                    369   4e-125   Gossypium raimondii
gb|AAL47679.1|  aminotransferase 1                                      372   4e-125   Cucumis melo [Oriental melon]
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             372   4e-125   Prunus persica
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     372   5e-125   Prunus mume [ume]
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    372   5e-125   Cucumis sativus [cucumbers]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    371   9e-125   
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     371   1e-124   Pyrus x bretschneideri [bai li]
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    371   1e-124   Solanum tuberosum [potatoes]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     371   1e-124   Fragaria vesca subsp. vesca
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     371   1e-124   Gossypium hirsutum [American cotton]
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     371   2e-124   Nicotiana tomentosiformis
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     370   2e-124   Nicotiana sylvestris
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       370   3e-124   Gossypium arboreum [tree cotton]
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     370   4e-124   Malus domestica [apple tree]
gb|AAQ56192.1|  aminotransferase 1                                      369   5e-124   Cucumis melo [Oriental melon]
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         369   6e-124   Ricinus communis
gb|KJB54389.1|  hypothetical protein B456_009G074800                    369   7e-124   Gossypium raimondii
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             363   7e-124   
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                369   8e-124   Cucumis melo [Oriental melon]
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          368   2e-123   Amborella trichopoda
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      368   2e-123   
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     368   2e-123   
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             364   2e-123   
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     366   2e-123   Peperomia schizandra
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     367   3e-123   Tarenaya hassleriana [spider flower]
ref|NP_001062170.1|  Os08g0502700                                       367   3e-123   
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     367   4e-123   Elaeis guineensis
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             367   4e-123   Fritillaria agrestis
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     367   4e-123   Eucalyptus grandis [rose gum]
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     367   4e-123   Nelumbo nucifera [Indian lotus]
gb|ABQ81924.1|  aminotransferase 2                                      367   6e-123   Cucumis sativus [cucumbers]
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     367   6e-123   Phoenix dactylifera
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    367   7e-123   Sesamum indicum [beniseed]
dbj|BAJ90006.1|  predicted protein                                      366   8e-123   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           366   8e-123   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      366   8e-123   Cucumis sativus [cucumbers]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    366   9e-123   Cucumis melo [Oriental melon]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         366   9e-123   Jatropha curcas
gb|AAQ56193.1|  aminotransferase 2                                      366   1e-122   Cucumis melo [Oriental melon]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            366   1e-122   Cucumis melo [Oriental melon]
gb|AFK37194.1|  unknown                                                 360   1e-122   Medicago truncatula
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     365   2e-122   Triticum urartu
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       365   2e-122   Gossypium arboreum [tree cotton]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  365   3e-122   Citrus sinensis [apfelsine]
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    360   3e-122   
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    365   3e-122   Citrus sinensis [apfelsine]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     363   5e-122   Peperomia bracteata
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     363   7e-122   Peperomia cerrateae
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     363   7e-122   Peperomia cerrateae
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     364   7e-122   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             364   9e-122   Populus trichocarpa [western balsam poplar]
gb|ABQ81925.1|  aminotransferase 2                                      363   9e-122   Cucumis melo [Oriental melon]
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     362   1e-121   Peperomia cerrateae
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    363   2e-121   Cucumis sativus [cucumbers]
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             363   2e-121   Citrus clementina [clementine]
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     362   2e-121   Peperomia bracteata
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     363   2e-121   Beta vulgaris subsp. vulgaris [field beet]
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     361   2e-121   Peperomia cavispicata
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     361   2e-121   Peperomia radiatinervosa
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     361   2e-121   Peperomia bracteata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     363   2e-121   Populus euphratica
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia bracteata
gb|ABK24112.1|  unknown                                                 362   3e-121   Picea sitchensis
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     360   3e-121   Peperomia radiatinervosa
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     360   3e-121   Peperomia ayacuchoana
gb|ACN39798.1|  unknown                                                 362   3e-121   Picea sitchensis
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia bracteata
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     361   3e-121   Peperomia parvisagittata
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    362   3e-121   Glycine max [soybeans]
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     360   4e-121   Peperomia radiatinervosa
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      362   5e-121   Genlisea aurea
ref|NP_001237048.1|  enzymatic resistance protein                       362   6e-121   
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    362   6e-121   Glycine max [soybeans]
emb|CBI24214.3|  unnamed protein product                                360   7e-121   Vitis vinifera
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                361   9e-121   Medicago truncatula
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     360   1e-120   Peperomia parvisagittata
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     359   1e-120   Peperomia bracteata
emb|CDP08481.1|  unnamed protein product                                361   1e-120   Coffea canephora [robusta coffee]
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     359   2e-120   Peperomia andina
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     360   2e-120   Glycine soja [wild soybean]
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    360   2e-120   
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     360   2e-120   Vitis vinifera
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     359   2e-120   Peperomia pseudoverruculosa
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           360   2e-120   Glycine max [soybeans]
gb|AFK40703.1|  unknown                                                 360   3e-120   Medicago truncatula
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     358   3e-120   Peperomia questionis
emb|CAN84001.1|  hypothetical protein VITISV_007680                     360   3e-120   Vitis vinifera
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     358   4e-120   Peperomia verruculosa
gb|ACN36238.1|  unknown                                                 357   4e-120   Zea mays [maize]
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    359   4e-120   Setaria italica
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     358   6e-120   Peperomia verruculosa
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      359   6e-120   Spirodela polyrhiza
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    359   7e-120   Glycine max [soybeans]
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     361   9e-120   Brachypodium distachyon [annual false brome]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             358   9e-120   Phaseolus vulgaris [French bean]
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    358   1e-119   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     356   1e-119   Peperomia bracteata
ref|NP_001148339.1|  LOC100281949                                       358   1e-119   Zea mays [maize]
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    359   2e-119   
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     357   2e-119   Peperomia peruviana
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    358   2e-119   Phaseolus vulgaris [French bean]
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     357   2e-119   Peperomia parvifolia
ref|XP_002313371.1|  aminotransferase 2 family protein                  358   2e-119   
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     356   3e-119   Peperomia rupiseda
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          357   5e-119   Sorghum bicolor [broomcorn]
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    357   7e-119   Populus euphratica
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     355   7e-119   Peperomia sp. JN-2011
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     355   8e-119   Peperomia chutanka
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             356   1e-118   
emb|CDY37208.1|  BnaA09g08290D                                          355   1e-118   Brassica napus [oilseed rape]
emb|CDX81443.1|  BnaC09g08540D                                          355   1e-118   
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     355   2e-118   Brassica rapa
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     353   2e-118   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     353   2e-118   Peperomia aff. gracillima JN-2011
gb|ABK96624.1|  unknown                                                 355   3e-118   Populus trichocarpa x Populus deltoides
dbj|BAJ33858.1|  unnamed protein product                                356   3e-118   Eutrema halophilum
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     352   6e-118   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    353   1e-117   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     351   3e-117   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     350   4e-117   Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          351   7e-117   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     349   9e-117   Peperomia polycephala
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    350   2e-116   Camelina sativa [gold-of-pleasure]
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     348   2e-116   Peperomia peruviana
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    350   3e-116   Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  349   6e-116   Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      347   2e-115   Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             347   3e-115   
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             344   5e-114   Capsella rubella
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     337   7e-112   Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     337   8e-112   Peperomia putlaensis
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    339   2e-111   Camelina sativa [gold-of-pleasure]
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     335   2e-111   Peperomia cyclaminoides
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     334   4e-111   Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     335   5e-111   Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     334   7e-111   Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     332   1e-110   Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     332   2e-110   Peperomia peruviana
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     332   3e-110   Peperomia cyclaminoides
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     332   3e-110   Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     332   4e-110   Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     330   2e-109   Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     329   4e-109   Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     327   4e-108   Peperomia sp. JN-2011
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     326   1e-107   Peperomia aff. ovatopeltata JN-2011
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     326   1e-107   Peperomia exclamationis
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    325   2e-106   Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                322   2e-105   Medicago truncatula
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     315   9e-104   Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     315   1e-103   Peperomia aff. pinoi JN-2011
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             316   3e-103   Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             315   1e-102   
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     311   4e-102   Peperomia jalcaensis
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     311   6e-102   Peperomia parvisagittata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     311   6e-102   Peperomia elatior
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     309   3e-101   Peperomia wernerrauhii
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     308   1e-100   Peperomia cerrateae
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     307   1e-100   Peperomia schizandra
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     306   3e-100   Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     305   4e-100   Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     305   1e-99    Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     304   3e-99    Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     304   3e-99    Peperomia wernerrauhii
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     298   2e-97    
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             301   3e-97    Selaginella moellendorffii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             300   1e-96    Selaginella moellendorffii
gb|AEA48973.1|  glyoxylate aminotransferase                             290   4e-96    Rosa roxburghii [chestnut rose]
ref|XP_001755667.1|  predicted protein                                  297   9e-96    
ref|XP_001783551.1|  predicted protein                                  296   3e-95    
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     289   1e-93    Peperomia sp. JN-2011
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                289   5e-93    Morus notabilis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     286   2e-92    Peperomia aff. ovatopeltata JN-2011
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             284   8e-91    
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                284   1e-90    
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              278   1e-90    
gb|ABR16109.1|  unknown                                                 282   2e-90    Picea sitchensis
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  280   1e-89    Citrus sinensis [apfelsine]
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   2e-88    
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              276   6e-88    
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                275   8e-88    
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   6e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                261   2e-82    
ref|XP_001763095.1|  predicted protein                                  259   4e-81    
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     236   3e-75    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     234   2e-74    Phaseolus vulgaris [French bean]
gb|AGN53916.1|  glyoxylate aminotransferase                             233   3e-74    Silene latifolia
gb|AGN53915.1|  glyoxylate aminotransferase                             233   5e-74    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             232   7e-74    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             232   9e-74    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             232   1e-73    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             231   2e-73    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             231   3e-73    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             230   4e-73    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             230   7e-73    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             230   7e-73    Silene vulgaris [maiden's-tears]
gb|AGN53921.1|  glyoxylate aminotransferase                             229   1e-72    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             229   2e-72    Silene vulgaris [maiden's-tears]
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   7e-70    Arabidopsis thaliana [mouse-ear cress]
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    220   6e-66    Methylobacterium aquaticum
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                219   4e-65    Methylocapsa aurea
gb|AEW08188.1|  hypothetical protein 2_2585_01                          209   9e-65    Pinus lambertiana
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     216   1e-64    Methyloceanibacter caenitepidi
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 216   2e-64    Auxenochlorella protothecoides
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                215   9e-64    
gb|AFG57258.1|  hypothetical protein 2_2585_01                          206   1e-63    Pinus taeda
gb|AEW08187.1|  hypothetical protein 2_2585_01                          205   2e-63    Pinus radiata
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      213   5e-63    Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                213   5e-63    Hyphomicrobium nitrativorans
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    213   6e-63    Methylocystaceae
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                213   9e-63    Methylocapsa acidiphila
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                211   2e-62    Methylosinus
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                211   2e-62    Methylosinus sp. LW4
ref|XP_005709273.1|  serine--glyoxylate transaminase                    211   2e-62    Galdieria sulphuraria
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                211   3e-62    Methylobacterium sp. MB200
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                211   4e-62    Methylorubrum populi
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     209   5e-62    Methylorubrum extorquens DM4
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                209   1e-61    Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                209   1e-61    Methylorubrum extorquens
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                209   2e-61    Methylocella silvestris
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                209   2e-61    Methylobacteriaceae
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                208   4e-61    Paraburkholderia sacchari
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                208   4e-61    Methylosinus
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              207   2e-60    Volvox carteri f. nagariensis
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylobacterium
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                206   2e-60    Methylobacterium nodulans
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                206   3e-60    Methylocaldum szegediense
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                204   9e-60    Methylobacterium sp. 88A
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                205   9e-60    Methylobacterium sp. 4-46
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                205   1e-59    Methylobacterium sp. WSM2598
gb|KIZ03753.1|  serine--glyoxylate transaminase                         204   3e-59    Monoraphidium neglectum
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                203   4e-59    Caballeronia glathei
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                202   4e-59    Hyphomicrobium zavarzinii
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                202   5e-59    Methylobacterium sp. 77
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                202   9e-59    Methylocystis parvus
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                201   2e-58    Paraburkholderia mimosarum
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    201   3e-58    Hyphomicrobium methylovorum
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                200   4e-58    Hyphomicrobium denitrificans
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                200   4e-58    Methylocystis sp. ATCC 49242
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                200   4e-58    Methylobacterium
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                201   4e-58    Paraburkholderia phymatum
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    200   5e-58    Methylobacterium
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                200   5e-58    Granulibacter bethesdensis
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                200   5e-58    Granulibacter bethesdensis
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                200   6e-58    Ferrovum
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     200   8e-58    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        200   8e-58    Granulibacter bethesdensis CGDNIH4
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                199   9e-58    Hyphomicrobium denitrificans
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                199   9e-58    Methylobacterium
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                199   1e-57    Methylobacterium
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    199   1e-57    Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           199   2e-57    Methylobacterium mesophilicum
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                199   2e-57    Paraburkholderia terrae
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                198   2e-57    Granulibacter bethesdensis
gb|AIQ91949.1|  Aminotransferase class V                                199   3e-57    Methylobacterium oryzae CBMB20
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        199   3e-57    Granulibacter bethesdensis
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                198   5e-57    Burkholderia sp. UYPR1.413
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                197   5e-57    Methyloversatilis universalis
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                198   5e-57    Paraburkholderia hospita
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                197   5e-57    Methylobacterium sp. B34
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                197   6e-57    Paraburkholderia caribensis
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    197   6e-57    Hyphomicrobium
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                197   6e-57    Paraburkholderia oxyphila
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    188   7e-57    Prunus avium [gean]
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                197   8e-57    Burkholderiaceae
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                196   1e-56    
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    196   1e-56    Methylibium
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      196   2e-56    Methylibium petroleiphilum PM1
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    187   3e-56    Dactylis glomerata [cocksfoot]
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    186   3e-56    Betula pendula [white birch]
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                195   3e-56    Dongia sp. URHE0060
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                195   4e-56    Methylopila sp. M107
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    186   5e-56    Hedera helix [English ivy]
gb|AID30749.1|  serine--glyoxylate aminotransferase                     190   8e-56    
ref|WP_020188076.1|  hypothetical protein                               194   9e-56    
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                194   1e-55    
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                194   1e-55    
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                194   1e-55    
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                193   1e-55    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 194   2e-55    
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                189   2e-55    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                193   2e-55    
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                189   3e-55    
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                189   3e-55    
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                189   3e-55    
emb|CAM59877.2|  alanine:glyoxylate aminotransferase                    184   3e-55    
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                192   3e-55    
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                189   3e-55    
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                191   8e-55    
ref|WP_020592928.1|  hypothetical protein                               191   9e-55    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                191   1e-54    
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                191   1e-54    
emb|CAM59872.1|  alanine:glyoxylate aminotransferase                    182   2e-54    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                190   2e-54    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                190   3e-54    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                190   4e-54    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                189   4e-54    
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                189   5e-54    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                189   5e-54    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                189   6e-54    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    189   6e-54    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                189   6e-54    
emb|CAM59871.2|  alanine:glyoxylate aminotransferase                    181   7e-54    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                189   7e-54    
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                189   7e-54    
emb|CAM84338.1|  alanine:glyoxylate aminotransferase                    180   8e-54    
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                189   8e-54    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                189   8e-54    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                189   9e-54    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                189   9e-54    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                189   1e-53    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                188   1e-53    
emb|CAM59873.1|  alanine:glyoxylate aminotransferase                    180   1e-53    
emb|CAM59868.2|  alanine:glyoxylate aminotransferase                    180   1e-53    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                188   1e-53    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                188   2e-53    
emb|CAM59870.2|  alanine:glyoxylate aminotransferase                    179   2e-53    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                188   2e-53    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                187   2e-53    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    187   3e-53    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                187   4e-53    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 187   4e-53    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 188   4e-53    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 188   5e-53    
emb|CAM59869.2|  alanine:glyoxylate aminotransferase                    178   5e-53    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                187   5e-53    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                187   5e-53    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                187   6e-53    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                186   1e-52    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                186   2e-52    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                185   2e-52    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                185   3e-52    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                185   3e-52    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                185   3e-52    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                184   4e-52    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                184   4e-52    
gb|AFN27487.1|  alanine-glyoxylate transaminase                         175   4e-52    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    184   5e-52    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                184   6e-52    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    184   6e-52    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                184   6e-52    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    184   7e-52    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                184   7e-52    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                184   7e-52    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                184   7e-52    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    184   7e-52    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                184   8e-52    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                184   8e-52    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                184   8e-52    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                184   8e-52    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    184   8e-52    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                184   8e-52    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                183   9e-52    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    183   9e-52    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    183   9e-52    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                183   1e-51    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    182   2e-51    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                182   2e-51    
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                182   2e-51    
gb|AFN27522.1|  alanine-glyoxylate transaminase                         174   2e-51    
gb|AFN27490.1|  alanine-glyoxylate transaminase                         174   2e-51    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                182   2e-51    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                182   2e-51    
gb|AFN27505.1|  alanine-glyoxylate transaminase                         173   2e-51    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                182   2e-51    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                182   2e-51    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    182   3e-51    
ref|XP_005851882.1|  hypothetical protein CHLNCDRAFT_33614              183   3e-51    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    182   3e-51    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                182   3e-51    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                182   3e-51    
gb|AFN27518.1|  alanine-glyoxylate transaminase                         173   3e-51    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                182   3e-51    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                182   3e-51    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                182   3e-51    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                182   3e-51    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                182   3e-51    
gb|AFN27511.1|  alanine-glyoxylate transaminase                         173   4e-51    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                182   4e-51    
ref|WP_020058450.1|  hypothetical protein                               182   4e-51    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                181   5e-51    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                182   5e-51    
gb|AFN27499.1|  alanine-glyoxylate transaminase                         172   5e-51    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                181   5e-51    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                181   5e-51    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                181   6e-51    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                181   7e-51    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                181   7e-51    
emb|CAM84337.1|  alanine:glyoxylate aminotransferase                    172   1e-50    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                181   1e-50    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                181   1e-50    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                180   1e-50    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             182   1e-50    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                180   2e-50    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            180   2e-50    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                180   2e-50    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                180   2e-50    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                180   2e-50    
gb|AFN27496.1|  alanine-glyoxylate transaminase                         171   3e-50    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                179   3e-50    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                179   3e-50    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                179   4e-50    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                179   4e-50    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                179   4e-50    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                179   6e-50    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         179   6e-50    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                179   6e-50    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                178   7e-50    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                179   7e-50    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                178   7e-50    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                178   7e-50    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                178   8e-50    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                178   9e-50    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                178   9e-50    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                178   1e-49    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                177   1e-49    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                177   1e-49    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                177   1e-49    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                177   2e-49    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    178   3e-49    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                177   3e-49    
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                177   4e-49    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                176   4e-49    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    176   5e-49    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    176   5e-49    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                176   5e-49    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                176   6e-49    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                176   7e-49    
ref|WP_023263325.1|  serine--glyoxylate aminotransferase                176   1e-48    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                175   1e-48    
gb|EEE42985.1|  aminotransferase, class V superfamily                   175   1e-48    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                175   1e-48    
ref|WP_028818976.1|  serine--glyoxylate aminotransferase                175   1e-48    
ref|WP_019294507.1|  MULTISPECIES: septum site-determining protein      175   2e-48    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    175   2e-48    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_039187206.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                174   2e-48    
ref|WP_027260136.1|  serine--glyoxylate aminotransferase                174   3e-48    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                174   4e-48    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                174   4e-48    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                174   5e-48    
ref|WP_007817284.1|  serine--glyoxylate aminotransferase                173   6e-48    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                173   6e-48    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                173   7e-48    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                173   8e-48    
ref|WP_024092553.1|  serine--glyoxylate aminotransferase                173   8e-48    
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                173   8e-48    
ref|WP_039396834.1|  serine--glyoxylate aminotransferase                173   9e-48    
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                173   1e-47    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                172   1e-47    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    172   1e-47    
ref|WP_042112271.1|  serine--glyoxylate aminotransferase                172   1e-47    
ref|WP_011872107.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_037929134.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_008209359.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_040605265.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                172   2e-47    
gb|EBA05577.1|  probable serine-glyoxylate aminotransferase             172   2e-47    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_027233841.1|  serine--glyoxylate aminotransferase                172   2e-47    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                172   3e-47    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                172   3e-47    
gb|AGL09530.1|  alanine-glyoxylate aminotransferase                     169   3e-47    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   376 bits (966),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIICASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHNRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYP
Sbjct  317  IDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGV AA+AYLQNTTPMIPSRI
Sbjct  377  VKLGSGVGAAAAYLQNTTPMIPSRI  401



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 202/205 (99%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDN+IARHTRLG ATRLAV+AWGLKNCTQKEEW+SDTVTAVV+PSY
Sbjct  257  YGLRAALDLIFEEGLDNIIARHTRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVVIPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV++AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSTEIVRQAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN+TP+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNSTPLIPSRI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  198  TGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWADYLKFYKMGTYWPYTPSIQLL  257

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RHTRLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVPSY
Sbjct  258  YGLRAALDLIFEEGLDNVIKRHTRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPSY  317

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCL+GVEMVLKD+GYP
Sbjct  318  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLSGVEMVLKDVGYP  377

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  378  VKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   368 bits (944),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  11   TGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  70

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  71   YGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  130

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  131  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  190

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  PMIPSRI
Sbjct  191  VKLGSGVAAACAYLQNNIPMIPSRI  215



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   373 bits (958),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTA SVRVFFDW DYLKFYK+G+YWPYTPSIQLL
Sbjct  155  TGSQKALSLPTGMGIVCASPKALEASKTATSVRVFFDWNDYLKFYKLGSYWPYTPSIQLL  214

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARHTRL  ATRLAV AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  215  YGLRAALDLLFEEGLDNVIARHTRLAKATRLAVDAWGLKNCTQKEEWFSDTVTAVIVPSY  274

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  275  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  334

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAASA+LQNTTP+IPSRI
Sbjct  335  VTLGSGVAAASAFLQNTTPLIPSRI  359



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   371 bits (953),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  138  TGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  197

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  198  YGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  257

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  258  IDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  317

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  318  VKLGSGVAAASAYLQNNIPMIPSRI  342



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   373 bits (958),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +
Sbjct  257  YGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP
Sbjct  317  IESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK GSGVAAASA+LQN+TP+IPSRI
Sbjct  377  VKFGSGVAAASAFLQNSTPLIPSRI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   369 bits (947),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  102  TGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  161

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  162  YGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  221

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  222  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  281

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  PMIPSRI
Sbjct  282  VKLGSGVAAACAYLQNNIPMIPSRI  306



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   372 bits (956),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  257  YGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   372 bits (955),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP Y
Sbjct  257  YGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY QN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   372 bits (955),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP Y
Sbjct  257  YGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY QN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   372 bits (955),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 200/205 (98%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  257  YGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   371 bits (953),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +
Sbjct  257  YGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   371 bits (953),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP Y
Sbjct  257  YGLRTALDLVFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY QN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYFQNNTPLIPSRI  401



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   371 bits (953),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 190/205 (93%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +
Sbjct  257  YGLRAALDLLFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEMVLKDIGYP
Sbjct  317  IESSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGSLNELQLLGCLAGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK GSGVAAASA+LQN+TP+IPSRI
Sbjct  377  VKFGSGVAAASAFLQNSTPLIPSRI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPS+QLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSVQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP Y
Sbjct  257  YGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWVSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDLGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN TP+IPSR+
Sbjct  377  VKLGSGVAAASAYLQNNTPLIPSRV  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDN+I RH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNIIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVKR WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSSEIVKRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   371 bits (952),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK GSGVAAAS +LQN+TP+IPSRI
Sbjct  377  VKFGSGVAAASTFLQNSTPLIPSRI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   370 bits (951),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLLFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSVEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK GSGVAAAS +LQN+TP+IPSRI
Sbjct  377  VKFGSGVAAASTFLQNSTPLIPSRI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   370 bits (950),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCAS KALEA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASQKALEATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP Y
Sbjct  257  YGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNK+AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY QN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYFQNNTPLIPSRI  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   369 bits (948),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  257  YGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVF IGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFSIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   369 bits (948),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGL NCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLNNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAACAYLQNNIPLIPSRI  401



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   369 bits (948),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARHTR+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHTRMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAACAYLQNNIPMIPSRI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   363 bits (932),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLL
Sbjct  40   TGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLL  99

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  100  YGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  159

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  160  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  219

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN+TP+I SRI
Sbjct  220  VKLGSGVAAACAYLQNSTPLIASRI  244



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   369 bits (947),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKAL ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIICASPKALVASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  257  YGLRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYL+FYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLRFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVV+P+ 
Sbjct  257  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVIPAN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+GYP
Sbjct  317  IDSSEIVRRAWNRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN+ PMI SRI
Sbjct  377  VKLGSGVAAASAYLQNSIPMIASRI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG+VCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPS+QLL
Sbjct  197  TGSQKALSLPTGIGLVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSVQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNVITRHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQNT PMIPSRI
Sbjct  377  VKLGSGVAAACAYLQNTIPMIPSRI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +
Sbjct  257  YGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GY 
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYX  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN TP+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNTPLIPSRI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   364 bits (935),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLL
Sbjct  107  TGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLL  166

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  167  YGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  226

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  227  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  286

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN+TP+I SRI
Sbjct  287  VKLGSGVAAACAYLQNSTPLIASRI  311



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   366 bits (940),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 197/201 (98%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   367 bits (943),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWSDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVP +
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAACAYLQNNVPLIPSRI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   367 bits (943),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL
Sbjct  198  TGSQKALSLPTGLGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL  257

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  258  YGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  317

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMVLKDIGYP
Sbjct  318  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMVLKDIGYP  377

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  378  VKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  198  TGSQKALSLPTGMGIVCASPKALEASKMAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  257

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQK+EWFSDTVTAVVVP Y
Sbjct  258  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKDEWFSDTVTAVVVPPY  317

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+++V+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEM+LKD+GYP
Sbjct  318  IDSADVVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMILKDVGYP  377

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQNTTPMIPSRI
Sbjct  378  VKLGSGVAAAAAYLQNTTPMIPSRI  402



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   367 bits (943),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+G +CASPKALEASKTA+S RVFFDW DYLKFYK+GTYWPYTPSIQ+L
Sbjct  197  TGSQKALSMPTGMGFICASPKALEASKTAQSARVFFDWNDYLKFYKIGTYWPYTPSIQML  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+ YLQN+TPMIPSRI
Sbjct  377  VKLGSGVAAAATYLQNSTPMIPSRI  401



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   367 bits (942),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS +VFFDWKDYLKFY+MGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSYKVFFDWKDYLKFYQMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL T TRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHNRLATGTRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IESSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            +KLGSGV AASAY QNTTP+I SRI
Sbjct  377  IKLGSGVGAASAYFQNTTPLIASRI  401



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   367 bits (942),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLENVIERHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAACAYLQNNIPLIPSRI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   367 bits (941),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   367 bits (941),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASK AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIICASPKALEASKMAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHGRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+V+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+G P
Sbjct  317  IDSAEVVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMILKDLGCP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQNT PMIPSRI
Sbjct  377  VKLGSGVAAAAAYLQNTIPMIPSRI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   367 bits (941),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCAS KAL A+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASAKALRATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVPS 
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGQATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPSN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN+TP IPSRI
Sbjct  377  VKLGSGVAAASAYLQNSTPYIPSRI  401



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   366 bits (940),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT+KEE FSDTVTAVVVP Y
Sbjct  257  YGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYP
Sbjct  317  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  377  VKLGSGVAAAAAYLSNSTPLIPSRI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   366 bits (940),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   366 bits (940),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   366 bits (940),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   366 bits (940),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTA+SVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTARSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPS  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMLLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASA+LQN TP+IPSRI
Sbjct  377  VKLGSGVAAASAFLQNNTPLIPSRI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   366 bits (940),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGVGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   366 bits (939),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRPALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   360 bits (923),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  34   TGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLL  93

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  94   YGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPY  153

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYP
Sbjct  154  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYP  213

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  214  VKLGSGVAAASAYLQNNIPLIPSRI  238



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/205 (93%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRAGLDLLFEEGLDNVI RHTRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP Y
Sbjct  257  YGLRAGLDLLFEEGLDNVIKRHTRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYP
Sbjct  317  IDSSEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  377  VKLGSGVAAAAAYLSNSTPLIPSRI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   365 bits (937),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLD+VIARH R+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDSVIARHNRMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYN+SLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVKRAWKRYNMSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAACAYLQNNIPMIPSRI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+
Sbjct  257  YGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPMIPSRI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   360 bits (924),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLL
Sbjct  58   TGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLL  117

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  
Sbjct  118  YGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPN  177

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  178  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  237

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  238  VKLGSGVAAAAAYLSNSTPLIPSRI  262



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   365 bits (937),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+
Sbjct  257  YGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   363 bits (931),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   363 bits (931),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   363 bits (931),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   364 bits (934),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASPKA+EA+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSMPTGMGIVCASPKAMEAAKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVPSY
Sbjct  257  YGLRTALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+S+++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVL+D+GYP
Sbjct  317  INSADVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL+N+TPMI SRI
Sbjct  377  VKLGSGVAAAAAYLRNSTPMITSRI  401



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   364 bits (934),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN+TP+I SRI
Sbjct  377  VKLGSGVAAACAYLQNSTPLIASRI  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   363 bits (933),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK LSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKVLSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            +DS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  MDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+YLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYLQNNIPLIPSRI  401



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   362 bits (930),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 183/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASP+ALEASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPRALEASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP Y
Sbjct  257  YGLRAALDLVFEEGLENVIARHKRLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAAS+Y QN  P+IPSRI
Sbjct  377  VKLGSGVAAASSYFQNNIPLIPSRI  401



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   363 bits (932),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPMIPSRI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   362 bits (928),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   363 bits (931),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+ ASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIISASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +
Sbjct  257  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+VKRAW+RYN+SLGLGLNKVAGKVFRIGHLGN+NELQLLG LAGVEM+LKD+GYP
Sbjct  317  IDSNEVVKRAWRRYNMSLGLGLNKVAGKVFRIGHLGNINELQLLGALAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQN+TPMI SRI
Sbjct  377  VKLGSGVAAAAAYLQNSTPMITSRI  401



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  142  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  201

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  202  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  261

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  321

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  322  VKFGSGVAAAAAYLQNTTPLI  342



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   361 bits (926),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  153  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  212

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  213  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  272

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  273  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  332

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  333  VKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   361 bits (927),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   363 bits (931),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLREALDLLFLEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN TP+I SRI
Sbjct  377  VKLGSGVAAACAYLQNNTPLIASRI  401



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   361 bits (927),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P Y
Sbjct  257  YGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  377  VKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  150  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  209

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  210  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  269

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  329

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  330  VKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   360 bits (925),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  151  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  210

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  211  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  270

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  330

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  331  VKFGSGVAAAEAYLQNTTPLI  351



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+F EGLDNVIARHTRLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P Y
Sbjct  257  YGLRTALDLIFLEGLDNVIARHTRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQ TTP+I SR+
Sbjct  377  VKLGSGVAAAAAYLQMTTPLIASRV  401



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   361 bits (926),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   362 bits (930),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQNT PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNTIPMIPSRI  401



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   360 bits (925),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/201 (91%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGRATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   362 bits (929),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEA+K+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGILCASPKALEATKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQ EEW SDTVTA++VPSY
Sbjct  257  YGLRAALDLVFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQSEEWVSDTVTAIMVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE+VL+D+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVELVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY QN+TP+I SRI
Sbjct  377  VKLGSGVAAASAYFQNSTPLISSRI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   362 bits (928),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA L+L+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALNLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   362 bits (928),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQNT PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNTIPMIPSRI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   360 bits (925),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  170  TGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLL  229

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  230  YGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPY  289

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYP
Sbjct  290  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYP  349

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK+GSGV AASAYLQNT P+IPSRI
Sbjct  350  VKMGSGVGAASAYLQNTIPLIPSRI  374



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   361 bits (927),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYP
Sbjct  317  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   360 bits (923),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQ+EE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQEEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   359 bits (922),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   361 bits (926),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLK YK+GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NV ARH RL  ATRLA++AWGLKNCTQKEEW+SDTVTAV+VP  
Sbjct  257  YGLRAALDLIFEEGLENVFARHARLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGV AA AYLQNTTP+IPSRI
Sbjct  377  VKLGSGVGAACAYLQNTTPLIPSRI  401



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 195/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRATLDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+S+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  INSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKD+LKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDHLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQDTIPMIPSRI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKA SLPTGIGIV ASPKA+EASK+AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKAXSLPTGIGIVVASPKAIEASKSAKSLRVFFDWSDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQ EEW+SDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWYSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            +K GSGVAAASAYLQN  P+IPSRI
Sbjct  377  IKYGSGVAAASAYLQNNIPLIPSRI  401



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   360 bits (925),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCA PKALEASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCAGPKALEASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  257  YGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK+GSGV AASAYLQNT P+IPSRI
Sbjct  377  VKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 193/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   360 bits (924),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL GVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLTGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQ+T PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQDTIPMIPSRI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   360 bits (924),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID +EIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYP
Sbjct  317  IDGAEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQN  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLQNNIPLIPSRI  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   358 bits (920),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/199 (91%), Positives = 193/199 (97%), Gaps = 0/199 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTP  93
            VK GSGVAAA+AYLQNTTP
Sbjct  342  VKFGSGVAAAAAYLQNTTP  360



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   360 bits (923),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCA PKALEASK A+SVR FFDW DYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCAGPKALEASKXAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YG+RA LD++FEEGLDNVI RH+RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  257  YGMRAALDIIFEEGLDNVIERHSRLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VK+GSGV AASAYLQNT P+IPSRI
Sbjct  377  VKMGSGVGAASAYLQNTIPLIPSRI  401



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   358 bits (918),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  151  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  210

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS 
Sbjct  211  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSN  270

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  330

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  331  VKFGSGVAAAAAYLQNTTPLI  351



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLL
Sbjct  124  TGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLL  183

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  
Sbjct  184  YGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPN  243

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  244  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  303

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  304  VKLGSGVAAAAAYLSNSTPLIPSRI  328



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   359 bits (922),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLL
Sbjct  198  TGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLL  257

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  258  YGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  317

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  318  IDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  377

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  378  VKLGSGVAAAAAYLSNSTPLIPSRI  402



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   358 bits (918),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS 
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSN  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   359 bits (921),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 198/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH+RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLENVIRRHSRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPGY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDSSEIV+RAWKR+NLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL+D+GYP
Sbjct  317  IDSSEIVRRAWKRFNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
             KLGSGVAAA+AYL N TP+IPSRI
Sbjct  377  AKLGSGVAAAAAYLLNNTPLIPSRI  401



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   359 bits (921),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A PKA+EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPKAIEASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+Y
Sbjct  257  YGLRAALDLIFEEGLENVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVRRAWKRNNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYLQNT PMIPSRI
Sbjct  377  VKLGSGVAAASAYLQNTIPMIPSRI  401



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   361 bits (926),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 189/205 (92%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASP+ALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL
Sbjct  257  TGSQKALSLPTGLGIVCASPRALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLL  316

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRAGLDL+FEEGLDNVI RHTRLGTATR+AV+AWGLKNCTQKEE FSDTVTAVVVP Y
Sbjct  317  YGLRAGLDLIFEEGLDNVIKRHTRLGTATRMAVEAWGLKNCTQKEENFSDTVTAVVVPPY  376

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  377  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  436

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N TP+IPSRI
Sbjct  437  VKLGSGVAAAAAYLSNATPLIPSRI  461



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   358 bits (920),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCTQKEEW SDTVTAV+VPSY
Sbjct  257  YGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVIVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY +NT P+IPSRI
Sbjct  377  VKLGSGVAAASAYFKNTIPLIPSRI  401



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   358 bits (920),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASPKALEA+K+AKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSMPTGMGIVCASPKALEAAKSAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YG RA LDLLFEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +
Sbjct  257  YGFRAALDLLFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+SS++VKRAW RYNLSLGLGLNKVAGKVFRIGHLGNLN+LQLLGCL+GVEMVL+D+GY 
Sbjct  317  INSSDVVKRAWTRYNLSLGLGLNKVAGKVFRIGHLGNLNDLQLLGCLSGVEMVLRDVGYQ  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYLQNT PMI SRI
Sbjct  377  VKLGSGVAAAAAYLQNTIPMISSRI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   356 bits (914),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/201 (90%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  151  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  210

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+A GLKNCTQKEE FSDTVTAV++PSY
Sbjct  211  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEARGLKNCTQKEECFSDTVTAVMIPSY  270

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  330

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  331  VKFGSGVAAAAAYLQNTTPLI  351



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   358 bits (919),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLL
Sbjct  199  TGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  
Sbjct  259  YGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPN  318

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  319  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  378

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  379  VKLGSGVAAAAAYLSNSTPLIPSRI  403



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   359 bits (922),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASPKALEASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLL
Sbjct  233  TGSQKALSMPTGLGIVCASPKALEASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLL  292

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLF EGLDNV  RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  293  YGLRAALDLLFLEGLDNVFKRHKRLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  352

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  353  IDSGEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  412

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  413  VKLGSGVAAAAAYLSNSTPLIPSRI  437



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 192/201 (96%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA AYLQNTTP+I
Sbjct  342  VKFGSGVAAAEAYLQNTTPLI  362



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  197  TGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSY
Sbjct  257  YGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYP
Sbjct  317  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAY +NT P+IPSRI
Sbjct  377  VKLGSGVAAASAYFKNTIPLIPSRI  401



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/201 (90%), Positives = 194/201 (97%), Gaps = 0/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW D LKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDNLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWERYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            VK GSGVAAA+AYLQNTTP+I
Sbjct  342  VKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   358 bits (918),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN TP+I SR+
Sbjct  377  VKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA+AYLQNT
Sbjct  342  VKFGSGVAAAAAYLQNT  358



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   357 bits (916),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCAS KALEASK A+SVRVFFDWKDYL+FY+MGTYWPYTPSIQLL
Sbjct  198  TGSQKALSMPTGMGIVCASSKALEASKAARSVRVFFDWKDYLRFYEMGTYWPYTPSIQLL  257

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATR AV+AWGLKNC QKEE FSDTVTAVVVP Y
Sbjct  258  YGLRTALDLIFEEGLDNVVKRHNRLGTATRFAVEAWGLKNCCQKEECFSDTVTAVVVPPY  317

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYP
Sbjct  318  IDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYP  377

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  378  VKLGSGVAAAAAYLSNSTPLIPSRI  402



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   357 bits (915),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLF EGL+NV  RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLRAALDLLFAEGLENVFERHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN TP+I SR+
Sbjct  377  VKLGSGVAAACAYLQNNTPLIASRV  401



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   355 bits (910),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VKLGSGVAAA+AYLQNT
Sbjct  342  VKLGSGVAAAAAYLQNT  358



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   355 bits (910),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 180/197 (91%), Positives = 190/197 (96%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA AYLQNT
Sbjct  342  VKFGSGVAAAEAYLQNT  358



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   356 bits (913),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  VVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   355 bits (912),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            + LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  IVLGSGVAAASTYLQHHIPLIPSRI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   355 bits (912),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            + LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  IVLGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            + LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  IVLGSGVAAASTYLQHHIPLIPSRI  401



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGEATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA+AYLQNT
Sbjct  342  VKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   353 bits (907),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/197 (91%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA+AYLQNT
Sbjct  342  VKFGSGVAAAAAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   355 bits (910),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKA+EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKAIEASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLF EGL+NV  RH R G ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLLFAEGLENVFERHARPGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQN TP+I SR+
Sbjct  377  VKLGSGVAAACAYLQNNTPLIASRV  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   356 bits (913),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  234  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  293

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  
Sbjct  294  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPN  353

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  354  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  413

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAAS YLQ+  P+IPSRI
Sbjct  414  VVLGSGVAAASTYLQHHIPLIPSRI  438



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   352 bits (904),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 178/197 (90%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA+AYLQNT
Sbjct  342  VKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   353 bits (906),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  
Sbjct  257  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  VVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   351 bits (900),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 178/198 (90%), Positives = 189/198 (95%), Gaps = 0/198 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNTT  96
            VK GSGVAAA AYLQNTT
Sbjct  342  VKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   350 bits (899),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 178/195 (91%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQ  105
            VK GSGVAAA AYLQ
Sbjct  342  VKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   351 bits (901),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  
Sbjct  257  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAAS YLQ+  P+IPSRI
Sbjct  377  VVLGSGVAAASTYLQHQIPLIPSRI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   349 bits (896),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 176/195 (90%), Positives = 188/195 (96%), Gaps = 0/195 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQ  105
            VK GSGVAAA+AYLQ
Sbjct  342  VKFGSGVAAAAAYLQ  356



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V +GSGVAAAS YLQN  P+IPSRI
Sbjct  377  VVMGSGVAAASTYLQNHIPLIPSRI  401



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   348 bits (894),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/197 (90%), Positives = 188/197 (95%), Gaps = 0/197 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAASAYLQNT  99
            VK GSGVAAA AYLQNT
Sbjct  342  VKFGSGVAAAEAYLQNT  358



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   350 bits (897),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            + +GSGVAAAS YLQN  P+IPSRI
Sbjct  377  IVMGSGVAAASTYLQNHIPLIPSRI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   349 bits (895),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V +GSGVAAAS YLQ+  P+IPSRI
Sbjct  377  VVMGSGVAAASTYLQHHIPLIPSRI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/196 (90%), Positives = 189/196 (96%), Gaps = 0/196 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLL
Sbjct  190  TGSQKALSLPTGLGIICASPKALEASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLL  249

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGLKNCTQKEEWFSDTVTAV+VPSY
Sbjct  250  YGLRAALDLLFEEGLDNVIARHSRLGKATRPAVEAWGLKNCTQKEEWFSDTVTAVLVPSY  309

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP
Sbjct  310  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYP  369

Query  149  VKLGSGVAAASAYLQN  102
            VKLGSGVAAAS  L N
Sbjct  370  VKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   347 bits (890),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IAR+ RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENIIARNARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SEIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V +GSGVAAAS YLQ+  P+IPSRI
Sbjct  377  VVMGSGVAAASTYLQHHIPLIPSRI  401



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   344 bits (882),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  
Sbjct  257  YGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SE+V+RAW+RYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEVVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            + +GSGVAAAS YLQN  P+I SRI
Sbjct  377  IVMGSGVAAASTYLQNHIPLILSRI  401



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   337 bits (863),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/190 (91%), Positives = 183/190 (96%), Gaps = 0/190 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS 
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSN  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAAA  120
            VK GSGVAAA
Sbjct  342  VKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   337 bits (863),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 171/188 (91%), Positives = 182/188 (97%), Gaps = 0/188 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVA  126
            VK GSGVA
Sbjct  342  VKFGSGVA  349



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   339 bits (870),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 167/199 (84%), Positives = 188/199 (94%), Gaps = 0/199 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +
Sbjct  257  YGLRAALDLIFEEGLENIIARHARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ID SEIV+RAW+RYNLSLGLGLNK+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP
Sbjct  317  IDGSEIVRRAWQRYNLSLGLGLNKIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTP  93
            + +GSGVAAAS YLQN  P
Sbjct  377  IVMGSGVAAASTYLQNHIP  395



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   335 bits (859),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  150  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  209

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS 
Sbjct  210  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSN  269

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  329

Query  149  VKLGSGVAA  123
            VK GSGVAA
Sbjct  330  VKFGSGVAA  338



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   334 bits (856),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 170/190 (89%), Positives = 181/190 (95%), Gaps = 0/190 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  141  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  200

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  201  YGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  260

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKV GKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVXGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  320

Query  149  VKLGSGVAAA  120
            VK GSGVAAA
Sbjct  321  VKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   335 bits (858),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIXRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVAA  123
            VK GSGVAA
Sbjct  342  VKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   334 bits (856),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  150  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  209

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  210  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  269

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  329

Query  149  VKLGSGVAA  123
            VK GSGVAA
Sbjct  330  VKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 169/186 (91%), Positives = 180/186 (97%), Gaps = 0/186 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  142  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  201

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  202  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  261

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  321

Query  149  VKLGSG  132
            VK GSG
Sbjct  322  VKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  141  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  200

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  201  YGLRAALDLIFEEGLDNVIERHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  260

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  320

Query  149  VKLGSGVA  126
            VK GSGVA
Sbjct  321  VKFGSGVA  328



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 181/189 (96%), Gaps = 0/189 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKA SLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  142  TGSQKAPSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  201

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS 
Sbjct  202  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSN  261

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  262  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  321

Query  149  VKLGSGVAA  123
            VK GSGVAA
Sbjct  322  VKFGSGVAA  330



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   332 bits (851),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  145  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  204

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  205  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  264

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  265  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  324

Query  149  VKLGSGVA  126
            VK GSGVA
Sbjct  325  VKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   332 bits (851),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/188 (90%), Positives = 180/188 (96%), Gaps = 0/188 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLGSGVA  126
            VK GSGVA
Sbjct  342  VKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VKLG  138
            VK G
Sbjct  342  VKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   329 bits (844),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 178/184 (97%), Gaps = 0/184 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  151  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  210

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  211  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  270

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  271  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  330

Query  149  VKLG  138
            VK G
Sbjct  331  VKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   327 bits (838),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI RH RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLDNVIDRHARLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  VK  144
            VK
Sbjct  342  VK  343



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  V  147
            V
Sbjct  342  V  342



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   326 bits (835),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYP
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYP  341

Query  149  V  147
            V
Sbjct  342  V  342



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 184/205 (90%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            T SQKALSLPTG+GIVCASPKA+EASK A S+R +FDW  YLK Y +GTYWPYTPSIQLL
Sbjct  197  TSSQKALSLPTGMGIVCASPKAIEASKHATSLRSYFDWNGYLKCYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI+RH RL  ATRLAV+AWGLKNC Q +E +SD+VTAVVVP+ 
Sbjct  257  YGLRATLDLIFEEGLENVISRHKRLAKATRLAVEAWGLKNCCQNKESYSDSVTAVVVPTN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIV RAWK+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLLGCLAGVEMVL+D+GYP
Sbjct  317  IDSGEIVNRAWKKYNLSLGVGLNKVAGKVFRIGHLGNINELQLLGCLAGVEMVLRDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            +K GSGVAAASAYL NT P+IPSRI
Sbjct  377  IKFGSGVAAASAYLHNTIPLIPSRI  401



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/205 (80%), Positives = 180/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            T SQKALSLPTG+GIVCA PKA+EA+K+A SVR FFDW  YLK Y +GTYWPYTPSIQLL
Sbjct  197  TSSQKALSLPTGMGIVCAGPKAIEATKSATSVRSFFDWNGYLKCYNLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC QKEEW+S +VTA+VVP  
Sbjct  257  YGLRAALDLVFEEGFENVILRHKRLAKATRLAVEAWGLKNCCQKEEWYSASVTAIVVPPN  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIV RAWKRYNLSLG GLNKVAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYP
Sbjct  317  IDSGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAASAYL N  P+IPSRI
Sbjct  377  VKLGSGVAAASAYLLNNVPLIPSRI  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   315 bits (806),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 160/175 (91%), Positives = 170/175 (97%), Gaps = 0/175 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  138  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  197

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P Y
Sbjct  198  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPY  257

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLK  165
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVLK
Sbjct  258  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/174 (93%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVV+PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWSSDTVTAVVIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  168
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+L
Sbjct  197  TGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKFYKLGSYWPYTPSSQML  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            Y LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ EW SDTVTAVVVP Y
Sbjct  257  YALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYP
Sbjct  317  INSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAA+A+LQ  TP+I SR+
Sbjct  377  VVLGSGVAAAAAHLQKKTPLISSRL  401



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   315 bits (807),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKAL LPTG+GIVCA PKALEA+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+L
Sbjct  197  TGSQKALGLPTGLGIVCAGPKALEAAKTATSPRVFFDWADYLKFYKVGSYWPYTPSSQML  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            Y LRA LDL+FEEGLDNVI RH RLG ATRLAV AWGLK CT++ EW SDTVTAVVVP Y
Sbjct  257  YALRASLDLIFEEGLDNVIKRHARLGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++S ++VK AWK+YNLSLG+GLNKVAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYP
Sbjct  317  LNSLDVVKMAWKKYNLSLGVGLNKVAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V LGSGVAAA+A+LQ  TP+I SR+
Sbjct  377  VVLGSGVAAAAAHLQKKTPLISSRL  401



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   311 bits (796),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  150  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  209

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  210  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  269

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  168
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  270  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  323



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  168
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   311 bits (796),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/174 (91%), Positives = 169/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  168
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSD VTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDAVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  168
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/171 (92%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  177
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   307 bits (787),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   306 bits (784),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  177
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   305 bits (782),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/171 (91%), Positives = 166/171 (97%), Gaps = 0/171 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  141  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  200

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  201  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  260

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVE  177
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  261  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P Y
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAG  183
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+G
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGV  180
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  282  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   298 bits (762),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 167/183 (91%), Positives = 172/183 (94%), Gaps = 0/183 (0%)
 Frame = -2

Query  623  LEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARH  444
              A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RH
Sbjct  108  FSAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRH  167

Query  443  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  264
            TRLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGL
Sbjct  168  TRLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGL  227

Query  263  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIP  84
            NKVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IP
Sbjct  228  NKVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIP  287

Query  83   SRI  75
            SRI
Sbjct  288  SRI  290



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   301 bits (771),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLL
Sbjct  197  TGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY
Sbjct  257  YGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCVKDPELYSDTVTAVVVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+P
Sbjct  317  LNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGVAAA AYLQ +TP+IPSR+
Sbjct  377  VKLGSGVAAAQAYLQESTPLIPSRL  401



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   300 bits (767),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK+L LPTG+GI+CASPKALEASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLL
Sbjct  197  TGSQKSLGLPTGLGILCASPKALEASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDLLFEEGL+NVI RH RL  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY
Sbjct  257  YGLRAALDLLFEEGLENVIKRHHRLAHATRLAVKAWGLELCIKDPELYSDTVTAVVVPSY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++S+++V+ AW++YNLS+G+GLNKVAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+P
Sbjct  317  LNSTDVVRVAWRKYNLSIGIGLNKVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFP  376

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            VKLGSGV+AA AYLQ +TP+IPSR+
Sbjct  377  VKLGSGVSAAQAYLQESTPLIPSRL  401



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   290 bits (742),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  575  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  396
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  395  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  216
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  215  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   297 bits (761),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKAL A+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+L
Sbjct  197  TGSQKALSLPTGLGIVCASPKALAAAKQSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQML  256

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LD++  EEGLDNVIARH RLG ATR AV+AWGL  CTQ  +W SDTVTAVVVPS
Sbjct  257  YGLRASLDMILNEEGLDNVIARHCRLGEATRQAVKAWGLTLCTQDPKWKSDTVTAVVVPS  316

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
            +I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQ+LG LAGVE+ L ++GY
Sbjct  317  WINSNDIVKIAYKKYNLSLGIGLNKVAGKVFRIGHLGNVNELQMLGALAGVELCLMEVGY  376

Query  152  PVKLGSGVAAASAYLQNTTPMIPSRI  75
            PV LGSGVAAA A+L   TP+I SRI
Sbjct  377  PVTLGSGVAAAQAHLAKKTPLISSRI  402



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 179/206 (87%), Gaps = 1/206 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+L
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEAAKRSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQML  256

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LD++  EEGLDNVIARH RL  ATR AV+AWGL  CT+  +W SDTVTAVVVPS
Sbjct  257  YGLRASLDMILNEEGLDNVIARHCRLAEATRQAVRAWGLTLCTKDPKWKSDTVTAVVVPS  316

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
            +I+S++IVK A+K+YNLSLG+GLNKVAGKVFRIGHLGN+NELQLLG LAGVE+ L ++GY
Sbjct  317  WINSNDIVKIAYKKYNLSLGVGLNKVAGKVFRIGHLGNVNELQLLGALAGVELCLMEVGY  376

Query  152  PVKLGSGVAAASAYLQNTTPMIPSRI  75
            PV LGSGVAAA A+L   TP+I SRI
Sbjct  377  PVTLGSGVAAAQAHLAKKTPLIVSRI  402



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  139  TGSQKALSLPTGMGILCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  198

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSY
Sbjct  199  YGLRAALDLIFEEGLENVIARHARLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSY  258

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  201
            IDS+EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGN+NELQL
Sbjct  259  IDSAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNVNELQL  301



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   289 bits (739),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 148/161 (92%), Positives = 157/161 (98%), Gaps = 0/161 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIVCASPKALEASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGIVCASPKALEASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH+RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP Y
Sbjct  257  YGLRAALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  357



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  162  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  221

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLG ATRL V+AWGLKNCT KEE FSDTVTAV++PSY
Sbjct  222  YGLRAALDLIFEEGLENVIARHARLGKATRLXVEAWGLKNCTPKEECFSDTVTAVMIPSY  281

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLG  195
            IDS+EIV+RAWKR NLSLGLGLNKVAGKVFRIGHLGN+NELQLLG
Sbjct  282  IDSAEIVRRAWKRSNLSLGLGLNKVAGKVFRIGHLGNVNELQLLG  326



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   284 bits (726),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 154/164 (94%), Gaps = 0/164 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDLLF EGLDNVIARH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP Y
Sbjct  257  YGLREALDLLFAEGLDNVIARHARLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
            IDS+EIV+R WKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+  +
Sbjct  317  IDSAEIVRRGWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTFI  360



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIG V ASPKA+EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGIGFVVASPKAIEASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+N+IARH RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP Y
Sbjct  257  YGLRAALDLIFEEGLENIIARHNRLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLL  198
            ID +EIV+RAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+ L+
Sbjct  317  IDGAEIVRRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEVTLI  360



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   278 bits (711),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/161 (86%), Positives = 151/161 (94%), Gaps = 0/161 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLL
Sbjct  58   TGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLL  117

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  
Sbjct  118  YGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPN  177

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  178  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  218



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/160 (89%), Positives = 154/160 (96%), Gaps = 0/160 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  197  TGSQKALSLPTGLGIVCASPKALEATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+F EGLDNVIARH+RLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P Y
Sbjct  257  YGLRTALDLIFLEGLDNVIARHSRLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPY  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  210
            IDS+EIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE
Sbjct  317  IDSTEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE  356



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   280 bits (717),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLL
Sbjct  197  TGSQKALSLPTGMGIVCASPKALEASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLL  256

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVI RH RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+
Sbjct  257  YGLRAALDLIFEEGLENVIERHRRLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSH  316

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQL  201
            I+SSEIV+RAW+RYNLSLGLGLNKVAGKVFRIGHLG+LNE+  
Sbjct  317  INSSEIVRRAWQRYNLSLGLGLNKVAGKVFRIGHLGHLNEVMF  359



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  551  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  372
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  371  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  192
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  191  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 150/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALS+PTG+GIVCASP+ALEASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLL
Sbjct  199  TGSQKALSMPTGMGIVCASPRALEASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  
Sbjct  259  YGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPN  318

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEL  207
            IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNE+
Sbjct  319  IDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNEV  359



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   275 bits (704),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 149/206 (72%), Positives = 167/206 (81%), Gaps = 15/206 (7%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            T SQKALSLPTG+GIVCA PKA+E                YLK Y +GTYWPYTPSI LL
Sbjct  159  TSSQKALSLPTGMGIVCAGPKAIE--------------NGYLKCYNLGTYWPYTPSIPLL  204

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE-WFSDTVTAVVVPS  333
            YGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKNC Q+EE W+S +VTA++VP 
Sbjct  205  YGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKNCCQQEEEWYSASVTAIIVPP  264

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
             ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLNELQLLGCLAGVEM+LK++GY
Sbjct  265  NIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLNELQLLGCLAGVEMILKEVGY  324

Query  152  PVKLGSGVAAASAYLQNTTPMIPSRI  75
             +KLGSGVAAASAYL N  P+IPSRI
Sbjct  325  LLKLGSGVAAASAYLLNNVPLIPSRI  350



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (660),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  530  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  351
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  350  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  171
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  170  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  75
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 161/205 (79%), Gaps = 19/205 (9%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            T SQKALSL TG+GIVCA PKA+EASK+A S+R FFDW  YLK Y +GTYWPYTPSIQLL
Sbjct  158  TSSQKALSLSTGMGIVCAGPKAIEASKSATSLRSFFDWNGYLKCYNLGTYWPYTPSIQLL  217

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEG +NVI RH       +L V            EW+S +VTA+V P  
Sbjct  218  YGLRAALDLVFEEGFENVILRH-------KLVV------------EWYSASVTAIVGPPN  258

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS EIV RAWKR NLSLG GLNKVAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYP
Sbjct  259  IDSGEIVSRAWKRCNLSLGGGLNKVAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYP  318

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V+LGSGVAAASAYL N  P+IPSRI
Sbjct  319  VQLGSGVAAASAYLLNNVPIIPSRI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   259 bits (663),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KA+E SK AK  R +FDW +YLK YK GTY PYTPS+QLL
Sbjct  197  TGSQKALSLPTGLGILCASLKAIETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLL  256

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LD++  +EGL+NVIARH RL  ATR AV+AWGL  C +K +W S  VT VVVPS
Sbjct  257  YGLRASLDIILKQEGLENVIARHLRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPS  316

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
             +DS++++K AWK+YNLSLGLGL +V GKVFRIGHLG +NELQLLG LAGVE+VL ++GY
Sbjct  317  SLDSNDVIKIAWKKYNLSLGLGLGEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGY  376

Query  152  PVKLGSGVAAASAYLQNTTPMIPSRI  75
            PV  GSGVAAA A+L   TP+I SR+
Sbjct  377  PVIFGSGVAAAQAFLSKQTPIIASRL  402



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   236 bits (602),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 133/139 (96%), Gaps = 0/139 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  11   TGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  70

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSY
Sbjct  71   YGLRAALDLVFEEGLENVIARHNRLGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSY  130

Query  329  IDSSEIVKRAWKRYNLSLG  273
            IDS+EIV+RAWKRYNLSLG
Sbjct  131  IDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   234 bits (596),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTGIGIV A P+A+EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LL
Sbjct  11   TGSQKALSLPTGIGIVVAGPRAIEASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLL  70

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGL+NVIARH RLGTAT LAV+AWGLKNCTQKEEW SDTVTAV+VPSY
Sbjct  71   YGLRAALDLVFEEGLENVIARHNRLGTATGLAVEAWGLKNCTQKEEWHSDTVTAVIVPSY  130

Query  329  IDSSEIVKRAWKRYNLSLG  273
            IDS+EIV+RAWKRYNLSLG
Sbjct  131  IDSAEIVRRAWKRYNLSLG  149



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   233 bits (595),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+SS+IVKRAWKRYN
Sbjct  127  IESSDIVKRAWKRYN  141



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   233 bits (593),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDS+EIVKRAWKRYN
Sbjct  127  IDSAEIVKRAWKRYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   232 bits (592),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIVCASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+SS+IVK+AWKRYN
Sbjct  127  IESSDIVKKAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   232 bits (591),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVI+RH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP Y
Sbjct  67   YGLRAALDLIFEEGLDNVISRHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+SS+IVKRAWKRYN
Sbjct  127  IESSDIVKRAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   232 bits (591),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CASPKALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASPKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+SS+IVK+AWKRYN
Sbjct  127  IESSDIVKKAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   231 bits (589),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDS+EIVK+AWKRYN
Sbjct  127  IDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   231 bits (588),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDSS+IVK+AWKRYN
Sbjct  127  IDSSDIVKKAWKRYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   230 bits (587),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDS+EIVK+AWK+YN
Sbjct  127  IDSAEIVKKAWKKYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDS+EIVK+AWK+YN
Sbjct  127  IDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   230 bits (586),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+SSEIVK AWKRYN
Sbjct  127  INSSEIVKMAWKRYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   229 bits (584),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 127/135 (94%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GI+CAS KALEA+KTAKSVRVFFDW DY+KFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIICASAKALEATKTAKSVRVFFDWNDYMKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            IDS+EIVK+AWK+YN
Sbjct  127  IDSAEIVKKAWKKYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCAS KALEA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLL
Sbjct  7    TGSQKALSLPTGMGIVCASAKALEATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLL  66

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLRA LDL+FEEGLDNVIARH RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P Y
Sbjct  67   YGLRAALDLIFEEGLDNVIARHGRLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPY  126

Query  329  IDSSEIVKRAWKRYN  285
            I+S+EIVK AWKRYN
Sbjct  127  INSAEIVKMAWKRYN  141



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (564),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  446  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  267
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  266  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  87
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  86   PSRI  75
            PSRI
Sbjct  121  PSRI  124



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/197 (58%), Positives = 151/197 (77%), Gaps = 1/197 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GIVCAS +ALEASKTA+  RVFFD+ D  K    G Y+PYTP++ +L
Sbjct  197  TGSQKGLMLPAGLGIVCASKRALEASKTAECRRVFFDFGDQAKANATG-YFPYTPALPML  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L  + +EGL+NV ARH RL  +TR AV+AWGL  C ++E+W+SDTV+AV+VP  
Sbjct  256  YGLREALRCVEDEGLENVFARHRRLADSTRAAVEAWGLTLCAKEEKWYSDTVSAVMVPDG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++ +E++  A+KRYNL+LG GL++VAGK+FRIGH+G+LNEL LLG LAGVEM + D G  
Sbjct  316  VNGAEVIDIAYKRYNLALGAGLSQVAGKLFRIGHIGDLNELMLLGALAGVEMAMLDAGIR  375

Query  149  VKLGSGVAAASAYLQNT  99
            ++ GSGVAAA   L+ +
Sbjct  376  IEPGSGVAAAQKSLRGS  392



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/194 (58%), Positives = 146/194 (75%), Gaps = 1/194 (1%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQlly  507
            GSQK L LP G+GIVCASP+ALEASKTA   RVFFD+ D +K    G Y+PYTP++ +LY
Sbjct  193  GSQKGLMLPAGLGIVCASPRALEASKTAGLKRVFFDFNDMIKANATG-YFPYTPALPMLY  251

Query  506  glragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYI  327
            GLR  L +LFEE L++V  RH  L    R AV+AWGLK C  + +W+SDTVTA+VVP  I
Sbjct  252  GLRESLKILFEEKLEHVFERHHVLAGGVRAAVKAWGLKPCATEPKWYSDTVTAIVVPPGI  311

Query  326  DSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  147
            + ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG + G EM + D+G  V
Sbjct  312  NGADVIDAAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIGGAEMAMADVGIDV  371

Query  146  KLGSGVAAASAYLQ  105
            KLGSGV AA A+ +
Sbjct  372  KLGSGVGAAQAHFR  385



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   209 bits (531),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 119/125 (95%), Gaps = 1/125 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYL+FYKMGTYWPYTPSIQLL
Sbjct  11   TGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLRFYKMGTYWPYTPSIQLL  70

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LDL+  EEGLDNVIARH RLGTATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP 
Sbjct  71   YGLRAALDLILVEEGLDNVIARHNRLGTATRLAVEAWGLKNCTQKEEWYSDTVTAVIVPP  130

Query  332  YIDSS  318
            YIDS+
Sbjct  131  YIDSA  135



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 148/205 (72%), Gaps = 1/205 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK + LP G+GIVCASPKAL    TA   R +F+  D+ K    G Y+PYTP++ LL
Sbjct  166  TGSQKGMMLPAGLGIVCASPKALARMDTATCTRAYFNLADHFK-ANAGGYFPYTPALPLL  224

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L ++FEEGLDN+ ARH  L + TR AV AWGL  C ++ +W SDTV+A++VP+ 
Sbjct  225  YGLRESLAMMFEEGLDNIFARHRYLASGTRAAVDAWGLSLCAKEPKWQSDTVSAIMVPAG  284

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             + ++++ RA++RYNL+LG GL++VAGK+FRIGHLG+LNEL LLG ++G EM ++D+G  
Sbjct  285  FNGADVIDRAYRRYNLALGAGLSEVAGKLFRIGHLGDLNELMLLGAISGAEMSMRDVGIQ  344

Query  149  VKLGSGVAAASAYLQNTTPMIPSRI  75
            V+ GSGVAAA  Y +N       R+
Sbjct  345  VEPGSGVAAAQEYFRNAHGAADQRL  369



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 147/204 (72%), Gaps = 1/204 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIV AS KAL+A  +AK  RV+F + D LK  K G   PYTP + LL
Sbjct  170  TGSQKALSLPTGLGIVAASDKALDARSSAKLKRVYFSFDDMLKTNKNGGV-PYTPILPLL  228

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            +GL+A L LL  EGLDNV ARH RL   TR AV AWGLK   ++  W SDT+T V VP  
Sbjct  229  HGLKASLGLLNAEGLDNVFARHHRLAEGTRAAVAAWGLKLLCREPRWQSDTLTVVEVPEG  288

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            +DS +IV  A+ +YNLSLGLGL +V GKVFRIGHLGN++EL L G L GVEM L+D+G P
Sbjct  289  LDSQKIVDTAFAKYNLSLGLGLAEVQGKVFRIGHLGNMDELMLAGALGGVEMTLRDVGLP  348

Query  149  VKLGSGVAAASAYLQNTTPMIPSR  78
            ++LGSGV AA    Q  TP+IP+R
Sbjct  349  IELGSGVGAALKVWQEGTPVIPTR  372



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 145/200 (73%), Gaps = 1/200 (1%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQlly  507
            GSQK   LP G+ IV AS KALEA  TAK  RVFF+++D +K    G Y+PYTPS+ LLY
Sbjct  201  GSQKGFMLPAGLAIVGASQKALEARHTAKCARVFFNFEDMIKSNATG-YFPYTPSLPLLY  259

Query  506  glragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYI  327
            GLR  + ++FEEG +NV  RH  L +  R AV AWGLKNC  + +WFSDTVTA+VVP   
Sbjct  260  GLRESMKMMFEEGQENVFQRHHYLASGVRAAVSAWGLKNCATEPKWFSDTVTAIVVPEGF  319

Query  326  DSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  147
            + ++++  A++RYNL+LG GL KVAGKVFRIGHLG+LNEL +LG LAG EM + DIG  +
Sbjct  320  NGADVIATAYRRYNLALGAGLAKVAGKVFRIGHLGDLNELMVLGALAGAEMSMLDIGIKI  379

Query  146  KLGSGVAAASAYLQNTTPMI  87
            + GSGVAAA  Y +++  +I
Sbjct  380  EPGSGVAAAQNYFRSSNSVI  399



>gb|AFG57258.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57259.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57260.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57261.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57262.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57263.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57264.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57265.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57266.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57267.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57268.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57269.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57270.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57271.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57272.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57273.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57274.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
 gb|AFG57275.1| hypothetical protein 2_2585_01, partial [Pinus taeda]
Length=135

 Score =   206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  11   TGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  70

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+SDTVTAVVVP 
Sbjct  71   YGLRAALDLILVEEGLDNVITRHSRLGTATRFAVEAWGLKNCTQKEEWYSDTVTAVVVPP  130

Query  332  YIDSS  318
            YIDS+
Sbjct  131  YIDSA  135



>gb|AEW08187.1| hypothetical protein 2_2585_01, partial [Pinus radiata]
Length=135

 Score =   205 bits (522),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 118/125 (94%), Gaps = 1/125 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+GIVCASPKALEA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLL
Sbjct  11   TGSQKALSLPTGLGIVCASPKALEAAKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLL  70

Query  509  yglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LDL+  EEGLDNVI RH+RLGTATR AV+AWGLKNCTQKEEW+SDTVTAVVVP 
Sbjct  71   YGLRAALDLILVEEGLDNVIIRHSRLGTATRFAVEAWGLKNCTQKEEWYSDTVTAVVVPP  130

Query  332  YIDSS  318
            YIDS+
Sbjct  131  YIDSA  135



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 147/205 (72%), Gaps = 4/205 (2%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQ  516
            +GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K    G ++PYTP+ Q
Sbjct  194  SGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKTNDQG-FFPYTPATQ  252

Query  515  llyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVP  336
            L+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++ +W SDTV+A++VP
Sbjct  253  LIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWHSDTVSAILVP  312

Query  335  SYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIG  156
              IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + G L  VEM LKD G
Sbjct  313  EGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIGGVLFSVEMALKDCG  372

Query  155  YPVKLGSGVAAASAYLQNTTPMIPS  81
             PVKLGSG  AA+ Y  N  P+ P+
Sbjct  373  VPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 147/205 (72%), Gaps = 4/205 (2%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQ  516
            +GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K    G ++PYTP+ Q
Sbjct  191  SGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKTNDQG-FFPYTPATQ  249

Query  515  llyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVP  336
            L+ GLR  LDLLF EG+DNV ARHTRL +  R AV AWGLK C ++ +W SDTV+A++VP
Sbjct  250  LIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWHSDTVSAILVP  309

Query  335  SYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIG  156
              IDS+ +VK A+ RYN SLG+GLNKVAGKVFRIGHLG L+E  + G L  VEM LKD G
Sbjct  310  EGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRIGHLGALDEYMIGGVLFSVEMALKDCG  369

Query  155  YPVKLGSGVAAASAYLQNTTPMIPS  81
             PVKLGSG  AA+ Y  N  P+ P+
Sbjct  370  VPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ I+  S KAL+A +TAK  R +FD++D++K    G Y+PYTP++ LL
Sbjct  197  SGSQKGFMLPAGLAIMSVSQKALKAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SDTVTA+VVP  
Sbjct  256  YGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG EM + D+G P
Sbjct  316  FDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIP  375

Query  149  VKLGSGVAAASA  114
            V  GSGVAAA A
Sbjct  376  VTAGSGVAAAQA  387



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 148/196 (76%), Gaps = 1/196 (1%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQlly  507
            GSQK L LP G+GIVCASP+AL A+KTA   RV+FD+ D +K    G Y+PYTP++ +LY
Sbjct  193  GSQKGLMLPAGLGIVCASPRALAATKTAGLKRVYFDFADMIKANATG-YFPYTPALPMLY  251

Query  506  glragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYI  327
            GLR  + +LFEE L++V  RH  L    R AV+AWGL  C ++ +W SDTVTA+VVP+ I
Sbjct  252  GLRESMRILFEEKLEHVFERHHVLAGGVRAAVKAWGLHPCAKEAKWDSDTVTAIVVPAGI  311

Query  326  DSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  147
            + ++++  A++RYNLSLG GL++VAGKVFRIGHLG+LN+L +LG +AG EM ++D+G  +
Sbjct  312  NGADVIDTAYRRYNLSLGAGLSQVAGKVFRIGHLGDLNDLMVLGAIAGAEMAMRDVGIDI  371

Query  146  KLGSGVAAASAYLQNT  99
            +LGSGV AA  + ++T
Sbjct  372  QLGSGVGAAQEHFRST  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K    G Y+PYTP++ LL
Sbjct  197  SGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SDTVTA+VVP  
Sbjct  256  YGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG EM + D+G P
Sbjct  316  FDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIP  375

Query  149  VKLGSGVAAASA  114
            V  GSGVAAA A
Sbjct  376  VTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   211 bits (538),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K    G Y+PYTP++ LL
Sbjct  197  SGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SDTVTA+VVP  
Sbjct  256  YGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D++++++ A+KRYNL+LG GLNKVAGKVFRIGHLG+LNEL LLG +AG EM + D+G P
Sbjct  316  FDAAKVIEIAYKRYNLALGAGLNKVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIP  375

Query  149  VKLGSGVAAASA  114
            V  GSGVAAA A
Sbjct  376  VTAGSGVAAAQA  387



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 145/201 (72%), Gaps = 1/201 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+G+VCAS KALE SK     RVFF ++D +    +G Y+PYTPSI LL
Sbjct  194  TGSQKGLMLPAGLGMVCASEKALERSKKNNLHRVFFSFEDMIVNNDVG-YFPYTPSIPLL  252

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGL+  L +L EEGL++V  RH RL    R AV+AWGLK C +  + +SDTVTAVVVP  
Sbjct  253  YGLKESLAMLMEEGLESVYVRHRRLAHGVRRAVEAWGLKTCCKNPKEYSDTVTAVVVPEG  312

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D+ ++++ A+++YNLSLG GL KV G+VFRIGHLG+LNEL +L  LAG EM + ++G P
Sbjct  313  FDAQQVIRIAYEKYNLSLGAGLMKVRGRVFRIGHLGDLNELMVLATLAGTEMAMLEVGIP  372

Query  149  VKLGSGVAAASAYLQNTTPMI  87
            +KLGSGVAAAS Y   T+  +
Sbjct  373  IKLGSGVAAASEYYMKTSKQV  393



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   211 bits (536),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D+ K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDHKKQNPAG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  257  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  317  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  NGVKVTPGSGVAAASSYLREN  397



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D+ K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDHKKQNPAG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  257  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  317  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  NGVNVTPGSGVAAASSYLREN  397



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   209 bits (533),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D  K    G Y+PYTP 
Sbjct  175  GSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPP  233

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  234  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  293

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  294  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLID  353

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  354  NGVKVTPGSGVAAASSYLREN  374



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D  K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  257  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  317  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLID  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  NGVKVTPGSGVAAASSYLREN  397



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A+     +  +  RV+FDW+D  K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAEGQSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  257  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  317  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLID  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  NGVKVTPGSGVAAASSYLREN  397



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK L LP G+G++  S KAL ASKTA S R +FD+ D +K    G Y+PYTP + LL
Sbjct  192  SGSQKGLMLPAGLGVLGVSQKALAASKTATSKRCYFDFDDMIKANATG-YFPYTPPLPLL  250

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L ++ +EGL+N+  RH+ L    R AV+AWGL  C ++ +W+SDTVTA+VVP  
Sbjct  251  YGLRESLKMIEDEGLENIFVRHSHLAGGVRAAVKAWGLTPCAKEPKWYSDTVTAIVVPPQ  310

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             ++ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL +LG LAG EM + D+G P
Sbjct  311  FNAVQVISTAYSRYNLSLGAGLSQVAGKVFRIGHLGDLNELMVLGALAGAEMAMADVGIP  370

Query  149  VKLGSGVAAASAYLQNTTPM  90
            V LGSGV AA ++ +   P+
Sbjct  371  VTLGSGVGAAQSFYRAAAPV  390



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEAS-----KTAKSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S +AL+A+     +  +  RV+FDW+D  K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQRALKAAEGQSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  LFEEGL+NV  RH  LG ATR AV AWGLK C +  EW SDTVTA++
Sbjct  257  LPLLYGLREALACLFEEGLENVYHRHAVLGEATRQAVAAWGLKTCAKSPEWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
             P  +D+++I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM L D
Sbjct  317  APEGVDAAKIIKHAYVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSLID  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  NGVKVTPGSGVAAASSYLREN  397



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (73%), Gaps = 2/201 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GI+C SPKAL+A +TAKS R +FD  D +K    G Y+PYTP++ LL
Sbjct  200  TGSQKGLMLPAGLGILCVSPKALKAIETAKSKRCYFDLGDMIKANATG-YFPYTPALSLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLR  LDL+F+EGLDNV ARH  L    R AV + WGL+ C +  +W+SDTV+A+VVP 
Sbjct  259  YGLRTALDLIFQEGLDNVFARHHHLAQGVRAAVTEGWGLELCAKGPKWYSDTVSAIVVPQ  318

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
              +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   +AG EM + D+G 
Sbjct  319  GFNAANVIDRAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAIAGAEMAMLDVGI  378

Query  152  PVKLGSGVAAASAYLQNTTPM  90
             V+ GSG  AA+ Y +   P+
Sbjct  379  DVRPGSGTGAATQYWRTHDPL  399



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 144/192 (75%), Gaps = 1/192 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ ++  S KAL+A +TAK  R +FD++D++K    G Y+PYTP++ LL
Sbjct  197  SGSQKGFMLPAGLALLSVSQKALKAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  L++LFEEGLD V ARH  L    R AV AWGLK C ++ +W SDTVTA++VP  
Sbjct  256  YGLRESLNVLFEEGLDQVYARHHHLAEGVRAAVAAWGLKPCAKESKWNSDTVTAILVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D++++++ A+KRYNL+LG GL+KVAGKVFRIGHLG+LNEL LLG +AG EM + D+G P
Sbjct  316  FDAAKVIEIAYKRYNLALGAGLSKVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIP  375

Query  149  VKLGSGVAAASA  114
            V  GSGVAAA A
Sbjct  376  VTPGSGVAAAQA  387



>ref|XP_002953765.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
 gb|EFJ45089.1| hypothetical protein VOLCADRAFT_75980 [Volvox carteri f. nagariensis]
Length=449

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 145/204 (71%), Gaps = 1/204 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+  V ASPKALEA K+AK  RV++D+ D L+    G   PYTPS+ +L
Sbjct  242  TGSQKALSLPTGLAFVAASPKALEAMKSAKLKRVYYDFADMLRTNPSGNV-PYTPSLAML  300

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YG+R  + +L EEG++NV ARH RLG   R AV+ WGLK   +   W SD++T V VP  
Sbjct  301  YGMRESIKMLREEGMENVFARHHRLGEGARRAVEGWGLKLLCKNPRWRSDSLTVVEVPEG  360

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS++IVK A+ +Y+LSLG+GL ++ GKVFRIGHLGN+NEL L+  LAG EM + D G P
Sbjct  361  IDSNKIVKVAYAKYDLSLGIGLAQINGKVFRIGHLGNMNELMLVSALAGAEMAMIDAGVP  420

Query  149  VKLGSGVAAASAYLQNTTPMIPSR  78
            ++ GSGV  A  Y Q T+ +I +R
Sbjct  421  IRPGSGVGKAIEYWQQTSSVIKTR  444



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A++++     +   V+FDW D+ K    G Y+PYTP+
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWADHQKQNGAG-YFPYTPA  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  L EEGL+NV  RH  LG ATR AV AWGLK C ++ +W SDTVTA++
Sbjct  257  LPLLYGLREALACLREEGLENVYHRHAVLGEATRQAVAAWGLKTCAKEAKWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
            VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM + D
Sbjct  317  VPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMAMLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V+ GSGVAAAS+YL+  
Sbjct  377  NGVKVQPGSGVAAASSYLREN  397



>ref|WP_015933415.1| serine--glyoxylate aminotransferase [Methylobacterium nodulans]
 gb|ACL61852.1| aminotransferase class V [Methylobacterium nodulans ORS 2060]
Length=417

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 143/197 (73%), Gaps = 1/197 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y+PYTP++ LL
Sbjct  197  TGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SDTV+A++VP  
Sbjct  256  YGLRESMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSDTVSAIMVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            I+ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG EM + D G  
Sbjct  316  INGADVIDIAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGAEMSMLDAGIK  375

Query  149  VKLGSGVAAASAYLQNT  99
            ++ GSGVAAA  + + T
Sbjct  376  IEPGSGVAAAQQHFRET  392



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 142/203 (70%), Gaps = 1/203 (0%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQlly  507
            GSQK   LP G+ ++C S KALEA  TAKS R F D +D++     G Y+PYTPSI LLY
Sbjct  193  GSQKGFMLPAGLALLCFSQKALEARHTAKSRRCFLDIQDHITNNASG-YFPYTPSIPLLY  251

Query  506  glragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYI  327
            GLR  +DLL EEGL NV ARH RL    R AV+AWGL+ C +  +W+S+TV+A+VVP   
Sbjct  252  GLRKAIDLLLEEGLQNVFARHQRLAEGVRRAVKAWGLELCARDPKWYSNTVSAIVVPQGY  311

Query  326  DSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  147
            D+ +++  A+ RYNLSLG GL++VAGKVFRIGHLG+LNEL L   +AG EM ++D+G  V
Sbjct  312  DARDVMHYAYHRYNLSLGAGLSEVAGKVFRIGHLGDLNELMLCSAIAGAEMAMRDVGIQV  371

Query  146  KLGSGVAAASAYLQNTTPMIPSR  78
              GSGVAAA  Y + T P +  R
Sbjct  372  TPGSGVAAACEYWRETAPAVKPR  394



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   204 bits (520),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 146/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A++++     +   V+FDW D+ K    G Y+PYTP+
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWADHQKQNGAG-YFPYTPA  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK C ++ +W SDTVTA++
Sbjct  257  LPLLYGLREALACLREEGLENVYHRHAVLAEATRQAVAAWGLKTCAKEAKWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
            VP  ID++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM + D
Sbjct  317  VPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMAMLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V+ GSGVAAAS+YL+  
Sbjct  377  NGVKVQPGSGVAAASSYLREN  397



>ref|WP_012336184.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 4-46]
 gb|ACA20808.1| Serine--glyoxylate transaminase [Methylobacterium sp. 4-46]
Length=417

 Score =   205 bits (521),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y+PYTP++ LL
Sbjct  197  TGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SDTV+A++VP  
Sbjct  256  YGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSDTVSAIMVPDG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG EM + D G  
Sbjct  316  VNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGAEMAMLDAGIR  375

Query  149  VKLGSGVAAASAYLQNT  99
            ++ GSGV AA  + + T
Sbjct  376  IEPGSGVGAAQKHFRET  392



>ref|WP_026190999.1| serine--glyoxylate aminotransferase [Methylobacterium sp. WSM2598]
Length=417

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 142/197 (72%), Gaps = 1/197 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GIVC SPKAL A KTA+  RV+FD+ D  K    G Y+PYTP++ LL
Sbjct  197  TGSQKGLMLPAGLGIVCVSPKALAAYKTAECRRVYFDFGDMSKANATG-YFPYTPALPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGLR  +  LFEEGL+ V  RH  L    R AV+AWGL  C ++ +W+SDTV+A++VP  
Sbjct  256  YGLREAMACLFEEGLERVFERHRVLADGCRAAVKAWGLTLCAKEPKWYSDTVSAIMVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            ++ ++++  A++RYNL+LG GL+KVAGK+FRIGHLG+LN+L LLG LAG EM + D G  
Sbjct  316  VNGADVIDVAFRRYNLALGAGLSKVAGKLFRIGHLGDLNDLMLLGALAGAEMAMLDAGIR  375

Query  149  VKLGSGVAAASAYLQNT  99
            ++ GSGV AA  + + T
Sbjct  376  IEPGSGVGAAQKHFRET  392



>gb|KIZ03753.1| serine--glyoxylate transaminase [Monoraphidium neglectum]
Length=425

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 142/204 (70%), Gaps = 1/204 (0%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQKALSLPTG+ ++C S KAL+A KTAK  R+++ W D L     G   PYTPS+ LL
Sbjct  221  TGSQKALSLPTGLALLCVSDKALDARKTAKLPRIYYSWDDQLNTNPSGNV-PYTPSLMLL  279

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            +GL+  L LL EEG DNV+ARH RL   TR AV+ WGLK   +   W SD++T + VP+ 
Sbjct  280  HGLKESLALLREEGFDNVVARHHRLAEGTRKAVEGWGLKLLCKHPRWQSDSLTVIEVPAG  339

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
            IDS+ IVK A+ +YNLS+G+GL+KV GKVFRIGHLGN++EL +   L+G EM + D G  
Sbjct  340  IDSNLIVKNAYSKYNLSIGIGLSKVNGKVFRIGHLGNMDELMMCSALSGAEMAMLDAGMK  399

Query  149  VKLGSGVAAASAYLQNTTPMIPSR  78
            +  GSGV  A  Y Q T+ +IP+R
Sbjct  400  ITPGSGVGRAIEYWQKTSKVIPTR  423



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 141/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GI+C S KAL+AS+TA S R +FD  D +K    G Y+PYTP++ LL
Sbjct  200  TGSQKGLMLPAGLGILCVSQKALKASETATSRRCYFDLADMIKANATG-YFPYTPALPLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLR  LDLLFEEGLDNV ARH  L    R A+ + W L  C +  +W SDTV+A+VVP 
Sbjct  259  YGLRTALDLLFEEGLDNVFARHHYLAQGVRAAITEGWDLGVCAKAPKWHSDTVSAIVVPE  318

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
              +++ ++ RA++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+G +AG EM + DIG 
Sbjct  319  KFNAAHVIDRAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMGAIAGAEMAMLDIGI  378

Query  152  PVKLGSGVAAASAY  111
             V+ GSG  AA+ Y
Sbjct  379  DVRPGSGTGAAAQY  392



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/199 (53%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKT--AKSVRVFFDWKDYLKFYKMGTYWPYTPSIQ  516
            +GSQK   LPTG+GI+  S KAL+A+K+   +  R FF W+D +K   +G ++PYTP+ Q
Sbjct  193  SGSQKGFMLPTGLGILAVSQKALDANKSLNGRMNRCFFSWEDMIKTNDLG-FFPYTPATQ  251

Query  515  llyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVP  336
            L+ GLRA L+L+F EG+DN++ARHTRL +  R AV AWGLK C ++ +W SDTV+A+VVP
Sbjct  252  LIRGLRASLNLIFAEGIDNIVARHTRLASGVRAAVDAWGLKLCAKEPKWHSDTVSAIVVP  311

Query  335  SYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIG  156
              ID++ ++K A+ RYN SLG GLNK+ G+VFRIGHLG L+E  +   L  VEM LKD G
Sbjct  312  EGIDANNVLKTAYYRYNTSLGTGLNKLNGRVFRIGHLGALDEGMIGSALFNVEMTLKDCG  371

Query  155  YPVKLGSGVAAASAYLQNT  99
             P+K GSG  AA+ Y   T
Sbjct  372  VPIKFGSGTGAAAEYFSKT  390



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 145/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASKTA-----KSVRVFFDWKDYLKFYKMGTYWPYTPS  522
            GSQK L LP G+G++C S KAL+A++++     +   V+FDW D+ K    G Y+PYTP 
Sbjct  198  GSQKGLMLPAGLGVICVSQKALKAAESSSGPNDRLAHVYFDWADHQKQNGAG-YFPYTPP  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L  L EEGL+NV  RH  L  ATR AV AWGLK C ++ +W SDTVTA++
Sbjct  257  LPLLYGLREALACLREEGLENVYNRHKVLAEATRQAVAAWGLKTCAKEAKWNSDTVTAIL  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
            VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRIGH+G+LNEL LLG +AG EM + D
Sbjct  317  VPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFRIGHVGDLNELSLLGAIAGAEMSMLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V+ GSGVAAAS+YL+  
Sbjct  377  NGVKVQPGSGVAAASSYLREN  397



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 141/195 (72%), Gaps = 1/195 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ ++ ASPKA++A KT K  R +F+++D +     G Y+PYTPS+ LL
Sbjct  197  SGSQKGFMLPAGLLLMAASPKAIDAGKTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGL+  L +LFEEGLD V  RH  L   TR AV AWGLK C ++ +W SDTVTA+VVP  
Sbjct  256  YGLKESLSILFEEGLDQVYKRHHHLAEGTRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D+ ++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG +AG EM + D G  
Sbjct  316  YDAVKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIK  375

Query  149  VKLGSGVAAASAYLQ  105
            ++ GSGVAAA A  +
Sbjct  376  IEAGSGVAAAQAVFR  390



>ref|WP_028212654.1| serine--glyoxylate aminotransferase [Burkholderia mimosarum]
Length=419

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 142/194 (73%), Gaps = 2/194 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GI+CASPKAL+A + A+S R +FD  D +K    G Y+PYTP++ LL
Sbjct  200  TGSQKGLMLPAGLGILCASPKALKAMEHAQSRRCYFDLGDMIKANATG-YFPYTPALSLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LDLLFEEGLDNV ARH  L    R AV + WGL+ C +  +W SDTVTA+VVP 
Sbjct  259  YGLRASLDLLFEEGLDNVFARHHYLAAGVRAAVTEGWGLELCAKAPKWHSDTVTAIVVPQ  318

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
              +++ ++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L   ++G EM + D+G 
Sbjct  319  GFNAAHVIDTAFRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLTSAISGAEMAMLDVGI  378

Query  152  PVKLGSGVAAASAY  111
             V+ GSG  AA+ Y
Sbjct  379  DVRPGSGTGAATQY  392



>sp|O08374.2|SGAA_HYPME RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Hyphomicrobium methylovorum]
 dbj|BAA19919.1| serine-glyoxylate aminotransferase [Hyphomicrobium methylovorum]
Length=405

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALE--ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQ  516
            +GSQK   LPTG+GI+  S KAL+   SK  +  R FF ++D +K    G ++PYTP+ Q
Sbjct  192  SGSQKGFMLPTGLGILAVSQKALDINKSKNGRMNRCFFSFEDMIKTNDQG-FFPYTPATQ  250

Query  515  llyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVP  336
            LL GLR  LDLLF EGLDNV ARHTRL +  R AV AWGLK C ++ +W+SDTV+A++VP
Sbjct  251  LLRGLRTSLDLLFAEGLDNVFARHTRLASGVRAAVDAWGLKLCAKEPKWYSDTVSAILVP  310

Query  335  SYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIG  156
              IDS+ I K A+ RYN S GLGLNKVAGKVFRIGHLG L+E+ + G L   EM LKD G
Sbjct  311  EGIDSNAITKTAYYRYNTSFGLGLNKVAGKVFRIGHLGMLDEVMIGGALFAAEMALKDNG  370

Query  155  YPVKLGSGVAAASAYL-QNTT  96
              +KLGSG  AA+ Y  +N T
Sbjct  371  VNLKLGSGTGAAAEYFSKNAT  391



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/199 (55%), Positives = 142/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEA--SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQ  516
            +GSQK   LPTG+GI+  S KAL+   SK  +  R FF ++D +K   +G ++PYTP+  
Sbjct  192  SGSQKGFMLPTGLGILAVSQKALDVNKSKNGRMNRCFFSFEDMIKTNDLG-FFPYTPATT  250

Query  515  llyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVP  336
            L+ GLRA +DLL  EG+DNV+ARH RL +  R  V AWGLK C ++ +W+SDTV+A++VP
Sbjct  251  LIRGLRASIDLLLAEGIDNVVARHHRLASGVRAGVAAWGLKLCAKEPKWYSDTVSAILVP  310

Query  335  SYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIG  156
              +DS+ + K A+ RYN SLGLGLNKVAGKVFRIGHLG+L+E  + G L  VEM LKD G
Sbjct  311  EGVDSNAVTKTAYYRYNTSLGLGLNKVAGKVFRIGHLGSLDEYMVGGVLFAVEMALKDNG  370

Query  155  YPVKLGSGVAAASAYLQNT  99
             PVKLGSG AAA+ Y  + 
Sbjct  371  IPVKLGSGTAAAAEYFTSN  389



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 140/195 (72%), Gaps = 1/195 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            +GSQK   LP G+ ++ ASPKA+E  KT K  R +F+++D +     G Y+PYTPS+ LL
Sbjct  197  SGSQKGFMLPAGLLLMAASPKAIEKGKTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLL  255

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSY  330
            YGL+  L +LFEEGLD V  RH  L    R AV AWGLK C ++ +W SDTVTA+VVP  
Sbjct  256  YGLKEALSILFEEGLDQVYKRHHHLAEGCRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEG  315

Query  329  IDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYP  150
             D++++++ A+KRYNL+LG GL++VAGKVFRIGHLG+LNEL LLG +AG EM + D G  
Sbjct  316  FDAAKVIETAYKRYNLALGAGLSEVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIK  375

Query  149  VKLGSGVAAASAYLQ  105
            ++ GSGVAAA A  +
Sbjct  376  IQPGSGVAAAQAVFR  390



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 143/201 (71%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALE--ASKTAKSVRV---FFDWKDYLKFYKMGTYWPYTPS  522
            GSQK   LP G+G++C SPKAL+   S T ++ R+   +F WKD L     G Y+PYTP 
Sbjct  198  GSQKGFMLPAGLGLICISPKALKIAESGTGRNDRLGHAYFAWKDQLAANATG-YFPYTPV  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W SDTVTA+V
Sbjct  257  LPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNSDTVTAIV  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
            VP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG EM + D
Sbjct  317  VPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAGAEMAMID  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  CGIKVTPGSGVAAASSYLREN  397



>ref|WP_012405153.1| serine--glyoxylate aminotransferase [Burkholderia phymatum]
 gb|ACC74993.1| Serine--glyoxylate transaminase [Burkholderia phymatum STM815]
Length=421

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/200 (56%), Positives = 143/200 (72%), Gaps = 2/200 (1%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQll  510
            TGSQK L LP G+GI+C S KAL+A   AKS R +FD  D ++    G Y+PYTP++ LL
Sbjct  200  TGSQKGLMLPAGLGILCVSQKALKAISHAKSRRCYFDLADMVRTNATG-YFPYTPALSLL  258

Query  509  yglragldlLFEEGLDNVIARHTRLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPS  333
            YGLRA LDLLFEEGL+NV ARH  L    R AV + WGL+ C +   W SDTV+A+VVP 
Sbjct  259  YGLRAALDLLFEEGLENVFARHHYLAAGVRAAVTEGWGLELCAKAPRWHSDTVSAIVVPE  318

Query  332  YIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGY  153
             +++++++  A++RYNL+LG GL+KVAGKVFRIGHLG+LNEL L+  +AG EM + D G 
Sbjct  319  GVNAAQVIDTAYRRYNLALGAGLSKVAGKVFRIGHLGDLNELMLMSAIAGAEMAMLDAGI  378

Query  152  PVKLGSGVAAASAYLQNTTP  93
             V+ GSGV AA  Y +  TP
Sbjct  379  DVRPGSGVGAAGQYWRTHTP  398



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 144/201 (72%), Gaps = 6/201 (3%)
 Frame = -2

Query  686  GSQKALSLPTGIGIVCASPKALEASK--TAKSVRV---FFDWKDYLKFYKMGTYWPYTPS  522
            GSQK   LP G+G++C SPKAL+ ++  T ++ R+   +F WKD L     G Y+PYTP 
Sbjct  198  GSQKGFMLPAGLGLICISPKALKIAEGGTGRNDRLGHAYFAWKDQLAANATG-YFPYTPV  256

Query  521  IQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVV  342
            + LLYGLR  L ++ EEGL+NV  RH  L  ATR AV AWGLK C ++ +W SDTVTA+V
Sbjct  257  LPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQAVAAWGLKPCAKEPKWNSDTVTAIV  316

Query  341  VPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD  162
            VP   D+++++  A++RYNLSLG GL+KVAGKVFRIGHLG+LNEL LLG +AG EM + D
Sbjct  317  VPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRIGHLGDLNELSLLGAIAGAEMAMLD  376

Query  161  IGYPVKLGSGVAAASAYLQNT  99
             G  V  GSGVAAAS+YL+  
Sbjct  377  CGIKVTPGSGVAAASSYLREN  397



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKS----VRVFFDWKDYLKFYKMGTYWPYTPS  522
            TGSQK L LP G+GI   S KALEA K A++     RV+FD++D  K  + G Y+PYTP+
Sbjct  192  TGSQKGLMLPAGLGIAVVSQKALEAQKAARANNPLRRVYFDFEDQSKANETG-YFPYTPA  250

Query  521  IQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAV  345
            + LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+SDTV+A+
Sbjct  251  LPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWYSDTVSAI  310

Query  344  VVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLK  165
            +VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + G EM ++
Sbjct  311  LVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAITGAEMAMR  370

Query  164  DIGYPVKLGSGVAAASAY  111
            DIG  VK GSG AAA  Y
Sbjct  371  DIGIDVKPGSGAAAAEEY  388



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   200 bits (508),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 143/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  689  TGSQKALSLPTGIGIVCASPKALEASKTAKS----VRVFFDWKDYLKFYKMGTYWPYTPS  522
            TGSQK L LP G+GI   S KALEA K A++     RV+FD++D  K  + G Y+PYTP+
Sbjct  192  TGSQKGLMLPAGLGIAVVSQKALEAQKAARANNPLRRVYFDFEDQSKANETG-YFPYTPA  250

Query  521  IQllyglragldlLF-EEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAV  345
            + LLYGLR  L ++  EEGLDNVIARH  L    R AV+AWGL  C + ++W+SDTV+A+
Sbjct  251  LPLLYGLREALQIILDEEGLDNVIARHHYLAQGVREAVKAWGLTLCAKDQKWYSDTVSAI  310

Query  344  VVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLK  165
            +VP   + ++++ RA+KRYNL+LG GL++VAGK+FRIGHLG+LNEL  LG + G EM ++
Sbjct  311  LVPEGFNGADVISRAFKRYNLALGAGLSQVAGKLFRIGHLGDLNELMCLGAITGAEMAMR  370

Query  164  DIGYPVKLGSGVAAASAY  111
            DIG  VK GSG AAA  Y
Sbjct  371  DIGIDVKPGSGAAAAEEY  388



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1158382918520