BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030K18

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789076.1|  PREDICTED: DELLA protein GAI1-like                 306   7e-97   Nicotiana sylvestris
ref|XP_011070609.1|  PREDICTED: DELLA protein GAI1                      298   3e-94   Sesamum indicum [beniseed]
gb|AFN25699.1|  RGA-1                                                   284   6e-94   Pyrus pyrifolia [sha li]
emb|CDP00805.1|  unnamed protein product                                292   6e-94   Coffea canephora [robusta coffee]
ref|XP_007225630.1|  hypothetical protein PRUPE_ppa005944mg             289   4e-92   
gb|AEX97109.1|  spur-type DELLA protein                                 294   6e-92   Malus domestica [apple tree]
gb|KDP38079.1|  hypothetical protein JCGZ_04722                         294   6e-92   Jatropha curcas
ref|XP_002312450.2|  hypothetical protein POPTR_0008s13090g             293   1e-91   
gb|ACL68359.1|  DELLA protein                                           293   1e-91   Malus baccata var. xiaojinensis
gb|ADH53778.1|  GAI2                                                    293   1e-91   Malus domestica [apple tree]
ref|XP_010264458.1|  PREDICTED: DELLA protein GAI1                      292   2e-91   Nelumbo nucifera [Indian lotus]
gb|AAY56752.1|  DELLA protein                                           292   3e-91   Malus domestica [apple tree]
gb|AHB17744.1|  GA repressor DELLA                                      290   3e-91   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004298516.1|  PREDICTED: DELLA protein GAIP                      291   3e-91   Fragaria vesca subsp. vesca
gb|ADW85805.1|  DELLA protein                                           292   4e-91   Malus domestica [apple tree]
ref|XP_008221422.1|  PREDICTED: DELLA protein GAIP-B                    292   4e-91   Prunus mume [ume]
gb|AAY56751.1|  DELLA protein                                           291   6e-91   Malus domestica [apple tree]
gb|ABL61270.1|  GAI1                                                    291   7e-91   Malus hupehensis
gb|ACL68360.1|  DELLA protein                                           291   7e-91   Malus domestica [apple tree]
gb|AGK07287.1|  GAI1                                                    290   1e-90   Rosa hybrid cultivar
ref|XP_002527794.1|  DELLA protein GAIP-B, putative                     290   1e-90   
ref|XP_011023720.1|  PREDICTED: DELLA protein GAIP-B-like               289   2e-90   Populus euphratica
ref|XP_009351505.1|  PREDICTED: DELLA protein GAI-like                  290   2e-90   Pyrus x bretschneideri [bai li]
ref|XP_009603475.1|  PREDICTED: DELLA protein GAI1-like                 288   3e-90   Nicotiana tomentosiformis
ref|XP_009349514.1|  PREDICTED: DELLA protein GAI-like                  290   4e-90   
gb|AHB17742.1|  GA repressor DELLA                                      287   4e-90   Actinidia deliciosa [Chinese gooseberry]
gb|ADA84480.1|  GRAS                                                    286   4e-90   Antirrhinum majus [garden snapdragon]
gb|EPS61323.1|  hypothetical protein M569_13471                         286   8e-90   Genlisea aurea
gb|AFJ23219.1|  DELLA protein                                           288   1e-89   Pyrus betulifolia
gb|EYU30084.1|  hypothetical protein MIMGU_mgv1a027121mg                287   1e-89   Erythranthe guttata [common monkey flower]
gb|AFJ23220.1|  DELLA protein                                           288   2e-89   Pyrus x bretschneideri [bai li]
gb|AEK06229.1|  GAI1                                                    286   2e-89   Vitis vinifera
ref|XP_002284648.1|  PREDICTED: DELLA protein GAI1                      286   2e-89   Vitis vinifera
dbj|BAG71200.1|  DELLA 1                                                285   3e-89   Lactuca sativa [cultivated lettuce]
ref|XP_007045197.1|  GRAS family transcription factor family protein    286   4e-89   
ref|XP_010274729.1|  PREDICTED: DELLA protein GAI1-like                 286   4e-89   Nelumbo nucifera [Indian lotus]
gb|ADH53781.1|  GAI2                                                    285   4e-89   Malus baccata var. xiaojinensis
gb|ADH53779.1|  GAI1                                                    284   7e-89   Malus domestica [apple tree]
ref|XP_002314799.2|  hypothetical protein POPTR_0010s12080g             285   1e-88   Populus trichocarpa [western balsam poplar]
gb|ABG26370.1|  DELLA protein GAI                                       285   2e-88   Gossypium barbadense [Egyptian cotton]
gb|ABI34432.1|  CRY                                                     282   3e-88   Pisum sativum [garden pea]
gb|ACM47244.1|  putative gibberellin signaling DELLA protein            282   3e-88   Sinningia speciosa [Brazilian gloxinia]
emb|CAN59753.1|  hypothetical protein VITISV_036639                     283   3e-88   Vitis vinifera
ref|XP_004504565.1|  PREDICTED: DELLA protein GAI1-like                 281   4e-88   Cicer arietinum [garbanzo]
gb|KJB15415.1|  hypothetical protein B456_002G177000                    283   4e-88   Gossypium raimondii
gb|AFP58844.1|  DELLA domain GRAS family transcription factor GAI       283   5e-88   Populus tomentosa [Chinese white poplar]
ref|XP_008467128.1|  PREDICTED: DELLA protein GAIP-B                    283   5e-88   Cucumis melo [Oriental melon]
ref|XP_002266267.1|  PREDICTED: DELLA protein GAI-like                  283   5e-88   Vitis vinifera
ref|XP_004166672.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    282   1e-87   
ref|XP_004150593.1|  PREDICTED: DELLA protein GAIP-B-like               282   1e-87   Cucumis sativus [cucumbers]
ref|XP_011038614.1|  PREDICTED: DELLA protein GAIP                      282   1e-87   Populus euphratica
gb|ADH53780.1|  GAI1                                                    281   1e-87   Malus domestica [apple tree]
ref|XP_010066602.1|  PREDICTED: DELLA protein GAIP-B-like               283   2e-87   Eucalyptus grandis [rose gum]
gb|AAY28970.1|  GIA/RGA-like gibberellin response modulator             279   3e-87   Gossypium hirsutum [American cotton]
gb|KJB08563.1|  hypothetical protein B456_001G089400                    279   4e-87   Gossypium raimondii
gb|AEE69074.2|  GAI-like protein                                        281   4e-87   Juglans regia
gb|AFN25702.1|  RGL2-2                                                  266   4e-87   Pyrus pyrifolia [sha li]
ref|XP_006384166.1|  hypothetical protein POPTR_0004s08890g             276   5e-87   
ref|XP_006307228.1|  hypothetical protein CARUB_v10008833mg             278   5e-87   Capsella rubella
sp|Q6EI06.1|GAIP_CUCMA  RecName: Full=DELLA protein GAIP; AltName...    280   6e-87   Cucurbita maxima [Boston marrow]
ref|XP_010527787.1|  PREDICTED: DELLA protein GAI-like                  280   6e-87   Tarenaya hassleriana [spider flower]
gb|ACR58455.1|  GAI/RGA protein                                         280   6e-87   Gossypium hirsutum [American cotton]
ref|XP_008362563.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    274   9e-87   
ref|XP_006383329.1|  hypothetical protein POPTR_0005s14540g             280   2e-86   Populus trichocarpa [western balsam poplar]
ref|XP_010496659.1|  PREDICTED: DELLA protein GAI                       277   2e-86   Camelina sativa [gold-of-pleasure]
ref|XP_006416958.1|  hypothetical protein EUTSA_v10007323mg             277   2e-86   Eutrema salsugineum [saltwater cress]
gb|AEX97111.1|  spur-type DELLA protein                                 278   2e-86   Malus domestica [apple tree]
gb|AAY56750.1|  DELLA protein                                           278   2e-86   Malus domestica [apple tree]
ref|XP_008343058.1|  PREDICTED: DELLA protein GAI-like                  278   2e-86   
ref|XP_009334448.1|  PREDICTED: DELLA protein GAI-like                  278   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_010459010.1|  PREDICTED: DELLA protein GAI-like                  277   2e-86   Camelina sativa [gold-of-pleasure]
sp|Q6EI05.1|GAIPB_CUCMA  RecName: Full=DELLA protein GAIP-B; AltN...    278   3e-86   Cucurbita maxima [Boston marrow]
gb|AHB17743.1|  GA repressor DELLA                                      277   3e-86   Actinidia deliciosa [Chinese gooseberry]
gb|EYU33133.1|  hypothetical protein MIMGU_mgv1a027125mg                267   4e-86   Erythranthe guttata [common monkey flower]
ref|XP_003531153.1|  PREDICTED: DELLA protein GAI1-like                 275   5e-86   Glycine max [soybeans]
ref|XP_011021384.1|  PREDICTED: DELLA protein GAI-like                  278   6e-86   Populus euphratica
ref|XP_008229195.1|  PREDICTED: DELLA protein GAI                       277   6e-86   
ref|XP_007214956.1|  hypothetical protein PRUPE_ppa003206mg             277   7e-86   Prunus persica
gb|AHX57850.1|  DELLA                                                   277   7e-86   Prunus mume [ume]
emb|CAA72178.1|  RGA2 protein                                           275   1e-85   Arabidopsis thaliana [mouse-ear cress]
emb|CAA75492.1|  GAI                                                    275   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172945.1|  DELLA protein GAI                                     275   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305198.1|  hypothetical protein POPTR_0004s08890g             276   2e-85   Populus trichocarpa [western balsam poplar]
ref|XP_006430617.1|  hypothetical protein CICLE_v10011367mg             276   2e-85   Citrus clementina [clementine]
ref|XP_011002785.1|  PREDICTED: DELLA protein GAI                       276   2e-85   Populus euphratica
ref|XP_010476569.1|  PREDICTED: DELLA protein GAI-like                  275   2e-85   Camelina sativa [gold-of-pleasure]
ref|XP_010681882.1|  PREDICTED: DELLA protein GAI-like                  276   2e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002534030.1|  DELLA protein GAI, putative                        275   3e-85   Ricinus communis
gb|KFK26113.1|  hypothetical protein AALP_AA8G204400                    274   3e-85   Arabis alpina [alpine rockcress]
ref|XP_006469195.1|  PREDICTED: DELLA protein GAIP-B-like               275   4e-85   Citrus sinensis [apfelsine]
gb|KDO64603.1|  hypothetical protein CISIN_1g043131mg                   275   4e-85   Citrus sinensis [apfelsine]
gb|AAT08645.1|  GAI-like protein                                        263   6e-85   Hyacinthus orientalis [common hyacinth]
ref|XP_002890081.1|  hypothetical protein ARALYDRAFT_471680             273   7e-85   
ref|XP_007156503.1|  hypothetical protein PHAVU_003G291500g             272   8e-85   Phaseolus vulgaris [French bean]
ref|XP_006482132.1|  PREDICTED: DELLA protein GAI-like                  274   8e-85   Citrus sinensis [apfelsine]
dbj|BAF62636.1|  DELLA protein                                          272   8e-85   Phaseolus vulgaris [French bean]
gb|ACY74341.1|  putative DELLA protein                                  273   9e-85   Artemisia annua [sweet Annie]
ref|NP_001240948.1|  DELLA protein GAI 1                                272   1e-84   Glycine max [soybeans]
dbj|BAG71201.1|  DELLA 2                                                274   1e-84   Lactuca sativa [cultivated lettuce]
ref|XP_010101954.1|  hypothetical protein L484_011971                   271   1e-84   
ref|XP_010553798.1|  PREDICTED: DELLA protein GAI-like                  275   1e-84   Tarenaya hassleriana [spider flower]
emb|CDP01615.1|  unnamed protein product                                272   2e-84   Coffea canephora [robusta coffee]
gb|KDP33167.1|  hypothetical protein JCGZ_13432                         272   2e-84   Jatropha curcas
ref|XP_010032696.1|  PREDICTED: DELLA protein GAI                       275   2e-84   Eucalyptus grandis [rose gum]
gb|EYU25601.1|  hypothetical protein MIMGU_mgv1a003589mg                272   6e-84   Erythranthe guttata [common monkey flower]
gb|AHB17746.1|  GA repressor DELLA                                      271   1e-83   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006448223.1|  hypothetical protein CICLE_v10017466mg             271   1e-83   Citrus clementina [clementine]
gb|KFK33379.1|  rga1 protein                                            271   2e-83   Arabis alpina [alpine rockcress]
gb|ABI30654.1|  putative gibberellin signaling DELLA protein LA         270   3e-83   Pisum sativum [garden pea]
ref|XP_010554410.1|  PREDICTED: DELLA protein GAI-like                  271   3e-83   Tarenaya hassleriana [spider flower]
ref|XP_008460522.1|  PREDICTED: DELLA protein GAI-like                  270   3e-83   Cucumis melo [Oriental melon]
ref|XP_009779843.1|  PREDICTED: DELLA protein GAI-like isoform X4       270   4e-83   Nicotiana sylvestris
ref|XP_006826893.1|  hypothetical protein AMTR_s00010p00148880          268   8e-83   Amborella trichopoda
ref|XP_006395878.1|  hypothetical protein EUTSA_v10005482mg             270   1e-82   Eutrema salsugineum [saltwater cress]
gb|ABO61516.1|  GAI1                                                    267   1e-82   Glycine max [soybeans]
ref|XP_004155733.1|  PREDICTED: DELLA protein GAI-like                  269   2e-82   
ref|XP_009370101.1|  PREDICTED: DELLA protein GAI-like                  268   2e-82   
dbj|BAF62637.1|  DELLA protein                                          268   3e-82   Phaseolus vulgaris [French bean]
ref|XP_007163387.1|  hypothetical protein PHAVU_001G230500g             268   3e-82   Phaseolus vulgaris [French bean]
gb|ABS50250.1|  DELLA protein                                           267   3e-82   Malus hupehensis
ref|XP_003552980.1|  PREDICTED: DELLA protein GAI-like                  267   3e-82   Glycine max [soybeans]
gb|AEX97110.1|  spur-type DELLA protein                                 267   4e-82   Malus domestica [apple tree]
gb|AAY56749.1|  DELLA protein                                           267   4e-82   Malus domestica [apple tree]
ref|XP_010551797.1|  PREDICTED: DELLA protein RGL1-like                 266   5e-82   Tarenaya hassleriana [spider flower]
emb|CDY36236.1|  BnaC07g20900D                                          266   8e-82   Brassica napus [oilseed rape]
gb|EYU30908.1|  hypothetical protein MIMGU_mgv1a024641mg                265   1e-81   Erythranthe guttata [common monkey flower]
gb|EYU45810.1|  hypothetical protein MIMGU_mgv1a003644mg                266   1e-81   Erythranthe guttata [common monkey flower]
gb|AFA35960.1|  ELLA domain GRAS family transcription factor            265   1e-81   Nicotiana attenuata
ref|XP_009796771.1|  PREDICTED: DELLA protein GAI-like                  265   1e-81   Nicotiana sylvestris
sp|Q5BN22.1|RGA2_BRACM  RecName: Full=DELLA protein RGA2; AltName...    266   1e-81   Brassica rapa
gb|ACN33960.1|  unknown                                                 262   1e-81   Zea mays [maize]
ref|XP_009779840.1|  PREDICTED: DELLA protein GAI-like isoform X1       265   2e-81   Nicotiana sylvestris
ref|XP_009779842.1|  PREDICTED: DELLA protein GAI-like isoform X3       265   2e-81   Nicotiana sylvestris
gb|ACN36682.1|  unknown                                                 261   2e-81   Zea mays [maize]
ref|XP_010424927.1|  PREDICTED: DELLA protein RGA-like                  266   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_010109004.1|  hypothetical protein L484_027201                   265   2e-81   
ref|XP_008381346.1|  PREDICTED: DELLA protein GAI                       265   2e-81   
dbj|BAG16380.1|  GRAS family transcription factor                       265   2e-81   Brassica rapa var. perviridis [kabuna]
sp|Q84TQ7.1|GAI_GOSHI  RecName: Full=DELLA protein GAI; AltName: ...    264   2e-81   Gossypium hirsutum [American cotton]
gb|AHB17745.1|  GA repressor DELLA                                      265   3e-81   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010513881.1|  PREDICTED: DELLA protein RGA isoform X1            265   3e-81   
gb|AFD62413.1|  reduced height-2                                        265   5e-81   Eragrostis tef [tef]
dbj|BAG16374.1|  GRAS family transcription factor                       263   9e-81   Brassica oleracea var. italica [asparagus broccoli]
gb|AFD62385.1|  reduced height-1                                        265   1e-80   Eragrostis tef [tef]
gb|ACL53794.1|  unknown                                                 263   1e-80   Zea mays [maize]
ref|XP_010502135.1|  PREDICTED: DELLA protein RGA-like                  264   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_009594460.1|  PREDICTED: DELLA protein GAI-like                  263   1e-80   Nicotiana tomentosiformis
gb|AFD62391.1|  reduced height-2                                        263   2e-80   Eragrostis tef [tef]
sp|Q9ST48.1|DWRF8_MAIZE  RecName: Full=DELLA protein DWARF8; Shor...    264   2e-80   Zea mays [maize]
gb|AFD62419.1|  reduced height-2                                        263   2e-80   Eragrostis tef [tef]
ref|XP_009101333.1|  PREDICTED: DELLA protein RGA1                      262   2e-80   Brassica rapa
gb|AFD62396.1|  reduced height-2                                        263   2e-80   Eragrostis tef [tef]
tpg|DAA50918.1|  TPA: dwarf plant8                                      263   2e-80   
gb|AFD62360.1|  reduced height-1                                        263   3e-80   Eragrostis tef [tef]
gb|AFD62369.1|  reduced height-1                                        263   3e-80   Eragrostis tef [tef]
gb|AFD62384.1|  reduced height-1                                        263   3e-80   Eragrostis tef [tef]
gb|ADD71137.1|  DELLA protein                                           262   4e-80   Brassica napus [oilseed rape]
gb|KEH34625.1|  DELLA domain GRAS family transcription factor GAI       261   4e-80   Medicago truncatula
ref|XP_002876760.1|  RGA1 protein                                       262   5e-80   
emb|CDY17662.1|  BnaA06g34810D                                          261   8e-80   Brassica napus [oilseed rape]
gb|AAZ08572.1|  truncated gibberellic acid-insensitive isoform 1        257   9e-80   Saccharum hybrid cultivar Co 419
gb|AFC88481.1|  DELLA protein                                           260   1e-79   Rosa lucieae [memorial rose]
ref|XP_009590329.1|  PREDICTED: DELLA protein GAI-like                  260   1e-79   Nicotiana tomentosiformis
ref|XP_011097451.1|  PREDICTED: DELLA protein GAI-like                  260   2e-79   Sesamum indicum [beniseed]
gb|EPS67815.1|  hypothetical protein M569_06957                         258   2e-79   Genlisea aurea
ref|XP_011099949.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    259   2e-79   Sesamum indicum [beniseed]
emb|CAA75493.1|  GRS protein                                            260   3e-79   Arabidopsis thaliana [mouse-ear cress]
gb|AAK97709.1|  At2g01570/F2I9.19                                       260   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178266.1|  DELLA protein RGA                                     259   3e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CAA72177.1|  RGA1 protein                                           259   3e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004140302.1|  PREDICTED: DELLA protein GAI-like                  259   4e-79   
ref|XP_003560731.1|  PREDICTED: DELLA protein SLN1                      260   5e-79   Brachypodium distachyon [annual false brome]
ref|XP_004503135.1|  PREDICTED: DELLA protein GAI-like                  259   8e-79   Cicer arietinum [garbanzo]
gb|EMS65108.1|  hypothetical protein TRIUR3_18790                       253   9e-79   Triticum urartu
ref|XP_002466594.1|  hypothetical protein SORBIDRAFT_01g010660          259   1e-78   Sorghum bicolor [broomcorn]
ref|XP_010916517.1|  PREDICTED: DELLA protein SLR1 isoform X1           259   1e-78   
gb|AAZ08571.1|  gibberellic acid-insensitive                            259   1e-78   Saccharum hybrid cultivar Co 419
ref|XP_010528540.1|  PREDICTED: DELLA protein RGL1                      257   2e-78   Tarenaya hassleriana [spider flower]
ref|NP_001234365.1|  DELLA protein GAI                                  258   2e-78   Solanum lycopersicum
gb|AEI25530.1|  gibberellic acid insensitive protein                    257   4e-78   Solanum tuberosum [potatoes]
ref|XP_006364643.1|  PREDICTED: DELLA protein GAI-like                  257   4e-78   
ref|XP_002884379.1|  hypothetical protein ARALYDRAFT_477591             256   5e-78   
ref|XP_006650473.1|  PREDICTED: DELLA protein SLR1-like                 257   7e-78   Oryza brachyantha
gb|EEE59780.1|  hypothetical protein OsJ_12286                          257   9e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982031.1|  PREDICTED: DELLA protein DWARF8-like               256   1e-77   
gb|AFD62376.1|  reduced height-1                                        256   1e-77   Eragrostis tef [tef]
emb|CBX87014.1|  DELLA protein                                          254   2e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006400288.1|  hypothetical protein EUTSA_v100155351mg            251   2e-77   
gb|ABI84226.1|  dwarf plant9                                            256   2e-77   Zea mays [maize]
emb|CBW30283.1|  RHT-A1 protein                                         255   3e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AHK61037.1|  DELLA protein                                           255   3e-77   Psathyrostachys huashanica
gb|AGG68491.1|  DELLA protein                                           255   3e-77   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30285.1|  RHT-B1 protein                                         255   3e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AAX07462.1|  gibberellic acid-insensitive                            255   3e-77   Oryza sativa Indica Group [Indian rice]
gb|AGG68490.1|  DELLA protein                                           255   3e-77   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30286.1|  RHT-B1 protein                                         255   3e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AEV92815.1|  DELLA protein                                           255   3e-77   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30287.1|  RHT-B1 protein                                         255   3e-77   Triticum aestivum [Canadian hard winter wheat]
gb|EAY91579.1|  hypothetical protein OsI_13213                          255   3e-77   Oryza sativa Indica Group [Indian rice]
ref|NP_001051032.1|  Os03g0707600                                       255   3e-77   
emb|CCD31540.1|  Reduced height-1 protein                               255   4e-77   Triticum aestivum [Canadian hard winter wheat]
gb|ADM32428.1|  DELLA protein Rht-A1                                    255   4e-77   Triticum aestivum [Canadian hard winter wheat]
gb|AGO59331.1|  DELLA protein                                           255   4e-77   Triticum turgidum subsp. durum
gb|AGG68464.1|  DELLA protein                                           255   4e-77   Triticum aestivum [Canadian hard winter wheat]
sp|Q8W127.1|SLN1_HORVU  RecName: Full=DELLA protein SLN1; AltName...    255   4e-77   Hordeum vulgare [barley]
gb|AEV92816.1|  DELLA protein                                           255   5e-77   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009413642.1|  PREDICTED: DELLA protein SLR1-like                 254   5e-77   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI84063.1|  DELLA protein RHT1                                     252   1e-76   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68462.1|  DELLA protein                                           254   1e-76   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009390245.1|  PREDICTED: DELLA protein SLR1-like                 253   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380281.1|  PREDICTED: DELLA protein SLN1-like                 252   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008644580.1|  PREDICTED: DELLA protein DWARF8-like               253   3e-76   
ref|NP_186995.1|  DELLA protein RGL2                                    250   7e-76   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42642.1|  putative RGA1                                          250   7e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008809806.1|  PREDICTED: DELLA protein SLR1                      252   8e-76   Phoenix dactylifera
ref|XP_003538395.1|  PREDICTED: DELLA protein GAI1                      250   1e-75   Glycine max [soybeans]
emb|CDY55037.1|  BnaCnng28010D                                          248   1e-75   Brassica napus [oilseed rape]
gb|AGA16543.1|  DELLA protein RGL2                                      248   2e-75   Sisymbrium officinale
ref|XP_008782281.1|  PREDICTED: DELLA protein SLR1-like                 251   3e-75   Phoenix dactylifera
ref|XP_006408301.1|  hypothetical protein EUTSA_v10020431mg             248   3e-75   Eutrema salsugineum [saltwater cress]
ref|NP_176809.1|  DELLA protein RGL1                                    246   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302161.1|  hypothetical protein CARUB_v10020171mg             246   8e-75   Capsella rubella
ref|XP_010420475.1|  PREDICTED: DELLA protein RGL3                      246   1e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010453948.1|  PREDICTED: DELLA protein RGL3-like                 246   1e-74   Camelina sativa [gold-of-pleasure]
gb|AFC88482.1|  DELLA protein                                           247   1e-74   Rosa lucieae [memorial rose]
ref|XP_010926472.1|  PREDICTED: DELLA protein SLR1-like                 249   2e-74   Elaeis guineensis
emb|CDY70426.1|  BnaCnng68300D                                          245   2e-74   Brassica napus [oilseed rape]
ref|XP_008457015.1|  PREDICTED: DELLA protein GAI-like                  246   2e-74   Cucumis melo [Oriental melon]
ref|XP_010492705.1|  PREDICTED: DELLA protein RGL3-like                 245   2e-74   
ref|XP_009127484.1|  PREDICTED: DELLA protein RGL1                      244   3e-74   Brassica rapa
ref|XP_010511563.1|  PREDICTED: DELLA protein RGL1-like                 244   4e-74   Camelina sativa [gold-of-pleasure]
gb|KFK41051.1|  hypothetical protein AALP_AA2G079000                    244   4e-74   Arabis alpina [alpine rockcress]
ref|XP_006299072.1|  hypothetical protein CARUB_v10015212mg             245   5e-74   Capsella rubella
ref|XP_002887024.1|  hypothetical protein ARALYDRAFT_475738             244   5e-74   
gb|EPS58722.1|  hypothetical protein M569_16090                         244   6e-74   Genlisea aurea
gb|KFK38060.1|  hypothetical protein AALP_AA3G064800                    244   1e-73   Arabis alpina [alpine rockcress]
emb|CDY38434.1|  BnaA10g17240D                                          243   1e-73   Brassica napus [oilseed rape]
ref|XP_010470510.1|  PREDICTED: DELLA protein RGL1 isoform X1           243   1e-73   
emb|CAA12242.1|  RGA-like                                               246   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107522.1|  PREDICTED: DELLA protein RGL3                      243   2e-73   Brassica rapa
emb|CDY16915.1|  BnaC09g40420D                                          243   2e-73   Brassica napus [oilseed rape]
ref|XP_009130367.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    243   2e-73   Brassica rapa
ref|NP_197251.1|  DELLA protein RGL3                                    243   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415179.1|  PREDICTED: DELLA protein RGL1-like                 242   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_006391387.1|  hypothetical protein EUTSA_v10018436mg             241   4e-73   Eutrema salsugineum [saltwater cress]
gb|ADO60988.1|  DELLA protein 2                                         231   6e-73   Helianthus annuus
gb|AAM15895.1|AF492578_1  GIA/RGA-like gibberellin response modul...    242   6e-73   Calycadenia multiglandulosa
ref|XP_002873832.1|  hypothetical protein ARALYDRAFT_488615             241   7e-73   
gb|ADP02183.1|  Rht-D1b                                                 242   9e-73   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68478.1|  DELLA protein                                           243   1e-72   Triticum aestivum [Canadian hard winter wheat]
gb|AGG68476.1|  DELLA protein                                           243   2e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30290.1|  RHT-D1 protein                                         243   2e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30289.1|  RHT-D1 protein                                         243   2e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30288.1|  RHT-D1 protein                                         243   2e-72   Triticum aestivum [Canadian hard winter wheat]
sp|Q9ST59.1|RHT1_WHEAT  RecName: Full=DELLA protein RHT-1; AltNam...    243   2e-72   Triticum aestivum [Canadian hard winter wheat]
emb|CBW30291.1|  RHT-D1 protein                                         243   2e-72   Triticum aestivum [Canadian hard winter wheat]
gb|ADP02199.1|  Rht-D1a                                                 243   2e-72   Aegilops tauschii
emb|CCG14222.1|  gibberellin DELLA protein                              241   4e-72   Cucumis sativus [cucumbers]
ref|XP_010549753.1|  PREDICTED: DELLA protein RGL2 isoform X1           240   4e-72   Tarenaya hassleriana [spider flower]
ref|XP_006289966.1|  hypothetical protein CARUB_v10003592mg             239   4e-72   Capsella rubella
ref|XP_004145854.1|  PREDICTED: DELLA protein GAI-like                  240   5e-72   Cucumis sativus [cucumbers]
ref|XP_007141902.1|  hypothetical protein PHAVU_008G235500g             239   9e-72   Phaseolus vulgaris [French bean]
ref|XP_010463795.1|  PREDICTED: DELLA protein RGL2-like                 239   9e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010510814.1|  PREDICTED: DELLA protein RGL2 isoform X1           238   3e-71   
ref|XP_010558681.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    238   3e-71   Tarenaya hassleriana [spider flower]
ref|XP_009114228.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    238   3e-71   Brassica rapa
ref|XP_010510942.1|  PREDICTED: DELLA protein RGL2 isoform X3           238   3e-71   
gb|KFK25966.1|  hypothetical protein AALP_AA8G186200                    236   4e-71   Arabis alpina [alpine rockcress]
ref|XP_009409625.1|  PREDICTED: DELLA protein SLR1-like                 238   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM15897.1|AF492580_1  GIA/RGA-like gibberellin response modul...    223   2e-70   Anisocarpus madioides
gb|AAM15884.1|AF492566_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Dubautia menziesii
gb|AAM15883.1|AF492565_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Dubautia ciliolata subsp. glutinosa
gb|AAM15890.1|AF492572_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15882.1|AF492564_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Dubautia ciliolata subsp. glutinosa
gb|AAM15889.1|AF492571_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Argyroxiphium sandwicense subsp. macrocephalum
gb|AAM15885.1|  GIA/RGA-like gibberellin response modulator             235   3e-70   Dubautia raillardioides
gb|AAM15881.1|AF492563_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Dubautia arborea
gb|AAM15880.1|AF492562_1  GIA/RGA-like gibberellin response modul...    235   3e-70   Dubautia arborea
gb|AAM15901.1|AF492584_1  GIA/RGA-like gibberellin response modul...    235   4e-70   Argyroxiphium kauense
gb|AAM15900.1|AF492583_1  GIA/RGA-like gibberellin response modul...    234   4e-70   
gb|ABL97942.1|  GAI-like protein 1                                      225   9e-70   
gb|AAM15891.1|AF492573_1  GIA/RGA-like gibberellin response modul...    234   1e-69   
gb|AFN25700.1|  RGA-2                                                   221   1e-69   
gb|AAM15906.1|AF492589_1  GIA/RGA-like gibberellin response modul...    233   2e-69   
gb|AAM15904.1|AF492587_1  GIA/RGA-like gibberellin response modul...    233   2e-69   
gb|AAM15888.1|AF492570_1  GIA/RGA-like gibberellin response modul...    233   2e-69   
gb|AAM15907.1|AF492590_1  GIA/RGA-like gibberellin response modul...    233   2e-69   
gb|AAM15903.1|AF492586_1  GIA/RGA-like gibberellin response modul...    233   3e-69   
gb|ABL97900.1|  GAI-like protein 1                                      224   3e-69   
gb|AAM15898.1|AF492581_1  GIA/RGA-like gibberellin response modul...    233   3e-69   
ref|XP_007033025.1|  GRAS family transcription factor family protein    235   3e-69   
gb|ABL97941.1|  GAI-like protein 1                                      231   5e-69   
gb|AFN25701.1|  RGL2-1                                                  219   6e-69   
gb|AAM15892.1|AF492575_1  GIA/RGA-like gibberellin response modul...    231   8e-69   
gb|AAM15886.1|AF492568_1  GIA/RGA-like gibberellin response modul...    231   9e-69   
gb|AAM15899.1|AF492582_1  GIA/RGA-like gibberellin response modul...    231   1e-68   
gb|ABL97899.1|  GAI-like protein 1                                      224   2e-68   
gb|ABL97939.1|  GAI-like protein 1                                      221   3e-68   
ref|XP_006292324.1|  hypothetical protein CARUB_v10018534mg             231   5e-68   
gb|ABL97872.1|  GAI-like protein 1                                      221   6e-68   
gb|AAM15893.1|AF492576_1  GIA/RGA-like gibberellin response modul...    229   7e-68   
gb|ABL97887.1|  GAI-like protein 1                                      220   9e-68   
gb|ABL97898.1|  GAI-like protein 1                                      224   1e-67   
gb|ABL97914.1|  GAI-like protein 1                                      219   2e-67   
gb|ABL97843.1|  GAI-like protein 1                                      219   3e-67   
gb|ABL97902.1|  GAI-like protein 1                                      224   7e-67   
gb|ABL97864.1|  GAI-like protein 1                                      218   8e-67   
gb|ABL97901.1|  GAI-like protein 1                                      224   2e-66   
gb|ABL97869.1|  GAI-like protein 1                                      224   2e-66   
gb|ABL97874.1|  GAI-like protein 1                                      224   2e-66   
gb|ABL97873.1|  GAI-like protein 1                                      224   3e-66   
gb|ABL97862.1|  GAI-like protein 1                                      223   4e-66   
gb|ABL97852.1|  GAI-like protein 1                                      223   4e-66   
gb|ABL97930.1|  GAI-like protein 1                                      223   4e-66   
gb|ABL97934.1|  GAI-like protein 1                                      223   4e-66   
gb|ABL97938.1|  GAI-like protein 1                                      223   5e-66   
gb|ABL97845.1|  GAI-like protein 1                                      223   5e-66   
gb|ABL97928.1|  GAI-like protein 1                                      223   5e-66   
gb|AAM15905.1|AF492588_1  GIA/RGA-like gibberellin response modul...    224   5e-66   
gb|ABL97842.1|  GAI-like protein 1                                      223   6e-66   
gb|ABL97844.1|  GAI-like protein 1                                      223   6e-66   
gb|ABL97931.1|  GAI-like protein 1                                      222   6e-66   
gb|ABL97860.1|  GAI-like protein 1                                      223   6e-66   
gb|ABL97909.1|  GAI-like protein 1                                      223   7e-66   
gb|ABL97903.1|  GAI-like protein 1                                      223   8e-66   
gb|ABL97857.1|  GAI-like protein 1                                      222   9e-66   
gb|ABL97886.1|  GAI-like protein 1                                      222   1e-65   
gb|ABL97879.1|  GAI-like protein 1                                      222   2e-65   
gb|ABL97856.1|  GAI-like protein 1                                      214   2e-65   
gb|ABL97854.1|  GAI-like protein 1                                      221   3e-65   
gb|ABL97897.1|  GAI-like protein 1                                      220   3e-65   
gb|ABL97861.1|  GAI-like protein 1                                      221   3e-65   
gb|ABL97840.1|  GAI-like protein 1                                      221   3e-65   
gb|ABL97940.1|  GAI-like protein 1                                      220   4e-65   
gb|ABL97882.1|  GAI-like protein 1                                      221   4e-65   
gb|ABL97912.1|  GAI-like protein 1                                      221   4e-65   
gb|ABL97870.1|  GAI-like protein 1                                      221   4e-65   
gb|AAM78198.1|  putative RGA1 protein                                   209   4e-65   
gb|ABL97932.1|  GAI-like protein 1                                      220   5e-65   
gb|ABL97841.1|  GAI-like protein 1                                      220   6e-65   
gb|ABL97880.1|  GAI-like protein 1                                      220   6e-65   
gb|ABL97871.1|  GAI-like protein 1                                      213   7e-65   
gb|ABL97933.1|  GAI-like protein 1                                      220   7e-65   
gb|AAM78197.1|  putative RGA1 protein                                   208   1e-64   
gb|ABL97849.1|  GAI-like protein 1                                      218   2e-64   
gb|ABL97884.1|  GAI-like protein 1                                      219   2e-64   
gb|AAM78194.1|  putative RGA1 protein                                   207   3e-64   
gb|ABL97936.1|  GAI-like protein 1                                      218   3e-64   
gb|ADQ47622.1|  GAI-like protein 1                                      211   3e-64   
gb|ABL97839.1|  GAI-like protein 1                                      218   3e-64   
gb|ABL97877.1|  GAI-like protein 1                                      218   3e-64   
gb|ABL97910.1|  GAI-like protein 1                                      218   4e-64   
gb|ABL97876.1|  GAI-like protein 1                                      218   6e-64   
gb|ABL97846.1|  GAI-like protein 1                                      217   7e-64   
gb|AHW42471.1|  DPL                                                     221   8e-64   
gb|ABL97935.1|  GAI-like protein 1                                      216   9e-64   
gb|ABL97937.1|  GAI-like protein 1                                      216   1e-63   
gb|ABL97881.1|  GAI-like protein 1                                      214   1e-63   
gb|ABL97865.1|  GAI-like protein 1                                      209   1e-63   
gb|ABL97850.1|  GAI-like protein 1                                      209   1e-63   
gb|ABL97913.1|  GAI-like protein 1                                      216   2e-63   
gb|ABL97859.1|  GAI-like protein 1                                      216   2e-63   
gb|ABL97858.1|  GAI-like protein 1                                      214   2e-63   
gb|ABL97885.1|  GAI-like protein 1                                      209   3e-63   
gb|ABL97926.1|  GAI-like protein 1                                      216   4e-63   
gb|ABL97925.1|  GAI-like protein 1                                      216   4e-63   
gb|ABL97908.1|  GAI-like protein 1                                      215   4e-63   
gb|ADQ47646.1|  GAI-like protein 1                                      212   4e-63   
gb|ABL97878.1|  GAI-like protein 1                                      215   5e-63   
gb|ABL97911.1|  GAI-like protein 1                                      214   8e-63   
gb|AET82136.1|  hypothetical protein                                    204   9e-63   
gb|AEW07596.1|  hypothetical protein 0_6323_02                          204   9e-63   
gb|ABL97922.1|  GAI-like protein 1                                      214   1e-62   
gb|ADQ47643.1|  GAI-like protein 1                                      211   1e-62   
gb|ABL97868.1|  GAI-like protein 1                                      214   2e-62   
gb|ADQ47645.1|  GAI-like protein 1                                      210   2e-62   
dbj|BAP05438.1|  GAI1-like E3 ubiquitin ligase protein                  215   2e-62   
gb|ADQ47621.1|  GAI-like protein 1                                      213   2e-62   
gb|ABL97924.1|  GAI-like protein 1                                      214   2e-62   
gb|ACV52014.1|  GAI/RGA-like 3-b                                        214   2e-62   
gb|ABL97894.1|  GAI-like protein 1                                      213   2e-62   
gb|ADQ47632.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47629.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47625.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47626.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47631.1|  GAI-like protein 1                                      213   3e-62   
gb|ACV52013.1|  GAI/RGA-like 3-a                                        214   3e-62   
gb|ADQ47636.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47623.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47617.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47633.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47627.1|  GAI-like protein 1                                      213   3e-62   
gb|ADQ47616.1|  GAI-like protein 1                                      212   4e-62   
gb|ADQ47635.1|  GAI-like protein 1                                      212   4e-62   
gb|ADQ47620.1|  GAI-like protein 1                                      212   4e-62   
gb|ADQ47615.1|  GAI-like protein 1                                      212   5e-62   
gb|ADQ47644.1|  GAI-like protein 1                                      209   5e-62   
gb|KJB54121.1|  hypothetical protein B456_009G021700                    213   8e-62   
gb|AHB17748.1|  GA repressor DELLA                                      213   8e-62   
gb|ABL97920.1|  GAI-like protein 1                                      204   9e-62   
ref|XP_008343960.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    213   9e-62   
gb|AAY56754.1|  DELLA protein                                           213   1e-61   
ref|XP_009371410.1|  PREDICTED: DELLA protein GAI-like                  213   1e-61   
gb|ABL97867.1|  GAI-like protein 1                                      211   1e-61   
gb|AJC52500.1|  SCL14                                                   200   2e-61   
gb|ABL97863.1|  GAI-like protein 1                                      211   2e-61   
gb|ADQ47618.1|  GAI-like protein 1                                      210   3e-61   
gb|ABL97929.1|  GAI-like protein 1                                      210   3e-61   
ref|XP_004287380.1|  PREDICTED: DELLA protein GAI-like                  211   7e-61   
gb|ABL97893.1|  GAI-like protein 1                                      209   8e-61   
ref|XP_008390123.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    213   2e-60   
gb|ABL97923.1|  GAI-like protein 1                                      207   4e-60   
gb|KDP32341.1|  hypothetical protein JCGZ_13266                         208   4e-60   
gb|ABL97915.1|  GAI-like protein 1                                      207   4e-60   
ref|XP_007203631.1|  hypothetical protein PRUPE_ppa003975mg             208   6e-60   
gb|ABL97866.1|  GAI-like protein 1                                      206   7e-60   
gb|ABL97918.1|  GAI-like protein 1                                      206   9e-60   
gb|ABL97927.1|  GAI-like protein 1                                      207   1e-59   
gb|AAY56753.1|  DELLA protein                                           207   2e-59   
gb|AHB17747.1|  GA repressor DELLA                                      206   2e-59   
gb|AEX97112.1|  spur-type DELLA protein                                 207   2e-59   
ref|XP_008337344.1|  PREDICTED: DELLA protein GAI-like                  206   2e-59   
gb|ACR58457.1|  GAI/RGA-like protein                                    207   3e-59   
ref|XP_002529354.1|  DELLA protein GAI1, putative                       206   3e-59   
ref|XP_002960248.1|  GRAS-family protein                                208   3e-59   
ref|XP_006589312.1|  PREDICTED: DELLA protein RGA-like                  205   3e-59   
gb|AHW42470.1|  RGA                                                     207   4e-59   
gb|ADQ47647.1|  GAI-like protein 1                                      201   4e-59   
ref|XP_003556343.1|  PREDICTED: DELLA protein GAI1-like                 203   5e-59   
gb|ADQ47613.1|  GAI-like protein 1                                      204   6e-59   
ref|XP_007013315.1|  GAI/RGA-like protein                               205   7e-59   
ref|XP_010925126.1|  PREDICTED: DELLA protein DWARF8-like               206   8e-59   
gb|ABL97917.1|  GAI-like protein 1                                      204   1e-58   
gb|AGV54403.1|  DELLA protein DWARF8-like protein                       203   1e-58   
ref|XP_007144131.1|  hypothetical protein PHAVU_007G131200g             203   2e-58   
ref|XP_010249953.1|  PREDICTED: DELLA protein SLR1-like                 204   2e-58   
ref|XP_004507626.1|  PREDICTED: DELLA protein RHT-1-like                203   2e-58   
ref|XP_003528281.1|  PREDICTED: DELLA protein SLR1-like                 203   3e-58   
gb|ADQ47611.1|  GAI-like protein 1                                      202   4e-58   
gb|ACR58456.1|  GAI/RGA-like protein                                    203   5e-58   
ref|XP_003524001.1|  PREDICTED: DELLA protein DWARF8-like               202   8e-58   
ref|XP_006475770.1|  PREDICTED: DELLA protein GAI-like                  202   8e-58   
ref|XP_006451026.1|  hypothetical protein CICLE_v10010825mg             202   9e-58   
gb|ADQ47648.1|  GAI-like protein 1                                      197   1e-57   
ref|XP_010254273.1|  PREDICTED: DELLA protein GAI-like                  201   2e-57   
gb|ABL97853.1|  GAI-like protein 1                                      200   2e-57   
gb|ADQ47637.1|  GAI-like protein 1                                      199   3e-57   
gb|ABU63411.1|  DELLA protein                                           201   4e-57   
ref|XP_001754090.1|  GAI1-like E3 ubiquitin ligase protein              200   7e-57   
ref|XP_002284952.1|  PREDICTED: DELLA protein SLR1-like                 200   7e-57   
gb|ADQ47608.1|  GAI-like protein 1                                      198   1e-56   
gb|ADQ47607.1|  GAI-like protein 1                                      197   1e-56   
ref|XP_010049952.1|  PREDICTED: DELLA protein GAI-like                  199   3e-56   
gb|KJB64828.1|  hypothetical protein B456_010G067000                    197   3e-56   
ref|XP_008809331.1|  PREDICTED: DELLA protein RHT-1-like                197   5e-56   
ref|XP_010916867.1|  PREDICTED: DELLA protein GAI-like                  198   6e-56   
emb|CBI28139.3|  unnamed protein product                                199   8e-56   
gb|ACV52015.1|  GAI/RGA-like 4-a                                        197   9e-56   
ref|XP_008463334.1|  PREDICTED: DELLA protein SLR1-like                 196   2e-55   
emb|CCG14223.1|  gibberellin DELLA protein                              196   3e-55   
ref|XP_004161044.1|  PREDICTED: DELLA protein GAI-like                  196   3e-55   
ref|XP_004146291.1|  PREDICTED: DELLA protein GAI-like                  195   3e-55   
dbj|BAQ20609.1|  GRAS-family protein 1                                  197   8e-55   
ref|XP_008777332.1|  PREDICTED: DELLA protein GAI-like                  194   9e-55   
ref|XP_004249633.2|  PREDICTED: DELLA protein GAI-like                  194   9e-55   
ref|XP_001774314.1|  AtGAI1 GRAS E3 ubiquitin ligase protein            194   1e-54   
ref|XP_006349517.1|  PREDICTED: DELLA protein GAI-like                  191   2e-54   
emb|CAN67929.1|  hypothetical protein VITISV_007904                     192   5e-54   
gb|ADO61620.1|  DELLA protein 2                                         179   3e-53   
gb|ADO61566.1|  DELLA protein 2                                         179   4e-53   
gb|ADO61532.1|  DELLA protein 2                                         179   4e-53   
gb|ABU63412.1|  DELLA protein                                           190   6e-53   
gb|ABL97904.1|  GAI-like protein 1                                      186   1e-52   
ref|XP_010688103.1|  PREDICTED: DELLA protein GAI1-like                 186   4e-52   
gb|ADO61535.1|  DELLA protein 2                                         176   8e-52   
ref|XP_008242703.1|  PREDICTED: LOW QUALITY PROTEIN: DELLA protei...    186   1e-51   
ref|XP_009407441.1|  PREDICTED: DELLA protein GAI-like                  186   2e-51   
emb|CDY64837.1|  BnaC09g52270D                                          185   3e-51   
gb|AAL10319.1|  DWARF8                                                  184   8e-51   
gb|AAL10303.1|  DWARF8                                                  184   1e-50   
gb|AAL10328.1|  DWARF8                                                  184   1e-50   
gb|AAL10382.1|  DWARF8                                                  184   1e-50   
gb|AAL10366.1|  DWARF8                                                  184   1e-50   
gb|AAL10379.1|  DWARF8                                                  184   1e-50   
gb|AAL10325.1|  DWARF8                                                  182   3e-50   
gb|AAL10361.1|  DWARF8                                                  182   5e-50   
gb|AAL10331.1|  DWARF8                                                  182   5e-50   
gb|AAL10304.1|  DWARF8                                                  182   5e-50   
gb|AAL10307.1|  DWARF8                                                  182   5e-50   
gb|AAL10302.1|  DWARF8                                                  182   6e-50   
gb|AAL10318.1|  DWARF8                                                  182   6e-50   
gb|AAL10348.1|  DWARF8                                                  182   7e-50   
gb|AAL10376.1|  DWARF8                                                  182   8e-50   
gb|AAL10335.1|  DWARF8                                                  181   1e-49   
gb|ABL97875.1|  GAI-like protein 1                                      179   1e-49   
emb|CDY04092.1|  BnaA09g18700D                                          180   2e-49   
gb|AAL10358.1|  DWARF8                                                  180   2e-49   
emb|CDM83536.1|  unnamed protein product                                178   7e-49   
gb|EMT30471.1|  hypothetical protein F775_03572                         166   2e-48   
dbj|BAQ20610.1|  GRAS-family protein 2                                  179   9e-48   



>ref|XP_009789076.1| PREDICTED: DELLA protein GAI1-like [Nicotiana sylvestris]
Length=587

 Score =   306 bits (783),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPG IEKVLS V+D+KPEI T+VEQEANHNGPVFMDRFTESLHYYSTLFDSLEG
Sbjct  418  LHQLLARPGGIEKVLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  477

Query  483  CAAS-EGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
            C +  E G V DQDK+MSEVYLGRQICN+V+CEGVDRVERHETLAQWRTRF SAGF  VH
Sbjct  478  CGSGGELGPVSDQDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVH  537

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            LG NA+KQASMLLALFAGG GY+VEEN+G L LGWHTRPLIATSAWKL+S
Sbjct  538  LGSNAFKQASMLLALFAGGGGYKVEENNGCLMLGWHTRPLIATSAWKLSS  587



>ref|XP_011070609.1| PREDICTED: DELLA protein GAI1 [Sesamum indicum]
Length=569

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 152/171 (89%), Gaps = 3/171 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGAIEKVL VV+++KPEI+TVVEQEANHNG VF+DRFTESLHYYSTLFDSLE 
Sbjct  399  LHQLLARPGAIEKVLKVVRELKPEILTVVEQEANHNGNVFLDRFTESLHYYSTLFDSLES  458

Query  483  CAASEGGA---VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
            C     G+   V DQDKVMSEVYLGRQICNVVACEG DRVERHETLAQWR+RF SAGF  
Sbjct  459  CGGGSNGSDGVVSDQDKVMSEVYLGRQICNVVACEGADRVERHETLAQWRSRFGSAGFVP  518

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            VHLG NAYKQASMLLALFAGGDGYRV+EN+G L LGWHTRPLIATSAWKL+
Sbjct  519  VHLGSNAYKQASMLLALFAGGDGYRVDENNGCLMLGWHTRPLIATSAWKLS  569



>gb|AFN25699.1| RGA-1, partial [Pyrus pyrifolia]
Length=171

 Score =   284 bits (727),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 144/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  4    LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  63

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHE L QWR RF SA F  VHL
Sbjct  64   SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHEKLTQWRARFGSADFVPVHL  116

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  117  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  162



>emb|CDP00805.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   292 bits (748),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 142/168 (85%), Positives = 153/168 (91%), Gaps = 3/168 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLL+RPGAIEKVLS V+++KPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  241  LHQLLSRPGAIEKVLSAVKELKPEILTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  300

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C +       + DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF SAGF AVHL
Sbjct  301  CGSG---GGGNGDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFGSAGFEAVHL  357

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL+
Sbjct  358  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWKLS  405



>ref|XP_007225630.1| hypothetical protein PRUPE_ppa005944mg [Prunus persica]
 gb|EMJ26829.1| hypothetical protein PRUPE_ppa005944mg [Prunus persica]
Length=436

 Score =   289 bits (739),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 145/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  269  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  328

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK MSE+YLG+QICNVVACEGVDRVERHETL QWRTR  S GF  VHL
Sbjct  329  -------SVNSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSGGFVPVHL  381

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  382  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWK  427



>gb|AEX97109.1| spur-type DELLA protein [Malus domestica]
Length=635

 Score =   294 bits (753),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 148/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  468  LHKLLARPGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  527

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHL
Sbjct  528  SANS-------QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHL  580

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK +S
Sbjct  581  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKPSS  629



>gb|KDP38079.1| hypothetical protein JCGZ_04722 [Jatropha curcas]
Length=623

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 151/169 (89%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  461  LHKLLARPGAIEKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  520

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A++       QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTR  S+GF  VHL
Sbjct  521  SAST-------QDKVMSEVYLGKQICNVVACEGADRVERHETLTQWRTRLGSSGFVPVHL  573

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G LTLGWHTRPLIATSAW++ +
Sbjct  574  GSNAFKQASMLLALFAGGDGYRVEENNGCLTLGWHTRPLIATSAWRVVN  622



>ref|XP_002312450.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
 gb|EEE89817.2| hypothetical protein POPTR_0008s13090g [Populus trichocarpa]
Length=600

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 150/169 (89%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVLSVV+ MKPEIVTVVEQEANHNGP+F+DRFTESLHYYSTLFDSLEG
Sbjct  431  LHKLLSRPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPIFLDRFTESLHYYSTLFDSLEG  490

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK+MSEVYLG+QICNVVACEG DRVERHETL QWRTR  SAGF+ VHL
Sbjct  491  -------SVSTQDKIMSEVYLGKQICNVVACEGPDRVERHETLTQWRTRLGSAGFAPVHL  543

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  544  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRLNT  592



>gb|ACL68359.1| DELLA protein [Malus baccata var. xiaojinensis]
Length=636

 Score =   293 bits (751),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 148/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  469  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  528

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  529  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  581

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK +S
Sbjct  582  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWKPSS  630



>gb|ADH53778.1| GAI2 [Malus domestica]
Length=636

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 148/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  469  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  528

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  529  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  581

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK +S
Sbjct  582  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWKPSS  630



>ref|XP_010264458.1| PREDICTED: DELLA protein GAI1 [Nelumbo nucifera]
Length=610

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 151/169 (89%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLS +++MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  435  LHRLLARPGAIEKVLSSIKEMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  494

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            CA S   +   QD+VMSE+YLGRQICNVVACEGVDRVERHE L QWR R  S+GFS VHL
Sbjct  495  CAMSPPNS---QDQVMSELYLGRQICNVVACEGVDRVERHEALTQWRNRLGSSGFSPVHL  551

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  552  GFNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAS  600



>gb|AAY56752.1| DELLA protein [Malus domestica]
Length=635

 Score =   292 bits (748),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  468  LHKLLARPGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  527

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHL
Sbjct  528  SANS-------QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHL  580

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  581  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  626



>gb|AHB17744.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/171 (80%), Positives = 150/171 (88%), Gaps = 3/171 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G IEKVLS V++MKPEIVTVVEQE NHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  380  LHKLLARTGGIEKVLSAVKEMKPEIVTVVEQEVNHNGPVFLDRFTEALHYYSTLFDSLEG  439

Query  483  CAASEG---GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
            C   E     AV +QDKVM+E+YLGRQICNVVAC+G DRVERHETLAQWR+RF S+GF  
Sbjct  440  CGGGESPSPSAVSNQDKVMTEMYLGRQICNVVACDGPDRVERHETLAQWRSRFASSGFEP  499

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            VHLG NA+KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  500  VHLGSNAFKQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  550



>ref|XP_004298516.1| PREDICTED: DELLA protein GAIP [Fragaria vesca subsp. vesca]
Length=611

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 149/167 (89%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVF++RF ESLHYYSTLFDSLEG
Sbjct  444  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFLNRFNESLHYYSTLFDSLEG  503

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK+MSEVYLG+QI NVVACEGV+RVERHETLAQWRTRF  +GF+ VHL
Sbjct  504  -------SVNSQDKMMSEVYLGKQIFNVVACEGVERVERHETLAQWRTRFDKSGFTPVHL  556

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  557  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL  603



>gb|ADW85805.1| DELLA protein [Malus domestica]
Length=635

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  468  LHKLLARPGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  527

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHL
Sbjct  528  SANS-------QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHL  580

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  581  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  626



>ref|XP_008221422.1| PREDICTED: DELLA protein GAIP-B [Prunus mume]
Length=633

 Score =   292 bits (747),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  466  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  525

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK MSE+YLG+QICNVVACEGVDRVERHETL QWRTR  SAGF  VHL
Sbjct  526  -------SVNSQDKAMSELYLGKQICNVVACEGVDRVERHETLTQWRTRLDSAGFVPVHL  578

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  579  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWK  624



>gb|AAY56751.1| DELLA protein [Malus domestica]
Length=639

 Score =   291 bits (746),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  469  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  528

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  529  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  581

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  582  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  627



>gb|ABL61270.1| GAI1 [Malus hupehensis]
Length=638

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  468  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  527

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  528  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  580

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  581  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  626



>gb|ACL68360.1| DELLA protein [Malus domestica]
Length=636

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 146/166 (88%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  469  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  528

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  529  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  581

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  582  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  627



>gb|AGK07287.1| GAI1 [Rosa hybrid cultivar]
Length=618

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/167 (83%), Positives = 149/167 (89%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRF ESLHYYSTLFDSLEG
Sbjct  451  LHKLLARPGAIDKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFNESLHYYSTLFDSLEG  510

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK+MSEVYLG+QI NVVACEG DRVERHETLAQWRTRF ++GF+ VHL
Sbjct  511  -------SVNSQDKMMSEVYLGKQIFNVVACEGPDRVERHETLAQWRTRFDASGFAPVHL  563

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  564  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL  610



>ref|XP_002527794.1| DELLA protein GAIP-B, putative [Ricinus communis]
 gb|EEF34604.1| DELLA protein GAIP-B, putative [Ricinus communis]
Length=609

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 149/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  441  LHKLLARPGAIDKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  500

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTR   AGF+ VHL
Sbjct  501  -------SVSTQDKVMSEVYLGKQICNVVACEGADRVERHETLTQWRTRLGLAGFAPVHL  553

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRV+EN+G L LGWHTRPLIATSAW+L S
Sbjct  554  GSNAFKQASMLLALFAGGDGYRVDENNGCLMLGWHTRPLIATSAWRLAS  602



>ref|XP_011023720.1| PREDICTED: DELLA protein GAIP-B-like [Populus euphratica]
Length=602

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 149/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVLSVV+ MKPEIVTVVEQEANHNGP+F+DRFTESLHYYSTLFDSLEG
Sbjct  433  LHKLLSRPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPIFLDRFTESLHYYSTLFDSLEG  492

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDK+MSE YLG+QICNVVACEG DRVERHETL QWRTR  SAGF+ VHL
Sbjct  493  -------SVSTQDKMMSEEYLGKQICNVVACEGPDRVERHETLTQWRTRLGSAGFAPVHL  545

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  546  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRLNT  594



>ref|XP_009351505.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 145/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  467  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  526

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHL
Sbjct  527  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHL  579

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  580  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>ref|XP_009603475.1| PREDICTED: DELLA protein GAI1-like [Nicotiana tomentosiformis]
Length=563

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 150/170 (88%), Gaps = 1/170 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPG IEKVLS V+D+KPEI T+VEQEANHNGPVFMDRFTESLHYYSTLFDSLEG
Sbjct  394  LHQLLARPGGIEKVLSFVKDLKPEIFTIVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  453

Query  483  CAASEGG-AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
            C        V DQDK+MSEVYLGRQICN+V+CEGVDRVERHETLAQWRTRF SAGF  V 
Sbjct  454  CGGGGELGPVSDQDKLMSEVYLGRQICNLVSCEGVDRVERHETLAQWRTRFNSAGFEPVL  513

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            LG NA+KQASMLLALFAGG GYRVEEN+G L LGWHTRPLIATSAWKL+S
Sbjct  514  LGSNAFKQASMLLALFAGGGGYRVEENNGCLMLGWHTRPLIATSAWKLSS  563



>ref|XP_009349514.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=634

 Score =   290 bits (741),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/166 (84%), Positives = 145/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  467  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  526

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHL
Sbjct  527  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHL  579

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  580  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>gb|AHB17742.1| GA repressor DELLA [Actinidia deliciosa]
Length=551

 Score =   287 bits (735),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 4/172 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+R G IEKVLS V++MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  380  LHKLLSRTGGIEKVLSAVKEMKPQIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  439

Query  483  CAASEG----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
            C    G     AV +QDK M+E+YLGRQICNVVAC+G DRVERHETL+QWRTRF S+GF 
Sbjct  440  CGGGSGLPSPSAVSNQDKAMTEMYLGRQICNVVACDGPDRVERHETLSQWRTRFGSSGFE  499

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
             VHLG NA+KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  500  PVHLGSNAFKQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  551



>gb|ADA84480.1| GRAS [Antirrhinum majus]
Length=528

 Score =   286 bits (733),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 146/167 (87%), Gaps = 1/167 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLAR GAIEKVL VV+++KPEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLE 
Sbjct  360  LHQLLARGGAIEKVLGVVRELKPEILTVVEQEANHNGVAFLDRFTESLHYYSTLFDSLES  419

Query  483  CAASEGGAV-CDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
            C     G V  DQDKVMSEVYLGRQICNVVACEGVDRVERHE+L QWRTRF  AGF  VH
Sbjct  420  CGGGVEGGVVSDQDKVMSEVYLGRQICNVVACEGVDRVERHESLVQWRTRFNGAGFKPVH  479

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            LG NAYKQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+
Sbjct  480  LGSNAYKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWR  526



>gb|EPS61323.1| hypothetical protein M569_13471, partial [Genlisea aurea]
Length=549

 Score =   286 bits (732),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGA+E+V+ +V+ +KPEI+TVVEQEANHNG  F+DRFTE+LHYYSTLFDSLE 
Sbjct  383  LHQLLARPGAVERVMDLVRGLKPEILTVVEQEANHNGSFFLDRFTEALHYYSTLFDSLES  442

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C     GAV  +DK+MSEVYLGRQICNVVACEG DRVERHETLAQWR+RF S+GF  VHL
Sbjct  443  CCGGSDGAVSGEDKLMSEVYLGRQICNVVACEGADRVERHETLAQWRSRFSSSGFKPVHL  502

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G N YKQA +LLA+FAGGDGYRVEEN G LTLGWHTRPLIATSAWKL
Sbjct  503  GSNVYKQAILLLAVFAGGDGYRVEENKGCLTLGWHTRPLIATSAWKL  549



>gb|AFJ23219.1| DELLA protein [Pyrus betulifolia]
Length=634

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 144/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF E LHYYSTLFDSLEG
Sbjct  467  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNEPLHYYSTLFDSLEG  526

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETL QWR RF SA F  VHL
Sbjct  527  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLTQWRARFGSADFVPVHL  579

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  580  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>gb|EYU30084.1| hypothetical protein MIMGU_mgv1a027121mg [Erythranthe guttata]
Length=588

 Score =   287 bits (734),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/168 (83%), Positives = 148/168 (88%), Gaps = 6/168 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQL+ARPGA+EKVL VV+++KPEI+TVVEQEANHNG VF+DRFTESLHYYSTLFDSLE 
Sbjct  427  LHQLMARPGAVEKVLQVVRELKPEILTVVEQEANHNGAVFLDRFTESLHYYSTLFDSLEK  486

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   AV  QDKVM+EVYLGRQICNVVACEGVDRVERHETLAQWRTRF SAGF  VHL
Sbjct  487  ------EAVSVQDKVMTEVYLGRQICNVVACEGVDRVERHETLAQWRTRFDSAGFVPVHL  540

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLALFAGGDGY VEEN G L LGWHTRPLIATSAWKL+
Sbjct  541  GSNAYKQASMLLALFAGGDGYMVEENGGCLMLGWHTRPLIATSAWKLS  588



>gb|AFJ23220.1| DELLA protein [Pyrus x bretschneideri]
Length=634

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 144/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  467  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  526

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHE L QWR RF SA F  VHL
Sbjct  527  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHEKLTQWRARFGSADFVPVHL  579

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSAWK
Sbjct  580  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSAWK  625



>gb|AEK06229.1| GAI1 [Vitis vinifera]
Length=590

 Score =   286 bits (733),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG IE+VLS V+DMKP+IVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  413  LHSLLARPGGIERVLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  472

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S    V  QDK+MSEVYLG+QICNVVACEG +RVERHETLAQWR R  SAGF  V+L
Sbjct  473  CGVS---PVNTQDKLMSEVYLGQQICNVVACEGPERVERHETLAQWRARLGSAGFDPVNL  529

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  530  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAN  578



>ref|XP_002284648.1| PREDICTED: DELLA protein GAI1 [Vitis vinifera]
 sp|Q8S4W7.1|GAI1_VITVI RecName: Full=DELLA protein GAI1; AltName: Full=Gibberellic acid-insensitive 
mutant protein 1; AltName: Full=VvGAI1 [Vitis 
vinifera]
 gb|AAM19210.1|AF378125_1 GAI-like protein 1 [Vitis vinifera]
Length=590

 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG IE+VLS V+DMKP+IVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  413  LHSLLARPGGIERVLSAVKDMKPDIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  472

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S    V  QDK+MSEVYLG+QICNVVACEG +RVERHETLAQWR R  SAGF  V+L
Sbjct  473  CGVS---PVNTQDKLMSEVYLGQQICNVVACEGPERVERHETLAQWRARLGSAGFDPVNL  529

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  530  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAN  578



>dbj|BAG71200.1| DELLA 1 [Lactuca sativa]
Length=569

 Score =   285 bits (730),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 149/174 (86%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGA+EKVLS V++MKPEI+TVVEQEANHNGPVF++RFTESLHYYSTLFDSLE 
Sbjct  395  LHQLLARPGAVEKVLSAVKEMKPEILTVVEQEANHNGPVFLERFTESLHYYSTLFDSLES  454

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
                 G        A  +QDK+MSEVYLG+QICNVVACEG DRVERH+TL+QW+TRF+S 
Sbjct  455  SGNGGGVVEGGGIPAASNQDKIMSEVYLGKQICNVVACEGPDRVERHQTLSQWKTRFESG  514

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF  VHLG NAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  515  GFEVVHLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  568



>ref|XP_007045197.1| GRAS family transcription factor family protein [Theobroma cacao]
 gb|EOY01029.1| GRAS family transcription factor family protein [Theobroma cacao]
Length=615

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 149/169 (88%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KVLSVV+ MKPEIVT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  447  LHKLLARPGAIDKVLSVVKQMKPEIVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  506

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYLG+QICNVVACEGVDRVERHE LA WR R  +AGF++VHL
Sbjct  507  -------SVSSQDKVMSEVYLGKQICNVVACEGVDRVERHEKLAHWRNRLGTAGFASVHL  559

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGY VEEN+G L LGWH+RPLIATSAWKL +
Sbjct  560  GSNAFKQASMLLALFAGGDGYGVEENNGCLMLGWHSRPLIATSAWKLAN  608



>ref|XP_010274729.1| PREDICTED: DELLA protein GAI1-like [Nelumbo nucifera]
Length=602

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 150/169 (89%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLS +++MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  434  LHRLLARPGAIEKVLSSIKEMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  493

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S   +   QD+VMS VYLG+QICNVVACEGV+RVERHETL QWR R  S+GF+ VHL
Sbjct  494  CGMSPPNS---QDQVMSGVYLGQQICNVVACEGVERVERHETLTQWRNRLASSGFAPVHL  550

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  551  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  599



>gb|ADH53781.1| GAI2 [Malus baccata var. xiaojinensis]
Length=570

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  414  LHKLLARPGAIEKVLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  473

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       QDKVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHL
Sbjct  474  SANS-------QDKVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHL  526

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  172
            G NA+KQA MLLALFAGGDGYRVEENDG L LGWHTRPLIATSA
Sbjct  527  GSNAFKQAGMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSA  570



>gb|ADH53779.1| GAI1 [Malus domestica]
Length=570

 Score =   284 bits (727),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/164 (84%), Positives = 143/164 (87%), Gaps = 7/164 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG IEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  414  LHKLLARPGVIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  473

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  474  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  526

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  172
            G NA+KQASMLLALFAGGDGYRVEENDG + L WHTRPLIATSA
Sbjct  527  GSNAFKQASMLLALFAGGDGYRVEENDGCMMLAWHTRPLIATSA  570



>ref|XP_002314799.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
 gb|EEF00970.2| hypothetical protein POPTR_0010s12080g [Populus trichocarpa]
Length=602

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 152/182 (84%), Gaps = 13/182 (7%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLA PGA++KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  433  FHKLLAIPGAMKKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  492

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHL
Sbjct  493  -------SVSTQDKVMSEVYLAKQICNVVACEGSSRVERHETLTQWRTRLSSAGFAPVHL  545

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIG  124
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW++      ++H  +G
Sbjct  546  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRV------NNHHPVG  599

Query  123  GS  118
            G+
Sbjct  600  GA  601



>gb|ABG26370.1| DELLA protein GAI [Gossypium barbadense]
Length=616

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 147/169 (87%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLH+YSTLFDSLEG
Sbjct  448  LHKLLARPGAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHFYSTLFDSLEG  507

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYLG+QICNVVACEGVDR+ERHE+L QWR R  +AGFS VHL
Sbjct  508  -------SVSSQDKVMSEVYLGKQICNVVACEGVDRIERHESLTQWRNRLSTAGFSPVHL  560

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT+
Sbjct  561  GSNAFKQASMLLALFAGGDGYGVEENNGCLMLGWHNRPLITTSAWKLTN  609



>gb|ABI34432.1| CRY [Pisum sativum]
Length=532

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 144/169 (85%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+L ARPGA+EKV SV++ ++PEIVTVVEQEANHNGP F+DRFTESLHYYSTLFDSLE 
Sbjct  363  LHKLNARPGALEKVFSVIRQIRPEIVTVVEQEANHNGPAFLDRFTESLHYYSTLFDSLES  422

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR RF SAGFS VHL
Sbjct  423  SL------VEPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRNRFGSAGFSPVHL  476

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGY+VEENDG L LGWHTRPLIATSAWKL +
Sbjct  477  GSNAFKQASMLLALFAGGDGYKVEENDGCLMLGWHTRPLIATSAWKLAA  525



>gb|ACM47244.1| putative gibberellin signaling DELLA protein [Sinningia speciosa]
Length=562

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 143/166 (86%), Gaps = 2/166 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGAI+KVL+VV+ MKPEI T++EQEANHNG VF+DRF ESLHYYSTLFDSLE 
Sbjct  397  LHQLLARPGAIDKVLNVVRQMKPEIFTMIEQEANHNGAVFLDRFNESLHYYSTLFDSLES  456

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C     G V DQDKVMSEVYLGRQICNVVA EGVDRVERHETLAQWRTRF S+GF  VHL
Sbjct  457  CGGD--GVVSDQDKVMSEVYLGRQICNVVASEGVDRVERHETLAQWRTRFGSSGFQPVHL  514

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NAYKQAS LL LFAGGD YRVEEN+G L LGW TRPLIATSAWK
Sbjct  515  GSNAYKQASTLLVLFAGGDEYRVEENNGCLMLGWRTRPLIATSAWK  560



>emb|CAN59753.1| hypothetical protein VITISV_036639 [Vitis vinifera]
Length=580

 Score =   283 bits (724),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  399  LHRLLARPGAIEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSNLFDSLEG  458

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S   +   QD +MSE+YLGRQICNVVACEG +RVERHETL+QWR+R  SAGF  VHL
Sbjct  459  CGVSPPSS---QDLMMSEIYLGRQICNVVACEGAERVERHETLSQWRSRMGSAGFDPVHL  515

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  516  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLNS  564



>ref|XP_004504565.1| PREDICTED: DELLA protein GAI1-like [Cicer arietinum]
Length=537

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 146/169 (86%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+L ARPGA+EKV SV++ ++PEIVTVVEQEANHNGP F+DRFTESLHYYSTLFDSLEG
Sbjct  368  LHKLNARPGALEKVFSVIRQIRPEIVTVVEQEANHNGPAFLDRFTESLHYYSTLFDSLEG  427

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +      V  Q+K MSE+YLG+QICNVVACEG DRVERHETL QWR RF SAGFS VHL
Sbjct  428  SS------VEQQEKAMSEMYLGKQICNVVACEGTDRVERHETLNQWRNRFGSAGFSPVHL  481

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGY+VEENDG L LGWHTRPLIATSAWKL +
Sbjct  482  GSNAFKQASMLLALFAGGDGYKVEENDGCLMLGWHTRPLIATSAWKLAA  530



>gb|KJB15415.1| hypothetical protein B456_002G177000 [Gossypium raimondii]
Length=617

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 145/168 (86%), Gaps = 7/168 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARP AI+KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  449  LHKLLARPAAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  508

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYLG+QICNVVACEGVDR+ERHE+L QWR R  +AGFS VHL
Sbjct  509  -------SVSSQDKVMSEVYLGKQICNVVACEGVDRIERHESLTQWRNRLSTAGFSPVHL  561

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NA+KQASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT
Sbjct  562  GSNAFKQASMLLALFAGGDGYGVEENNGCLMLGWHNRPLITTSAWKLT  609



>gb|AFP58844.1| DELLA domain GRAS family transcription factor GAI [Populus tomentosa]
Length=603

 Score =   283 bits (724),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 152/182 (84%), Gaps = 13/182 (7%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLA PG ++KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  434  FHKLLAIPGDMKKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  493

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A++       QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHL
Sbjct  494  SAST-------QDKVMSEVYLAKQICNVVACEGPSRVERHETLTQWRTRLSSAGFAPVHL  546

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIG  124
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW++      ++H  +G
Sbjct  547  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWRV------NNHHPVG  600

Query  123  GS  118
            G+
Sbjct  601  GA  602



>ref|XP_008467128.1| PREDICTED: DELLA protein GAIP-B [Cucumis melo]
Length=586

 Score =   283 bits (723),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 145/167 (87%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  419  LHKLLARPGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                      +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HL
Sbjct  479  SP-------NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHL  531

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWKL
Sbjct  532  GSNAFKQASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKL  578



>ref|XP_002266267.1| PREDICTED: DELLA protein GAI-like [Vitis vinifera]
Length=613

 Score =   283 bits (725),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 148/169 (88%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  432  LHRLLARPGAIEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSNLFDSLEG  491

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S   +   QD +MSE+YLGRQICNVVACEG +RVERHETL+QWR+R  SAGF  VHL
Sbjct  492  CGVSPPSS---QDLMMSEIYLGRQICNVVACEGAERVERHETLSQWRSRMGSAGFDPVHL  548

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  549  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLNS  597



>ref|XP_004166672.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAIP-B-like [Cucumis 
sativus]
Length=586

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  419  LHKLLARPGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                      +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HL
Sbjct  479  SP-------NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHL  531

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK+
Sbjct  532  GSNAFKQASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKI  578



>ref|XP_004150593.1| PREDICTED: DELLA protein GAIP-B-like [Cucumis sativus]
 emb|CBX88046.1| gibberellin DELLA protein, partial [Cucumis sativus]
 gb|KGN51488.1| DELLA protein GAIP-B [Cucumis sativus]
Length=586

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 145/167 (87%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVLSVV+ MKPEI+TVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  419  LHKLLARPGALEKVLSVVKQMKPEIMTVVEQEANHNGPVFVDRFTESLHYYSTLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                      +QDK+MSE+YLG+QICNVVACEG DRVERHETL QW+TR  SAGF  +HL
Sbjct  479  SP-------NNQDKIMSEMYLGKQICNVVACEGADRVERHETLTQWQTRLSSAGFEPIHL  531

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK+
Sbjct  532  GSNAFKQASMLLALFGSGEGYRVEENNGSLMLGWHTRPLIATSAWKI  578



>ref|XP_011038614.1| PREDICTED: DELLA protein GAIP [Populus euphratica]
Length=602

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 150/182 (82%), Gaps = 13/182 (7%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLA PGA+ KVLSVV+ MKPEIVTVVEQEANHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  433  FHKLLAIPGAMRKVLSVVKQMKPEIVTVVEQEANHNGPVFLDRFTESLHYYSTLFDSLEG  492

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYL +QICNVVACEG  RVERHETL QWRTR  SAGF+ VHL
Sbjct  493  -------SVSTQDKVMSEVYLAKQICNVVACEGPSRVERHETLTQWRTRLGSAGFAPVHL  545

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIG  124
            G NA+KQASMLLALFAGGDGYRVEEN G L LGWHTRPLIATSAW++      ++H  +G
Sbjct  546  GSNAFKQASMLLALFAGGDGYRVEENSGCLMLGWHTRPLIATSAWRV------NNHHPVG  599

Query  123  GS  118
            G+
Sbjct  600  GA  601



>gb|ADH53780.1| GAI1 [Malus domestica]
Length=570

 Score =   281 bits (719),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 142/164 (87%), Gaps = 7/164 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG
Sbjct  414  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEG  473

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       +DKVMSEVYLG+QICNVVACEGVDRVERHETLAQWR RF SA F  VHL
Sbjct  474  SANS-------RDKVMSEVYLGKQICNVVACEGVDRVERHETLAQWRARFGSADFVPVHL  526

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSA  172
            G NA+KQASMLLALFAGGDGYRVE NDG + L WHTRPLI TSA
Sbjct  527  GSNAFKQASMLLALFAGGDGYRVEGNDGCMMLAWHTRPLIVTSA  570



>ref|XP_010066602.1| PREDICTED: DELLA protein GAIP-B-like [Eucalyptus grandis]
 gb|KCW64558.1| hypothetical protein EUGRSUZ_G02163 [Eucalyptus grandis]
Length=634

 Score =   283 bits (723),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 144/167 (86%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVL VV+ ++P IVTVVEQEANHNGPVF+DRF ESLHYYSTLFDSLEG
Sbjct  466  LHKLLARPGAIEKVLGVVRQVRPAIVTVVEQEANHNGPVFVDRFNESLHYYSTLFDSLEG  525

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            CA++       QDK MSEVYLG+QICNVVACEG DRVERHETLAQWR R   AGF   HL
Sbjct  526  CAST-------QDKAMSEVYLGKQICNVVACEGADRVERHETLAQWRARLGGAGFVPAHL  578

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEEN G LTLGWHTRPLIATSAW+L
Sbjct  579  GSNAFKQASMLLALFAGGDGYRVEENGGCLTLGWHTRPLIATSAWRL  625



>gb|AAY28970.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=548

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 144/167 (86%), Gaps = 4/167 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG IEKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  372  LHPLLARPGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  431

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AGFS VHL
Sbjct  432  S----GVAPPSQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGFSPVHL  487

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NAYKQASMLLALFA GDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  488  GSNAYKQASMLLALFASGDGYRVEENNGCLMLGWHTRPLIATSAWRL  534



>gb|KJB08563.1| hypothetical protein B456_001G089400 [Gossypium raimondii]
Length=548

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 144/167 (86%), Gaps = 4/167 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG IEKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  372  LHPLLARPGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  431

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AGFS VHL
Sbjct  432  S----GVAPPSQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGFSPVHL  487

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NAYKQASMLLALFA GDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  488  GSNAYKQASMLLALFASGDGYRVEENNGCLMLGWHTRPLIATSAWRL  534



>gb|AEE69074.2| GAI-like protein [Juglans regia]
Length=613

 Score =   281 bits (719),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 146/167 (87%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR GAIEKV SVV+ MKP+IVTVVEQEANHNGPVF+DRFTESLHYYST+FDSLEG
Sbjct  446  LHKLLARSGAIEKVFSVVKQMKPDIVTVVEQEANHNGPVFLDRFTESLHYYSTMFDSLEG  505

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V +QDKVMSEVYLG+QICNVV+CEGVDRVERHET  QWR R  SAGF  VHL
Sbjct  506  -------SVSNQDKVMSEVYLGKQICNVVSCEGVDRVERHETSVQWRARLGSAGFEPVHL  558

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  559  GSNAFKQASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  605



>gb|AFN25702.1| RGL2-2, partial [Pyrus pyrifolia]
Length=158

 Score =   266 bits (680),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 135/156 (87%), Gaps = 7/156 (4%)
 Frame = -3

Query  624  VLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEGGAVCDQD  445
            VLSVV+ MKPEI+TVVEQEANHNGPVFMDRF ESLHYYSTLFDSLEG A S       QD
Sbjct  1    VLSVVKQMKPEILTVVEQEANHNGPVFMDRFNESLHYYSTLFDSLEGSANS-------QD  53

Query  444  KVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHLGXNAYKQASMLLA  265
            KVMSEVYLG+QICNVVACEG+DRVERHETL QWR RF SA F  VHLG NA+KQASMLLA
Sbjct  54   KVMSEVYLGKQICNVVACEGLDRVERHETLTQWRARFDSADFVPVHLGSNAFKQASMLLA  113

Query  264  LFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            LFAGGDGYRVEENDG L LGWHTRPLIATSAWK +S
Sbjct  114  LFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKASS  149



>ref|XP_006384166.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|ERP61963.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=431

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG I+KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  262  LHRLLGRPGGIDKVLESIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  321

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHL
Sbjct  322  ----SGLTPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHL  377

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  378  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  426



>ref|XP_006307228.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
 gb|EOA40126.1| hypothetical protein CARUB_v10008833mg [Capsella rubella]
Length=528

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 144/169 (85%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAIEKVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG
Sbjct  366  LHKLLGRPGAIEKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEG  425

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL QWR RF SAGFSA HL
Sbjct  426  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLRQWRNRFGSAGFSAAHL  478

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  479  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  527



>sp|Q6EI06.1|GAIP_CUCMA RecName: Full=DELLA protein GAIP; AltName: Full=CmGAIP; Short=GAIP; 
AltName: Full=Gibberellic acid-insensitive phloem protein 
[Cucurbita maxima]
 gb|AAQ96164.1| gibberellic acid insensitive phloem [Cucurbita maxima]
Length=579

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 145/166 (87%), Gaps = 7/166 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNGPVF++RFTESLHYYSTLFDSLE 
Sbjct  412  LHQLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGPVFVERFTESLHYYSTLFDSLE-  470

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C+ +       QDK+MSE+YLG+QICNVVACEG DRVERHETL QWRTR  SAGF  +HL
Sbjct  471  CSPN------SQDKMMSEMYLGKQICNVVACEGADRVERHETLTQWRTRLSSAGFDPIHL  524

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NA+KQAS+LLALF  G+GYRVEEN+G L LGWHTRPLIATSAWK
Sbjct  525  GSNAFKQASILLALFGSGEGYRVEENEGSLMLGWHTRPLIATSAWK  570



>ref|XP_010527787.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/167 (80%), Positives = 144/167 (86%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR GA+EKVL VV+ MKPEI TVVEQE+NHN P F+DRF+ESLHYYSTLFDSLEG
Sbjct  442  LHKLLARDGAMEKVLGVVKQMKPEIFTVVEQESNHNSPAFLDRFSESLHYYSTLFDSLEG  501

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V  QDKVMSEVYLG+QICNVVACEG DRVERHETLAQWR+RF SAGFS VHL
Sbjct  502  V-------VNSQDKVMSEVYLGKQICNVVACEGPDRVERHETLAQWRSRFGSAGFSPVHL  554

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF GG+GYRVEENDG L LGWHTRPLIATSAWKL
Sbjct  555  GSNAFKQASMLLALFNGGEGYRVEENDGCLMLGWHTRPLIATSAWKL  601



>gb|ACR58455.1| GAI/RGA protein [Gossypium hirsutum]
Length=616

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 146/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KV SVV+ MKPE+VT+VEQEANHNGPVF+DRFTESLH+YSTLFDSLEG
Sbjct  448  LHKLLARPGAIDKVFSVVKQMKPELVTIVEQEANHNGPVFLDRFTESLHFYSTLFDSLEG  507

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                   +V  QDKVMSEVYLG+QICNVVACEGVDR+E HE+L QWR R  +AGFS VHL
Sbjct  508  -------SVSSQDKVMSEVYLGKQICNVVACEGVDRIEGHESLTQWRNRLSTAGFSPVHL  560

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGY VEEN+G L LGWH RPLI TSAWKLT+
Sbjct  561  GSNAFKQASMLLALFAGGDGYGVEENNGCLMLGWHNRPLIITSAWKLTN  609



>ref|XP_008362563.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI-like [Malus 
domestica]
Length=392

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+ LARPGA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  227  LHRXLARPGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  286

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNV+ACE  DRVERHETL+QWR+R  SAGF  VHL
Sbjct  287  SSGPS------QDLVMSEVYLGRQICNVMACEXGDRVERHETLSQWRSRMDSAGFDPVHL  340

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  341  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  389



>ref|XP_006383329.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
 gb|ERP61126.1| hypothetical protein POPTR_0005s14540g [Populus trichocarpa]
Length=619

 Score =   280 bits (715),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG I+KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  438  LHRLLDRPGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  497

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD VMSE+YLGRQICNVVACEG DRVERHETLAQWRTRF SAGF  VHL
Sbjct  498  S----GVTPTSQDLVMSELYLGRQICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHL  553

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  554  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>ref|XP_010496659.1| PREDICTED: DELLA protein GAI [Camelina sativa]
Length=531

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG
Sbjct  369  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEG  428

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HL
Sbjct  429  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHL  481

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  482  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  530



>ref|XP_006416958.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
 dbj|BAJ34426.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35311.1| hypothetical protein EUTSA_v10007323mg [Eutrema salsugineum]
Length=535

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAIEKVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYS+LFDSLEG
Sbjct  368  LHKLLGRPGAIEKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSSLFDSLEG  427

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA H+
Sbjct  428  VPSS-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHI  480

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF  G+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  481  GSNAFKQASMLLALFNSGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  529



>gb|AEX97111.1| spur-type DELLA protein [Malus domestica]
Length=584

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  419  LHRLLARPGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHL
Sbjct  479  SSGPS------QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHL  532

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  533  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>gb|AAY56750.1| DELLA protein [Malus domestica]
Length=584

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  419  LHRLLARPGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHL
Sbjct  479  SSGPS------QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHL  532

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  533  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_008343058.1| PREDICTED: DELLA protein GAI-like [Malus domestica]
Length=584

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  419  LHRLLARPGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHL
Sbjct  479  SSGPS------QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHL  532

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  533  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_009334448.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=584

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  419  LHRLLARPGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNV+ACEG DRVERHETL+QWR R  SAGF  VHL
Sbjct  479  SSGPS------QDLVMSEVYLGRQICNVMACEGGDRVERHETLSQWRGRMDSAGFDPVHL  532

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  533  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  581



>ref|XP_010459010.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=535

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG
Sbjct  373  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEG  432

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 GG    QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HL
Sbjct  433  VP---GG----QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHL  485

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL +
Sbjct  486  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLAT  534



>sp|Q6EI05.1|GAIPB_CUCMA RecName: Full=DELLA protein GAIP-B; AltName: Full=CmGAIP-B; Short=GAIP-B; 
AltName: Full=Gibberellic acid-insensitive phloem 
protein B [Cucurbita maxima]
 gb|AAQ96165.1| gibberellic acid insensitive phloem B [Cucurbita maxima]
Length=587

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 143/167 (86%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKV+SVV+ MKPEI+TVVEQEANHNGPVFMDRFTESLHYYSTLFDSLE 
Sbjct  419  LHKLLARPGAIEKVMSVVKQMKPEIMTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLES  478

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                      +QDK+MSE+YLG+QICNVVACEG DRVE HETL QWRTR  S+GF  +HL
Sbjct  479  SPN-------NQDKMMSEMYLGKQICNVVACEGSDRVEWHETLTQWRTRLCSSGFEPIHL  531

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF  G+GYRVEEN+G LTLGWHTRPLI TSAWKL
Sbjct  532  GSNAFKQASMLLALFGSGEGYRVEENNGSLTLGWHTRPLIVTSAWKL  578



>gb|AHB17743.1| GA repressor DELLA [Actinidia deliciosa]
Length=550

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G IEKVLS V++MKPEIVTVVEQE NHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  380  LHKLLARTGGIEKVLSAVKEMKPEIVTVVEQEVNHNGPVFLDRFTEALHYYSTLFDSLEG  439

Query  483  CAASEGG---AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
            C         AV +QDKVM+E+YLGRQICNVVAC+G DRVERHETLAQWR RF SAGF  
Sbjct  440  CGGGGSPSPSAVSNQDKVMTEMYLGRQICNVVACDGPDRVERHETLAQWRNRFASAGFEP  499

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            V LG NA+KQASMLLALF GGDGY+VEEN G LTLGWHTRPLIATSAWKL+
Sbjct  500  VPLGSNAFKQASMLLALFNGGDGYKVEENGGCLTLGWHTRPLIATSAWKLS  550



>gb|EYU33133.1| hypothetical protein MIMGU_mgv1a027125mg [Erythranthe guttata]
Length=249

 Score =   267 bits (682),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLA+ GAIEKVL  V+++KP I+TVVEQEANHNG VF+DRF ESLHYYSTL+DSLE 
Sbjct  75   LHQLLAKTGAIEKVLKFVRELKPAILTVVEQEANHNGAVFLDRFNESLHYYSTLYDSLES  134

Query  483  CAASEGG-AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
            C    G  AV DQDKVMSEVYLGRQICNVVACEGV+RVERHETL QWR R   AGF  V+
Sbjct  135  CGGGGGDGAVSDQDKVMSEVYLGRQICNVVACEGVERVERHETLGQWRARLGWAGFGPVN  194

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            LG NAYKQASMLLALFAGG GY VEEN+G L LGWHTRPLIATSAWK+
Sbjct  195  LGSNAYKQASMLLALFAGGGGYVVEENNGCLMLGWHTRPLIATSAWKI  242



>ref|XP_003531153.1| PREDICTED: DELLA protein GAI1-like [Glycine max]
Length=517

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 144/169 (85%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLARPGA+EKVLSVV+ ++PEIVTVVEQEANHN   F+DRFTESLHYYSTLFDSLEG
Sbjct  353  FHKLLARPGAVEKVLSVVRQIRPEIVTVVEQEANHNRLSFVDRFTESLHYYSTLFDSLEG  412

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS+VHL
Sbjct  413  SP------VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFVSTGFSSVHL  466

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  467  GSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  515



>ref|XP_011021384.1| PREDICTED: DELLA protein GAI-like [Populus euphratica]
Length=608

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG I+KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  438  LHRLLDRPGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  497

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD VMSE+YLGRQICNVVACEG DRVERHETLA+WRTRF SAGF+ VHL
Sbjct  498  S----GVTPTSQDLVMSELYLGRQICNVVACEGADRVERHETLARWRTRFDSAGFNPVHL  553

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  554  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>ref|XP_008229195.1| PREDICTED: DELLA protein GAI [Prunus mume]
Length=597

 Score =   277 bits (709),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 142/169 (84%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGA+EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG
Sbjct  429  LHPLLARPGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEG  488

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  489  SSGPS------QDLVMSEVYLGRQICNVVACEGQDRVERHETLTQWRGRMDSAGFDLVHL  542

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  543  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  591



>ref|XP_007214956.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
 gb|EMJ16155.1| hypothetical protein PRUPE_ppa003206mg [Prunus persica]
Length=593

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 143/169 (85%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGA+EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG
Sbjct  425  LHPLLARPGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEG  484

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL+QWR R  SAGF  VHL
Sbjct  485  SSGPS------QDLVMSEVYLGRQICNVVACEGQDRVERHETLSQWRGRMDSAGFDLVHL  538

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  539  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  587



>gb|AHX57850.1| DELLA [Prunus mume]
Length=597

 Score =   277 bits (709),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 142/169 (84%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGA+EKVLS ++ MKP+IVT+VEQEANHNGP+F+DRF E+LHYYS LFDSLEG
Sbjct  429  LHPLLARPGAVEKVLSSIKAMKPKIVTIVEQEANHNGPIFLDRFNEALHYYSNLFDSLEG  488

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  489  SSGPS------QDLVMSEVYLGRQICNVVACEGQDRVERHETLTQWRGRMDSAGFDLVHL  542

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L S
Sbjct  543  GSNAFKQASMLLALFAGGDGYRVEENNGSLMLGWHTRPLIATSAWQLAS  591



>emb|CAA72178.1| RGA2 protein [Arabidopsis thaliana]
Length=532

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG
Sbjct  370  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEG  429

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+
Sbjct  430  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHI  482

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  483  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>emb|CAA75492.1| GAI [Arabidopsis thaliana]
Length=532

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG
Sbjct  370  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEG  429

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+
Sbjct  430  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHI  482

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  483  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>ref|NP_172945.1| DELLA protein GAI [Arabidopsis thaliana]
 sp|Q9LQT8.1|GAI_ARATH RecName: Full=DELLA protein GAI; AltName: Full=GRAS family protein 
3; Short=AtGRAS-3; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=Restoration of growth 
on ammonia protein 2 [Arabidopsis thaliana]
 gb|AAF79228.1|AC006917_13 F10B6.34 [Arabidopsis thaliana]
 gb|AAL25607.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AAM98266.1| At1g14920/F10B6_15 [Arabidopsis thaliana]
 gb|AEE29242.1| DELLA protein GAI [Arabidopsis thaliana]
Length=533

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN P+F+DRFTESLHYYSTLFDSLEG
Sbjct  371  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPIFLDRFTESLHYYSTLFDSLEG  430

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+
Sbjct  431  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHI  483

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  484  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  532



>ref|XP_002305198.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
 gb|EEE85709.1| hypothetical protein POPTR_0004s08890g [Populus trichocarpa]
Length=607

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG I+KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  438  LHRLLGRPGGIDKVLESIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  497

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHL
Sbjct  498  S----GLTPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHL  553

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  554  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  602



>ref|XP_006430617.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
 gb|ESR43857.1| hypothetical protein CICLE_v10011367mg [Citrus clementina]
Length=576

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 143/167 (86%), Gaps = 4/167 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG IEKV+S ++ M+P+I+T+VEQEANHN PVF+DRFTE+LHYYS+LFDSLEG
Sbjct  407  LHRLLARPGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEG  466

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD+VMSEVYLGRQICN+VACEG DR ERHETL QWRTR  SAGF  VHL
Sbjct  467  S----GLTPPSQDQVMSEVYLGRQICNIVACEGTDRNERHETLTQWRTRLGSAGFDPVHL  522

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  523  GSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQL  569



>ref|XP_011002785.1| PREDICTED: DELLA protein GAI [Populus euphratica]
Length=603

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 144/169 (85%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG I+KVL  ++ M+P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  434  LHRLLGRPGGIDKVLGSIKAMRPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  493

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD VMSE+YLGR ICNVVACEG DRVERHETLAQWRTRF SAGF  VHL
Sbjct  494  S----GLTPPSQDLVMSELYLGRHICNVVACEGADRVERHETLAQWRTRFDSAGFDPVHL  549

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L +
Sbjct  550  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLAA  598



>ref|XP_010476569.1| PREDICTED: DELLA protein GAI-like [Camelina sativa]
Length=533

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAI+KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG
Sbjct  371  LHKLLGRPGAIDKVLGVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEG  430

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA HL
Sbjct  431  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRKRFGSAGFSAAHL  483

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGW+TRPLIATSAWKL++
Sbjct  484  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWYTRPLIATSAWKLST  532



>ref|XP_010681882.1| PREDICTED: DELLA protein GAI-like [Beta vulgaris subsp. vulgaris]
Length=609

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+L+ARPGA+EKVL +++++KP IVTVVEQEANHNGP F+DRF ESLHYYSTLFDSLE 
Sbjct  442  LHRLMARPGAVEKVLGLMKEVKPVIVTVVEQEANHNGPAFLDRFNESLHYYSTLFDSLES  501

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C  S       QDK+MSEVYLGRQICNVVACEGVDRVERHETLAQWR RF SAGF+ VH+
Sbjct  502  CVDS-------QDKLMSEVYLGRQICNVVACEGVDRVERHETLAQWRNRFNSAGFTPVHI  554

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL  FAGGDGY VEENDG L LGWH+RPLI TSAW+L +
Sbjct  555  GSNAFKQASMLLDFFAGGDGYGVEENDGCLMLGWHSRPLITTSAWQLAN  603



>ref|XP_002534030.1| DELLA protein GAI, putative [Ricinus communis]
 gb|EEF28350.1| DELLA protein GAI, putative [Ricinus communis]
Length=567

 Score =   275 bits (703),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 146/168 (87%), Gaps = 4/168 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG +EKVLS ++ MKP+IVTVVEQEA+HNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  401  LHRLLARPGGMEKVLSSIKAMKPKIVTVVEQEASHNGPVFLDRFTEALHYYSSLFDSLEG  460

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G  V  QD VMSE+YLGRQICNVVACEG  RVERHE+L  WRTRF+SAGF  VHL
Sbjct  461  S----GLNVPSQDLVMSELYLGRQICNVVACEGAHRVERHESLPHWRTRFESAGFDRVHL  516

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L+
Sbjct  517  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQLS  564



>gb|KFK26113.1| hypothetical protein AALP_AA8G204400 [Arabis alpina]
Length=528

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAIEKVL VV  ++PEI TVVEQE+NHN PVF+DRFTESLHYYSTLFDSLEG
Sbjct  361  LHKLLGRPGAIEKVLGVVNQIQPEIFTVVEQESNHNSPVFLDRFTESLHYYSTLFDSLEG  420

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGFSA H+
Sbjct  421  APSS-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFSAAHM  473

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G  A+K ASMLLALF GG+GYRVEE+DG LTLGWHTRPL+A SAWKL++
Sbjct  474  GSKAFKDASMLLALFNGGEGYRVEESDGCLTLGWHTRPLVAASAWKLST  522



>ref|XP_006469195.1| PREDICTED: DELLA protein GAIP-B-like [Citrus sinensis]
Length=594

 Score =   275 bits (704),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGAI+KVLSVV+++KP+I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG
Sbjct  429  LHKLLAQPGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEG  488

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S      +  K M+E Y+G QICNVVACEG DRVERHETLAQWRTRF SAGF   H+
Sbjct  489  SVNSP-----ENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHI  543

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  544  GSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  592



>gb|KDO64603.1| hypothetical protein CISIN_1g043131mg [Citrus sinensis]
Length=592

 Score =   275 bits (703),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGAI+KVLSVV+++KP+I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG
Sbjct  427  LHKLLAQPGAIDKVLSVVKNIKPDIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEG  486

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S      +  K M+E Y+G QICNVVACEG DRVERHETLAQWRTRF SAGF   H+
Sbjct  487  SVNSP-----ENHKAMTEAYMGNQICNVVACEGADRVERHETLAQWRTRFSSAGFIPAHI  541

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  542  GSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  590



>gb|AAT08645.1| GAI-like protein [Hyacinthus orientalis]
Length=215

 Score =   263 bits (671),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 144/167 (86%), Gaps = 0/167 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR GAI+KVLS V+ +KP+I+TVVEQEANHNG +F +RFTE+LHYYST+FDSLEG
Sbjct  46   LHRLLAREGAIDKVLSTVKAIKPKIMTVVEQEANHNGGLFAERFTEALHYYSTMFDSLEG  105

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A+++  +   Q++VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF  VHL
Sbjct  106  GASADAVSGGQQNQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLSPAGFEPVHL  165

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGG+GYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  166  GSNAFKQASMLLALFAGGNGYRVEEKDGCLTLGWHTRPLIATSAWRV  212



>ref|XP_002890081.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66340.1| hypothetical protein ARALYDRAFT_471680 [Arabidopsis lyrata subsp. 
lyrata]
Length=532

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL +PGAI+KVL VV  +KPEI TVVEQE+NHN PVF+DRFTESLHYYS+LFDSLEG
Sbjct  370  LHKLLGQPGAIDKVLEVVNQIKPEIFTVVEQESNHNSPVFLDRFTESLHYYSSLFDSLEG  429

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QDKVMSEVYLG+QICNVVAC+G DRVERHETL+QWR RF SAGF+A H+
Sbjct  430  VPSG-------QDKVMSEVYLGKQICNVVACDGPDRVERHETLSQWRNRFGSAGFAAAHI  482

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE+DG L LGWHTRPLIATSAWKL++
Sbjct  483  GSNAFKQASMLLALFNGGEGYRVEESDGCLMLGWHTRPLIATSAWKLST  531



>ref|XP_007156503.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 ref|XP_007156504.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28497.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
 gb|ESW28498.1| hypothetical protein PHAVU_003G291500g [Phaseolus vulgaris]
Length=517

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 141/167 (84%), Gaps = 6/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLARPGAIEKVLSVV+ ++PEI+TVVEQE+NHNG  F DRFTESLHYYSTLFDSLEG
Sbjct  349  FHKLLARPGAIEKVLSVVRQIRPEILTVVEQESNHNGLSFRDRFTESLHYYSTLFDSLEG  408

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR+RF S GFS VHL
Sbjct  409  SP------VNPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRSRFSSTGFSPVHL  462

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEEN G L LGWHTR LIATSAW+L
Sbjct  463  GSNAFKQASMLLALFAGGDGYRVEENSGCLMLGWHTRALIATSAWQL  509



>ref|XP_006482132.1| PREDICTED: DELLA protein GAI-like [Citrus sinensis]
 gb|KDO50841.1| hypothetical protein CISIN_1g008153mg [Citrus sinensis]
Length=576

 Score =   274 bits (700),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 127/167 (76%), Positives = 143/167 (86%), Gaps = 4/167 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG IEKV+S ++ M+P+I+T+VEQEANHN PVF+DRFTE+LHYYS+LFDSLEG
Sbjct  407  LHRLLARPGGIEKVVSSIKAMRPKIITIVEQEANHNSPVFLDRFTEALHYYSSLFDSLEG  466

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD+VMSEVYLGRQICN+VAC+G DR ERHETL QWRTR  SAGF  VHL
Sbjct  467  S----GLTPPSQDQVMSEVYLGRQICNIVACDGTDRNERHETLTQWRTRLGSAGFEPVHL  522

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  523  GSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWQL  569



>dbj|BAF62636.1| DELLA protein [Phaseolus vulgaris]
Length=516

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 141/167 (84%), Gaps = 6/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLARPGAIEKVLSVV+ ++PEI+TVVEQE+NHNG  F DRFTESLHYYSTLFDSLEG
Sbjct  348  FHKLLARPGAIEKVLSVVRQIRPEILTVVEQESNHNGLSFRDRFTESLHYYSTLFDSLEG  407

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V  QDK MSEVYLG+QICNVVACEG DRVERHETL QWR+RF S GFS VHL
Sbjct  408  SP------VNPQDKAMSEVYLGKQICNVVACEGTDRVERHETLNQWRSRFSSTGFSPVHL  461

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEEN G L LGWHTR LIATSAW+L
Sbjct  462  GSNAFKQASMLLALFAGGDGYRVEENSGCLMLGWHTRALIATSAWQL  508



>gb|ACY74341.1| putative DELLA protein [Artemisia annua]
Length=530

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +HQLLAR G++EKVL+ V+DMKP I T+VE+EANHNGPVF+DRFTE+LHYYSTLFDSLE 
Sbjct  357  MHQLLARAGSVEKVLTAVKDMKPVIFTLVEEEANHNGPVFLDRFTEALHYYSTLFDSLES  416

Query  483  CAASEGG---AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
               +  G    V +QDK+MSEVYLG+QICNVVACEGVDRVERH T  QW+TRF+++GF  
Sbjct  417  SGNNGNGEVDGVSNQDKIMSEVYLGKQICNVVACEGVDRVERHMTSGQWKTRFENSGFEP  476

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            V+LG NAYKQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  477  VNLGSNAYKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  526



>ref|NP_001240948.1| DELLA protein GAI 1 [Glycine max]
 gb|ACA24488.1| gibberellin insensitive-like protein [Glycine max]
Length=523

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 142/169 (84%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLARPGA+EKVLSVV+ ++PEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLEG
Sbjct  354  FHKLLARPGAVEKVLSVVRQIRPEILTVVEQEANHNGLSFVDRFTESLHYYSTLFDSLEG  413

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS VHL
Sbjct  414  SP------VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFGSTGFSPVHL  467

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLL+LF GGDGYRVEEN+G L LGWHTRPLIATS W+L +
Sbjct  468  GSNAYKQASMLLSLFGGGDGYRVEENNGCLMLGWHTRPLIATSVWQLAT  516



>dbj|BAG71201.1| DELLA 2 [Lactuca sativa]
Length=590

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 144/174 (83%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLARPGA+EKVLS V++MKP I+TVVEQEANHNG VF++RFTESLHYYSTLFDSLE 
Sbjct  416  LHQLLARPGAVEKVLSAVKEMKPVILTVVEQEANHNGLVFLERFTESLHYYSTLFDSLES  475

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
                 G           +QDK+MSEVYLG+QICNVVACEG DRVERHETL QW+ R  S+
Sbjct  476  SGTGGGGVEGGAISPASNQDKIMSEVYLGKQICNVVACEGPDRVERHETLTQWKARLDSS  535

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF AVHLG NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  536  GFEAVHLGSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLITTSAWKL  589



>ref|XP_010101954.1| hypothetical protein L484_011971 [Morus notabilis]
 gb|EXB90878.1| hypothetical protein L484_011971 [Morus notabilis]
Length=477

 Score =   271 bits (692),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 141/167 (84%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVLSVV+ MKPEIVTVVEQEANHNG  F+DRFTE+LHYYSTLFDSLEG
Sbjct  309  LHKLLARPGAIEKVLSVVKQMKPEIVTVVEQEANHNGSFFLDRFTEALHYYSTLFDSLEG  368

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A         QDKVMSEVYLG+QI NVVA EGVDRVERHETL QWR R + AGF+  HL
Sbjct  369  SANG-------QDKVMSEVYLGKQIANVVAAEGVDRVERHETLGQWRARMEGAGFTPAHL  421

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLAL+AGGDGY VEE +G L LGWHTRPLIATSAW+L
Sbjct  422  GSNAFKQASMLLALYAGGDGYGVEEKNGSLMLGWHTRPLIATSAWQL  468



>ref|XP_010553798.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=611

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/167 (79%), Positives = 141/167 (84%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL VV+  KP+I TVVEQE+NHN P  +DRFTESLHYYSTLFDSLEG
Sbjct  444  LHKLLARPGAMEKVLDVVKRTKPDIFTVVEQESNHNSPALLDRFTESLHYYSTLFDSLEG  503

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A S       QDKVMSEVYLG+QICNVVACEG DRVERHETL QWRTRF SAGFS V L
Sbjct  504  VANS-------QDKVMSEVYLGKQICNVVACEGSDRVERHETLTQWRTRFCSAGFSPVQL  556

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF GG+GYRVEE DG L LGWHTRPLIATSAWKL
Sbjct  557  GSNAFKQASMLLALFNGGEGYRVEEKDGCLMLGWHTRPLIATSAWKL  603



>emb|CDP01615.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAI+KVL+ ++ M+P+IV VVEQEANHNG VFMDRF E+LHYYST+FDSLE 
Sbjct  370  LHRLLSRPGAIDKVLNSIKSMRPKIVAVVEQEANHNGNVFMDRFNEALHYYSTMFDSLES  429

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               ++      QD VMSEVYLGRQICNVVACEGVDRVERHETL QWR R  SAGF  VHL
Sbjct  430  SGLTQQSN--SQDLVMSEVYLGRQICNVVACEGVDRVERHETLTQWRGRMNSAGFDPVHL  487

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L
Sbjct  488  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQL  534



>gb|KDP33167.1| hypothetical protein JCGZ_13432 [Jatropha curcas]
Length=539

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 140/166 (84%), Gaps = 4/166 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG I+KVLS V+ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  373  LHRLLARPGGIDKVLSSVKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  432

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G  V  QD VMSE+YLGRQICNVVA EG DRVERHETLAQWRTR  +AGF  VHL
Sbjct  433  S----GSVVPSQDLVMSELYLGRQICNVVAWEGADRVERHETLAQWRTRIDAAGFEPVHL  488

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            G NAYKQA MLL +FAGGDGYRVEE DG L LGWHTRPLI TSAWK
Sbjct  489  GSNAYKQAGMLLDIFAGGDGYRVEEKDGCLMLGWHTRPLIVTSAWK  534



>ref|XP_010032696.1| PREDICTED: DELLA protein GAI [Eucalyptus grandis]
 gb|KCW52149.1| hypothetical protein EUGRSUZ_J01594 [Eucalyptus grandis]
Length=628

 Score =   275 bits (702),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 145/169 (86%), Gaps = 4/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGAI+KVLS ++ M+P+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG
Sbjct  461  LHPLLARPGAIDKVLSSIKAMRPKIVTMVEQEANHNGPGFVDRFTEALHYYSSLFDSLEG  520

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G A  +QD VMSEVYLGRQICNVVACEG DRVERHETL QW+ R  SAGF  VHL
Sbjct  521  S----GVAPPNQDLVMSEVYLGRQICNVVACEGPDRVERHETLVQWQARMGSAGFDPVHL  576

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGG+GYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  577  GSNAFKQASMLLALFAGGEGYRVEENDGCLMLGWHTRPLIATSAWQLAA  625



>gb|EYU25601.1| hypothetical protein MIMGU_mgv1a003589mg [Erythranthe guttata]
Length=576

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 132/168 (79%), Positives = 142/168 (85%), Gaps = 1/168 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLA+ GAIEKVL  V+++KP I+TVVEQEANHNG VF+DRF ESLHYYSTL+DSLE 
Sbjct  408  LHQLLAKTGAIEKVLKFVRELKPAILTVVEQEANHNGAVFLDRFNESLHYYSTLYDSLES  467

Query  483  CAASEGG-AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
            C    G  AV DQDKVMSEVYLGRQICNVVACEGV+RVERHETL QWR R   AGF  VH
Sbjct  468  CGGGGGDGAVSDQDKVMSEVYLGRQICNVVACEGVERVERHETLGQWRARLGWAGFGPVH  527

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            LG NAYKQASMLLALFAGG GY VEEN+G L LGWHTRPLIATSAWK+
Sbjct  528  LGSNAYKQASMLLALFAGGGGYVVEENNGCLMLGWHTRPLIATSAWKI  575



>gb|AHB17746.1| GA repressor DELLA [Actinidia deliciosa]
Length=581

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 145/169 (86%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KVL+ ++ M+P+IVTVVEQEANHNG   ++RF E+LHYYST+FDSLE 
Sbjct  413  LHRLLARPGAIDKVLASIKAMRPKIVTVVEQEANHNGSGLVERFNEALHYYSTMFDSLES  472

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               ++   V +QD VMSEVYLGRQICNVVACEG DRVERHETL+QWRTR  SAGF   HL
Sbjct  473  SGLTQ---VSNQDLVMSEVYLGRQICNVVACEGTDRVERHETLSQWRTRMGSAGFDPAHL  529

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+LT+
Sbjct  530  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQLTA  578



>ref|XP_006448223.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
 gb|ESR61463.1| hypothetical protein CICLE_v10017466mg [Citrus clementina]
Length=594

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 144/169 (85%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGAI+KVLSVV+++K +I TV EQEANHNGPVF+DRFTESLHYYST+FDSLEG
Sbjct  429  LHKLLAQPGAIDKVLSVVKNIKADIFTVAEQEANHNGPVFLDRFTESLHYYSTMFDSLEG  488

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S      +  K M+E YLG QICNVVACEG DRVERHETLAQWRTRF SAGF   H+
Sbjct  489  SVNSP-----ENHKAMTEAYLGNQICNVVACEGADRVERHETLAQWRTRFGSAGFIPAHI  543

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLLALFAGGDGY+VEEN+G LTLGW+TRPLIATSAWKL +
Sbjct  544  GSNAYKQASMLLALFAGGDGYKVEENNGCLTLGWYTRPLIATSAWKLAA  592



>gb|KFK33379.1| rga1 protein [Arabis alpina]
Length=590

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPGAIEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  427  LHKLLGRPGAIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  486

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL QW  RF S+GF   HL
Sbjct  487  APSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLNQWTNRFGSSGFVPAHL  539

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEE++G L LGWHTRPLI TSAWKLT+
Sbjct  540  GSNAFKQASMLLALFNGGEGYRVEESNGCLMLGWHTRPLITTSAWKLTA  588



>gb|ABI30654.1| putative gibberellin signaling DELLA protein LA [Pisum sativum]
Length=592

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 148/176 (84%), Gaps = 4/176 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LARPG+I+KVL+ V+ + P+IVT+VEQEANHNGPVFMDRFTE+LHYYS+LFDSLEG
Sbjct  418  LHTMLARPGSIDKVLNTVKKINPKIVTIVEQEANHNGPVFMDRFTEALHYYSSLFDSLEG  477

Query  483  CAASE--GGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAV  310
             + S   G     QD +MSE+YLGRQICNVVA EGVDRVERHETL+QWR+R  SAGF  V
Sbjct  478  SSNSNPAGSGSSSQDLLMSELYLGRQICNVVAYEGVDRVERHETLSQWRSRMGSAGFDPV  537

Query  309  HLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTES  142
            HLG NA+KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL   L+ES
Sbjct  538  HLGSNAFKQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKLP--LSES  591



>ref|XP_010554410.1| PREDICTED: DELLA protein GAI-like [Tarenaya hassleriana]
Length=609

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/167 (77%), Positives = 141/167 (84%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVL VV+ +KPEI TVVEQE+NHN P F++RFTESLHYYST+FDSLEG
Sbjct  442  LHKLLARPGAIEKVLGVVRQIKPEIFTVVEQESNHNSPAFLNRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       QDKVMSEVYLG+QICNVVACEG DRVERHE+LAQWRTRF+ AGFS  HL
Sbjct  502  VGNS-------QDKVMSEVYLGKQICNVVACEGPDRVERHESLAQWRTRFELAGFSPAHL  554

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASM+L+LF GG GY VEENDG L LGWHTRPLI TSAWKL
Sbjct  555  GSNAFKQASMILSLFNGGQGYGVEENDGCLMLGWHTRPLITTSAWKL  601



>ref|XP_008460522.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=603

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 145/167 (87%), Gaps = 2/167 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVL  ++  KP+IVT+VEQEANHNGPVF+DRFTE+LHYYS LFDSLEG
Sbjct  433  LHRLLARPGAIEKVLGSIKTTKPKIVTIVEQEANHNGPVFLDRFTEALHYYSNLFDSLEG  492

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S G     +D ++SEVYLG+QICNVVACEG +RVERHE+L QWRTR +SAGF  VHL
Sbjct  493  --SSSGFEPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLTQWRTRMESAGFDPVHL  550

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  551  GSNAFKQASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  597



>ref|XP_009779843.1| PREDICTED: DELLA protein GAI-like isoform X4 [Nicotiana sylvestris]
Length=572

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/179 (72%), Positives = 146/179 (82%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  388  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  447

Query  483  CAASEGGA----------VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
              ++   +          V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R 
Sbjct  448  SVSTSSVSTSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRM  507

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             SAGF  VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  508  NSAGFDPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  566



>ref|XP_006826893.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
 gb|ERM94130.1| hypothetical protein AMTR_s00010p00148880 [Amborella trichopoda]
Length=556

 Score =   268 bits (686),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/167 (72%), Positives = 142/167 (85%), Gaps = 4/167 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLA+P A++KVL+ V+ ++P+IVT+VEQEANHNGPVFMDRFTE+LHYYSTLFDSLEG
Sbjct  391  LHNLLAQPSALDKVLASVRALRPKIVTIVEQEANHNGPVFMDRFTEALHYYSTLFDSLEG  450

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
            C    G      D+VMSEVYLGRQICN+VACEG DRVERHETL QWR R  +AGF+ VHL
Sbjct  451  CGLPPGS----NDQVMSEVYLGRQICNIVACEGADRVERHETLTQWRARMGAAGFAPVHL  506

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA++QASMLL LF+GGDGY+VEEN+G L L WHTRPLIATSAW++
Sbjct  507  GSNAFRQASMLLTLFSGGDGYKVEENNGCLMLAWHTRPLIATSAWQI  553



>ref|XP_006395878.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
 dbj|BAJ33650.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33164.1| hypothetical protein EUTSA_v10005482mg [Eutrema salsugineum]
Length=616

 Score =   270 bits (689),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  453  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFVDRFTESLHYYSTLFDSLEG  512

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHE L+QW  RF S+GF+  HL
Sbjct  513  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHEMLSQWANRFGSSGFAPAHL  565

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  566  GSNAFKQASMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLST  614



>gb|ABO61516.1| GAI1 [Glycine max]
Length=523

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
             H+LLARPGA+EKVLSVV+ ++PEI+TVVEQEANHNG  F+DRFTESLHYYSTLFDSLEG
Sbjct  354  FHKLLARPGAVEKVLSVVRQIRPEILTVVEQEANHNGLSFVDRFTESLHYYSTLFDSLEG  413

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                    V   DK MSEVYLG+QICNVVACEG+DRVERHETL QWR RF S GFS VHL
Sbjct  414  SP------VNPNDKAMSEVYLGKQICNVVACEGMDRVERHETLNQWRNRFGSTGFSPVHL  467

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLL+LF GGDGYRVEEN+G L LGW  RPLIATS W+L +
Sbjct  468  GSNAYKQASMLLSLFGGGDGYRVEENNGCLMLGWPPRPLIATSVWQLAT  516



>ref|XP_004155733.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
 emb|CCG14221.1| gibberellin DELLA protein [Cucumis sativus]
 gb|KGN51056.1| hypothetical protein Csa_5G421370 [Cucumis sativus]
Length=603

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 146/167 (87%), Gaps = 2/167 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVL  ++  KP+IVT+VEQEANHNGP+F+DRFTE+LHYYS LFDSLEG
Sbjct  433  LHRLLARPGAIEKVLGSIKTTKPKIVTIVEQEANHNGPIFLDRFTEALHYYSNLFDSLEG  492

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S G     +D ++SEVYLG+QICNVVACEG +RVERHE+L+QWR+R +S+GF  VHL
Sbjct  493  --SSSGFEPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLSQWRSRMESSGFDPVHL  550

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALFAGG+GYRVEEN+G L LGWHTRPLIATSAW+L
Sbjct  551  GSNAFKQASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIATSAWQL  597



>ref|XP_009370101.1| PREDICTED: DELLA protein GAI-like [Pyrus x bretschneideri]
Length=580

 Score =   268 bits (684),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 141/169 (83%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR GA++KVLS ++ MKP+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG
Sbjct  415  LHGLLARAGAVDKVLSSIKAMKPKIVTIVEQEANHNGPAFLDRFTEALHYYSSLFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF +VHL
Sbjct  475  SSGPS------QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDSVHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAG DGYRVEEN+G L LGWHT+PLI TSAWKL S
Sbjct  529  GSNAFKQASMLLALFAGVDGYRVEENNGSLMLGWHTQPLIVTSAWKLAS  577



>dbj|BAF62637.1| DELLA protein [Phaseolus vulgaris]
Length=596

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++LARPG+++KV+  V+++ P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  425  LHRMLARPGSVDKVMDTVKNLNPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  484

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             ++S G     QD +MSEVYLG+QICNVVA EGV+RVERHETL+QWR R  SAGF  VHL
Sbjct  485  SSSSTGLGSPSQDLLMSEVYLGKQICNVVAYEGVERVERHETLSQWRGRMGSAGFDPVHL  544

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  545  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  593



>ref|XP_007163387.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
 gb|ESW35381.1| hypothetical protein PHAVU_001G230500g [Phaseolus vulgaris]
Length=596

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++LARPG+++KV+  V+++ P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  425  LHRMLARPGSVDKVMDTVKNLNPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  484

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             ++S G     QD +MSEVYLG+QICNVVA EGV+RVERHETL+QWR R  SAGF  VHL
Sbjct  485  SSSSTGLGSPSQDLLMSEVYLGKQICNVVAYEGVERVERHETLSQWRGRMGSAGFDPVHL  544

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  545  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  593



>gb|ABS50250.1| DELLA protein [Malus hupehensis]
Length=580

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR GA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  415  LHGLLARAGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  475  SSGPS------QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  529  GSNAFKQASMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>ref|XP_003552980.1| PREDICTED: DELLA protein GAI-like [Glycine max]
 gb|ACJ61497.1| gibberellic acid-insensitive mutant protein [Glycine max]
Length=584

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++LARPG+++KVL  V+ +KP+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG
Sbjct  408  LHRMLARPGSVDKVLDTVKKIKPKIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDSLEG  467

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             ++S G    +QD +MSE+YLGRQICNVVA EG DRVERHETL+QWR R  SAGF  VHL
Sbjct  468  SSSSTGLGSPNQDLLMSELYLGRQICNVVANEGADRVERHETLSQWRGRLDSAGFDPVHL  527

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  528  GSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  576



>gb|AEX97110.1| spur-type DELLA protein [Malus domestica]
Length=580

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR GA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  415  LHGLLARAGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  475  SSGPS------QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  529  GSNAFKQASMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>gb|AAY56749.1| DELLA protein [Malus domestica]
Length=580

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 140/169 (83%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR GA++KVLS ++ MKP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  415  LHGLLARAGAVDKVLSSIKAMKPKIVTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  475  SSGPS------QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  529  GSNAFKQASMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>ref|XP_010551797.1| PREDICTED: DELLA protein RGL1-like [Tarenaya hassleriana]
Length=553

 Score =   266 bits (680),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 8/169 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++LARPG+IEKV S ++ +KP+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  388  LHRVLARPGSIEKVFSTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYYSSLFDSLEG  447

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETLAQWRTRF SAGF  VHL
Sbjct  448  PPS--------QDRVMSELFLGRQILNLVACEGPDRVERHETLAQWRTRFNSAGFKPVHL  499

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLL LF+G DGY VEENDG L LGW TRPLIATSAW+L +
Sbjct  500  GSNAYKQASMLLDLFSGADGYNVEENDGCLLLGWQTRPLIATSAWQLAA  548



>emb|CDY36236.1| BnaC07g20900D [Brassica napus]
Length=556

 Score =   266 bits (679),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  393  LHKLLGRPGGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  452

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  453  APSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHL  505

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQAS LLALF GG+GYRVEEN+G L L WHTRPLI TSAWKL++
Sbjct  506  GSNAFKQASTLLALFNGGEGYRVEENNGCLMLSWHTRPLITTSAWKLSA  554



>gb|EYU30908.1| hypothetical protein MIMGU_mgv1a024641mg [Erythranthe guttata]
Length=532

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 142/169 (84%), Gaps = 1/169 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL  ++ M P+IVTVVEQEA+HNG VFMDRF ESLHYYST+FDSLEG
Sbjct  361  LHRLLARPGAVEKVLGSIRAMGPKIVTVVEQEADHNGVVFMDRFNESLHYYSTMFDSLEG  420

Query  483  CAASE-GGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
               ++  G    QD  M+EVYLGRQICNVVAC+G +RVERHETLA+WR R  SAGF   H
Sbjct  421  SGLTQPDGGGGGQDLFMTEVYLGRQICNVVACDGAERVERHETLAKWRRRMGSAGFEPAH  480

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            LG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+LT
Sbjct  481  LGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLT  529



>gb|EYU45810.1| hypothetical protein MIMGU_mgv1a003644mg [Erythranthe guttata]
Length=572

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 143/175 (82%), Gaps = 10/175 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGA+EKVL+ ++ M P+IVTVVEQEANHNG VF+DRF E+LHYYST+FDSLE 
Sbjct  400  LHRLLSRPGALEKVLNSIRAMNPKIVTVVEQEANHNGGVFLDRFNEALHYYSTMFDSLES  459

Query  483  CAA------SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAG  322
            C          GG    QD VM+EVYLGRQICNVVAC+G DRVERHETL QWR R  SAG
Sbjct  460  CGGVTQQLPPNGG----QDLVMTEVYLGRQICNVVACDGADRVERHETLPQWRRRMGSAG  515

Query  321  FSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            F   HLG NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+LT+
Sbjct  516  FEPAHLGSNAHKQASMLLALFAGGDGYRVEENEGCLMLGWHTRPLIATSAWRLTA  570



>gb|AFA35960.1| ELLA domain GRAS family transcription factor [Nicotiana attenuata]
Length=561

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  382  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  441

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V  QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF
Sbjct  442  SVSTSSTGLTQPIVNSQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGF  501

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            + VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  502  NPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  555



>ref|XP_009796771.1| PREDICTED: DELLA protein GAI-like [Nicotiana sylvestris]
Length=568

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  388  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  447

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF
Sbjct  448  SVSTSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGF  507

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  508  DPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>sp|Q5BN22.1|RGA2_BRACM RecName: Full=DELLA protein RGA2; AltName: Full=BrRGA2; AltName: 
Full=RGA-like protein 2 [Brassica rapa]
 gb|AAX33298.1| DELLA protein [Brassica rapa]
Length=579

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKVL VV+ +KP I TVVEQE++HNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  416  LHKLLGRTGGIEKVLGVVKQIKPVIFTVVEQESSHNGPVFLDRFTESLHYYSTLFDSLEG  475

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  476  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGSSGFAPAHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  529  GSNAFKQASMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  577



>gb|ACN33960.1| unknown [Zea mays]
Length=447

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 140/174 (80%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  268  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  327

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
              A  G        A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +
Sbjct  328  AGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGS  387

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF+ VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  388  GFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  441



>ref|XP_009779840.1| PREDICTED: DELLA protein GAI-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779841.1| PREDICTED: DELLA protein GAI-like isoform X2 [Nicotiana sylvestris]
Length=567

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  388  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  447

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF
Sbjct  448  SVSTSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGF  507

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  508  DPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>ref|XP_009779842.1| PREDICTED: DELLA protein GAI-like isoform X3 [Nicotiana sylvestris]
Length=567

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 128/174 (74%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  388  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  447

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V +QD VMSEVYLGRQICNVVACEGVDRVERHETL+QWR R  SAGF
Sbjct  448  SVSTSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLSQWRVRMNSAGF  507

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  508  DPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRLKA  561



>gb|ACN36682.1| unknown [Zea mays]
Length=447

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 140/174 (80%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  268  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNPGTFLDRFTESLHYYSTMFDSLEG  327

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
              A  G        A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +
Sbjct  328  AGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGS  387

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF+ VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  388  GFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  441



>ref|XP_010424927.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=605

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  442  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  501

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  502  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGIRFGSSGFAPAHL  554

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  555  GSNAFKQASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLSA  603



>ref|XP_010109004.1| hypothetical protein L484_027201 [Morus notabilis]
 gb|EXC20644.1| hypothetical protein L484_027201 [Morus notabilis]
Length=584

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 143/167 (86%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPG+IEKVLS ++ ++P+IVT+VEQEANHNGPVF+DRFTE+LHYYSTLFDSLE 
Sbjct  421  LHRLLARPGSIEKVLSSIKAVRPKIVTIVEQEANHNGPVFLDRFTEALHYYSTLFDSLEI  480

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       +D +MSEVYLG+QICNVVACEG DRVERHE L +WR RF SAGF  VHL
Sbjct  481  SPPS-------RDLMMSEVYLGKQICNVVACEGPDRVERHENLDRWRDRFGSAGFDRVHL  533

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLAL+AGG+GYRVEENDG L LGWHTRPLIATSAW+L
Sbjct  534  GSNAFKQASMLLALYAGGEGYRVEENDGCLMLGWHTRPLIATSAWQL  580



>ref|XP_008381346.1| PREDICTED: DELLA protein GAI [Malus domestica]
Length=580

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 139/169 (82%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR GA++KVLS ++ MKP+I T+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  415  LHGLLARAGAVDKVLSSIKAMKPKIXTIVEQEANHNGPVFLDRFTEALHYYSSLFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  SAGF  VHL
Sbjct  475  SSGPS------QDLVMSEVYLGRQICNVVACEGGDRVERHETLTQWRGRMDSAGFDPVHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL LFAG DGYRV+EN+G L LGWHTRPLI TSAWKL S
Sbjct  529  GSNAFKQASMLLDLFAGVDGYRVQENNGSLMLGWHTRPLIVTSAWKLAS  577



>dbj|BAG16380.1| GRAS family transcription factor [Brassica rapa var. perviridis]
Length=570

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKVL VV+ +KP I TVVEQE++HNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  407  LHKLLGRTGGIEKVLGVVKQIKPVIFTVVEQESSHNGPVFLDRFTESLHYYSTLFDSLEG  466

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HL
Sbjct  467  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHL  519

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  520  GSNAFKQASMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  568



>sp|Q84TQ7.1|GAI_GOSHI RecName: Full=DELLA protein GAI; AltName: Full=GhGAI; AltName: 
Full=Gibberellic acid-insensitive mutant protein [Gossypium 
hirsutum]
 gb|AAO62757.1| GIA/RGA-like gibberellin response modulator [Gossypium hirsutum]
Length=537

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 137/161 (85%), Gaps = 4/161 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG IEKV+S ++ MKP+IVTVVEQEANHNGPVF+DRFTE+LHYYSTLFDSLEG
Sbjct  372  LHPLLARPGGIEKVVSSIKAMKPKIVTVVEQEANHNGPVFLDRFTEALHYYSTLFDSLEG  431

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G A   QD  MSE+YLGRQICNVVACEG+DRVERHE L QWRTR ++AG S VHL
Sbjct  432  S----GVAPASQDLAMSELYLGRQICNVVACEGMDRVERHEPLTQWRTRMETAGVSPVHL  487

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIA  181
            G NAYKQASMLLALFA GDGYRVEEN+G L LGWHTRPLIA
Sbjct  488  GSNAYKQASMLLALFASGDGYRVEENNGCLMLGWHTRPLIA  528



>gb|AHB17745.1| GA repressor DELLA [Actinidia deliciosa]
Length=579

 Score =   265 bits (676),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI+KVL+ ++ M+P+IVTVVEQEANHNG  F+DRF E+LHYYST+FDSLE 
Sbjct  411  LHRLLARPGAIDKVLASIKAMRPKIVTVVEQEANHNGSGFVDRFNEALHYYSTMFDSLES  470

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               ++     +QD VMSEVYLGRQICNVVACEG DRVERHE L+Q RTR  SAGF   HL
Sbjct  471  SGLTQA---SNQDLVMSEVYLGRQICNVVACEGTDRVERHEMLSQLRTRMDSAGFEPAHL  527

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA++QASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+L +
Sbjct  528  GSNAFRQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWQLAA  576



>ref|XP_010513881.1| PREDICTED: DELLA protein RGA isoform X1 [Camelina sativa]
 ref|XP_010513882.1| PREDICTED: DELLA protein RGA isoform X2 [Camelina sativa]
Length=611

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 141/169 (83%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  448  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  507

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW +RF S+GF   HL
Sbjct  508  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGSRFGSSGFVPAHL  560

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  561  GSNAFKQASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLSA  609



>gb|AFD62413.1| reduced height-2 [Eragrostis tef]
 gb|AFD62414.1| reduced height-2 [Eragrostis tef]
 gb|AFD62415.1| reduced height-2 [Eragrostis tef]
 gb|AFD62416.1| reduced height-2 [Eragrostis tef]
 gb|AFD62417.1| reduced height-2 [Eragrostis tef]
 gb|AFD62418.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   265 bits (678),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 142/173 (82%), Gaps = 4/173 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  CAASEG----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
             A+ +     GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF 
Sbjct  504  GASGQSDASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFE  563

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  PVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>dbj|BAG16374.1| GRAS family transcription factor [Brassica oleracea var. italica]
Length=569

 Score =   263 bits (673),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 139/167 (83%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  406  LHKLLGRTGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  465

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HL
Sbjct  466  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHL  518

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLLALF GG+GY VEEN+G L LGWHTRPLI TSAWKL
Sbjct  519  GSNAFKQASMLLALFNGGEGYSVEENNGCLMLGWHTRPLITTSAWKL  565



>gb|AFD62385.1| reduced height-1 [Eragrostis tef]
 gb|AFD62386.1| reduced height-1 [Eragrostis tef]
 gb|AFD62387.1| reduced height-1 [Eragrostis tef]
 gb|AFD62388.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   265 bits (676),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  CA-----ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
                   A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  AGSGQSDAASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|ACL53794.1| unknown [Zea mays]
Length=586

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 140/174 (80%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  407  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  466

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
              A  G        A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +
Sbjct  467  AGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGS  526

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF+ VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  527  GFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  580



>ref|XP_010502135.1| PREDICTED: DELLA protein RGA-like [Camelina sativa]
Length=615

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/167 (74%), Positives = 139/167 (83%), Gaps = 7/167 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  451  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  510

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  511  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGYRFGSSGFAPAHL  563

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+KQASMLL++F  G GYRVEEN+G L LGWHTRPLI TSAWKL
Sbjct  564  GSNAFKQASMLLSVFNSGQGYRVEENNGCLMLGWHTRPLITTSAWKL  610



>ref|XP_009594460.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=567

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 143/174 (82%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  388  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  447

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V +QD VMSEVYLGRQICNVVACEGVDRVERHETL QWR R  SAGF
Sbjct  448  SVSTSSTGLTQPIVNNQDLVMSEVYLGRQICNVVACEGVDRVERHETLRQWRVRMNSAGF  507

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+  +
Sbjct  508  DPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRFKA  561



>gb|AFD62391.1| reduced height-2 [Eragrostis tef]
 gb|AFD62392.1| reduced height-2 [Eragrostis tef]
 gb|AFD62393.1| reduced height-2 [Eragrostis tef]
 gb|AFD62394.1| reduced height-2 [Eragrostis tef]
 gb|AFD62395.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  CAASEG----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
              + +     GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF 
Sbjct  504  GGSGQSDASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFE  563

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  PVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>sp|Q9ST48.1|DWRF8_MAIZE RecName: Full=DELLA protein DWARF8; Short=Protein dwarf-8 [Zea 
mays]
 emb|CAB51557.1| gibberellin response modulator [Zea mays]
 gb|ACL52869.1| unknown [Zea mays]
 tpg|DAA50920.1| TPA: dwarf plant8 [Zea mays]
Length=630

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 140/174 (80%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  451  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  510

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
              A  G        A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +
Sbjct  511  AGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGS  570

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF+ VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  571  GFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  624



>gb|AFD62419.1| reduced height-2 [Eragrostis tef]
 gb|AFD62420.1| reduced height-2 [Eragrostis tef]
 gb|AFD62421.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  CAASEG----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
              + +     GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF 
Sbjct  504  GGSGQSDASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFE  563

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  PVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>ref|XP_009101333.1| PREDICTED: DELLA protein RGA1 [Brassica rapa]
 sp|Q5BN23.1|RGA1_BRACM RecName: Full=DELLA protein RGA1; AltName: Full=BrRGA1; AltName: 
Full=RGA-like protein 1 [Brassica rapa]
 gb|AAX33297.1| DELLA protein [Brassica rapa]
Length=573

 Score =   262 bits (670),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  410  LHKLLGRTGGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  469

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  470  APSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHL  522

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQAS LLALF GG+GYRVEEN+G L L WHTRPLI TSAWKL++
Sbjct  523  GSNAFKQASTLLALFNGGEGYRVEENNGCLMLSWHTRPLITTSAWKLSA  571



>gb|AFD62396.1| reduced height-2 [Eragrostis tef]
 gb|AFD62397.1| reduced height-2 [Eragrostis tef]
 gb|AFD62398.1| reduced height-2 [Eragrostis tef]
 gb|AFD62399.1| reduced height-2 [Eragrostis tef]
 gb|AFD62400.1| reduced height-2 [Eragrostis tef]
 gb|AFD62401.1| reduced height-2 [Eragrostis tef]
 gb|AFD62402.1| reduced height-2 [Eragrostis tef]
 gb|AFD62403.1| reduced height-2 [Eragrostis tef]
 gb|AFD62404.1| reduced height-2 [Eragrostis tef]
 gb|AFD62405.1| reduced height-2 [Eragrostis tef]
 gb|AFD62406.1| reduced height-2 [Eragrostis tef]
 gb|AFD62407.1| reduced height-2 [Eragrostis tef]
 gb|AFD62408.1| reduced height-2 [Eragrostis tef]
 gb|AFD62409.1| reduced height-2 [Eragrostis tef]
 gb|AFD62410.1| reduced height-2 [Eragrostis tef]
 gb|AFD62411.1| reduced height-2 [Eragrostis tef]
 gb|AFD62412.1| reduced height-2 [Eragrostis tef]
Length=617

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  CAASEG----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
              + +     GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF 
Sbjct  504  GGSGQSDASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGFE  563

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  PVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  616



>tpg|DAA50918.1| TPA: dwarf plant8 [Zea mays]
Length=584

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 140/174 (80%), Gaps = 7/174 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  405  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  464

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
              A  G        A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR+R   +
Sbjct  465  AGAGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRSRLGGS  524

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            GF+ VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  525  GFAPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  578



>gb|AFD62360.1| reduced height-1 [Eragrostis tef]
 gb|AFD62361.1| reduced height-1 [Eragrostis tef]
 gb|AFD62362.1| reduced height-1 [Eragrostis tef]
 gb|AFD62363.1| reduced height-1 [Eragrostis tef]
 gb|AFD62364.1| reduced height-1 [Eragrostis tef]
 gb|AFD62365.1| reduced height-1 [Eragrostis tef]
 gb|AFD62366.1| reduced height-1 [Eragrostis tef]
 gb|AFD62367.1| reduced height-1 [Eragrostis tef]
 gb|AFD62368.1| reduced height-1 [Eragrostis tef]
 gb|AFD62379.1| reduced height-1 [Eragrostis tef]
 gb|AFD62380.1| reduced height-1 [Eragrostis tef]
 gb|AFD62381.1| reduced height-1 [Eragrostis tef]
 gb|AFD62382.1| reduced height-1 [Eragrostis tef]
 gb|AFD62383.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  -----CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
                   A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  GGSGQSDAASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|AFD62369.1| reduced height-1 [Eragrostis tef]
 gb|AFD62370.1| reduced height-1 [Eragrostis tef]
 gb|AFD62371.1| reduced height-1 [Eragrostis tef]
 gb|AFD62372.1| reduced height-1 [Eragrostis tef]
 gb|AFD62373.1| reduced height-1 [Eragrostis tef]
 gb|AFD62374.1| reduced height-1 [Eragrostis tef]
 gb|AFD62375.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  -----CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
                   A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  GGSGQSDAASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|AFD62384.1| reduced height-1 [Eragrostis tef]
 gb|AFD62389.1| reduced height-1 [Eragrostis tef]
 gb|AFD62390.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   263 bits (673),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 141/174 (81%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVEQEANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEQEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  -----CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
                   A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  GGSGQSDAASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>gb|ADD71137.1| DELLA protein [Brassica napus]
Length=579

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 141/169 (83%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKVL VV+ +KP I TVVEQE++HNGP F+DRFTESLHYYSTLFDSLEG
Sbjct  416  LHKLLGRTGGIEKVLGVVKQIKPVIFTVVEQESSHNGPDFLDRFTESLHYYSTLFDSLEG  475

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF ++GF+  HL
Sbjct  476  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALF GG+GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  529  GSNAFKQASMLLALFNGGEGYRVEENNGCLMLGWHTRPLITTSAWKLSA  577



>gb|KEH34625.1| DELLA domain GRAS family transcription factor GAI [Medicago truncatula]
Length=547

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 143/175 (82%), Gaps = 8/175 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LARPG++EKVL+ V+ + P+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  367  LHTMLARPGSVEKVLNTVKKINPKIVTIVEQEANHNGPVFVDRFTEALHYYSSLFDSLEG  426

Query  483  CAASE--------GGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKS  328
              +S         G     QD +MSE+YLG+QICNVVA EGVDRVERHETL QWR+R  S
Sbjct  427  SNSSSNNSNSNSTGLGSPSQDLLMSEIYLGKQICNVVAYEGVDRVERHETLTQWRSRMGS  486

Query  327  AGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            AGF  VHLG NA+KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL
Sbjct  487  AGFEPVHLGSNAFKQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKL  541



>ref|XP_002876760.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53019.1| RGA1 protein [Arabidopsis lyrata subsp. lyrata]
Length=580

 Score =   262 bits (669),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 141/169 (83%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  416  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  475

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  +L
Sbjct  476  VPSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGFAPANL  528

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL+++  G GYRVEEN+G L LGWHTRPLI TSAWKL++
Sbjct  529  GSNAFKQASMLLSVYNSGQGYRVEENNGCLMLGWHTRPLITTSAWKLST  577



>emb|CDY17662.1| BnaA06g34810D [Brassica napus]
Length=572

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G IEKV  VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  409  LHKLLGRTGGIEKVFGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  468

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+GF+  HL
Sbjct  469  APSS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFAPAHL  521

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQAS LLALF GG+GYRVE+N+G L L WHTRPLI TSAWKL++
Sbjct  522  GSNAFKQASTLLALFNGGEGYRVEKNNGCLMLSWHTRPLITTSAWKLSA  570



>gb|AAZ08572.1| truncated gibberellic acid-insensitive isoform 1 [Saccharum hybrid 
cultivar Co 419]
 gb|AAZ08573.1| truncated gibberellic acid-insensitive isoform 2 [Saccharum hybrid 
cultivar Co 419]
 gb|AAZ08574.1| truncated gibberellic acid-insensitive isoform 3 [Saccharum hybrid 
cultivar Co 419]
Length=442

 Score =   257 bits (657),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  268  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  327

Query  483  CAASEG-----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              + +       A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   +GF
Sbjct  328  AGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGGSGF  387

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALF GGDGY+VEE DG LTLGWHTRPLIATSAW+L +
Sbjct  388  EPVHLGSNAYKQASTLLALFNGGDGYKVEEKDGCLTLGWHTRPLIATSAWRLAA  441



>gb|AFC88481.1| DELLA protein [Rosa lucieae]
Length=562

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 138/169 (82%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGAIEKV++ ++ M P+IVT+VEQEANHNGPVF+DRF ESLHYYS+LFDSLEG
Sbjct  397  LHCLLARPGAIEKVMASIKAMNPKIVTMVEQEANHNGPVFLDRFNESLHYYSSLFDSLEG  456

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             +         +D VMSEVYLGRQICNVVAC+G DRVERHETL QWR R   AGF  VHL
Sbjct  457  SSGPS------EDLVMSEVYLGRQICNVVACDGGDRVERHETLTQWRNRLARAGFEPVHL  510

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G N +KQA  LLAL+AGG GY+VEEN+G LTLGWHTRPLIATSAW+L S
Sbjct  511  GSNVFKQAQTLLALYAGGGGYQVEENNGSLTLGWHTRPLIATSAWQLAS  559



>ref|XP_009590329.1| PREDICTED: DELLA protein GAI-like [Nicotiana tomentosiformis]
Length=560

 Score =   260 bits (664),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/174 (72%), Positives = 142/174 (82%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL+ ++ M P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  381  LHRLLARPGAVEKVLNSIKQMNPKIVTIVEQEANHNASVFLDRFNEALHYYSTMFDSLES  440

Query  483  CAASEGGA-----VCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              ++         V + D VMSEVYLGRQICNVVACEG DRVERHETL+QWR R  SAGF
Sbjct  441  SVSTSSTGSTQPIVNNHDLVMSEVYLGRQICNVVACEGADRVERHETLSQWRVRMNSAGF  500

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAW+  +
Sbjct  501  DPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWRFKA  554



>ref|XP_011097451.1| PREDICTED: DELLA protein GAI-like [Sesamum indicum]
Length=565

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 144/169 (85%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVL+ ++ + P+IVT+VEQEA+HNG  F++RF E+LHYYST+FDSLE 
Sbjct  398  LHRLLSRPGAIEKVLNSIKAINPKIVTIVEQEADHNGNNFLERFNEALHYYSTMFDSLES  457

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               ++  +   QD  M+EVYLGRQICNVVACEG +RVERHETLA+WR R +SAGFS  HL
Sbjct  458  SGPTQPDS---QDLAMTEVYLGRQICNVVACEGAERVERHETLARWRRRMESAGFSPAHL  514

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAW+LT+
Sbjct  515  GSNAFKQASMLLALFAGGDGYRVEENEGCLMLGWHTRPLIATSAWRLTA  563



>gb|EPS67815.1| hypothetical protein M569_06957, partial [Genlisea aurea]
Length=516

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 143/169 (85%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPG+I+ VL +V+++KPEI+TVVEQEANH G +F+DRF E+LHYYSTLFDSLE 
Sbjct  348  LHRLLSRPGSIDGVLKLVRELKPEILTVVEQEANHGGNIFLDRFNEALHYYSTLFDSLES  407

Query  483  ---CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
                AA+  G+  D+D++M+EVYLGRQIC++VACEG DRVERHETLAQWR RF S GF+ 
Sbjct  408  GAAAAAAADGSATDEDRLMTEVYLGRQICDIVACEGADRVERHETLAQWRARFGSRGFTP  467

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            V LG N YKQA +LL LFAGGDGYRVEENDG L LGWHTRPLIATSAWK
Sbjct  468  VRLGSNVYKQAILLLGLFAGGDGYRVEENDGCLMLGWHTRPLIATSAWK  516



>ref|XP_011099949.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein GAI [Sesamum indicum]
Length=565

 Score =   259 bits (663),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAI KVL+ ++ M P+IVTVVEQEANHNG VF+DRF E+LHYYST+FDSLE 
Sbjct  398  LHRLLARPGAINKVLNSIKAMNPKIVTVVEQEANHNGDVFLDRFNEALHYYSTMFDSLES  457

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               +   +    D VM+EVYLGRQIC+VVA +G +RVERHETLAQWR+R  SAGF  VHL
Sbjct  458  SGLTPANS---HDLVMTEVYLGRQICDVVAYDGPERVERHETLAQWRSRMHSAGFDPVHL  514

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLI TSAW+L +
Sbjct  515  GSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLITTSAWRLAA  563



>emb|CAA75493.1| GRS protein [Arabidopsis thaliana]
Length=587

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  423  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  482

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HL
Sbjct  483  VPNS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHL  535

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  536  GSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>gb|AAK97709.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
Length=587

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  423  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  482

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HL
Sbjct  483  VPNS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHL  535

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  536  GSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>ref|NP_178266.1| DELLA protein RGA [Arabidopsis thaliana]
 sp|Q9SLH3.1|RGA_ARATH RecName: Full=DELLA protein RGA; AltName: Full=GAI-related sequence; 
AltName: Full=GRAS family protein 10; Short=AtGRAS-10; 
AltName: Full=Repressor on the ga1-3 mutant; AltName: Full=Restoration 
of growth on ammonia protein 1 [Arabidopsis thaliana]
 gb|AAC67333.1| putative RGA1, giberellin repsonse modulation protein [Arabidopsis 
thaliana]
 gb|AAL06821.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AAQ65090.1| At2g01570/F2I9.19 [Arabidopsis thaliana]
 gb|AEC05469.1| DELLA protein RGA [Arabidopsis thaliana]
Length=587

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  423  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  482

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HL
Sbjct  483  VPNS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHL  535

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  536  GSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>emb|CAA72177.1| RGA1 protein [Arabidopsis thaliana]
Length=587

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 139/169 (82%), Gaps = 7/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL RPG IEKVL VV+ +KP I TVVEQE+NHNGPVF+DRFTESLHYYSTLFDSLEG
Sbjct  423  LHKLLGRPGGIEKVLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEG  482

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
               S       QDKVMSEVYLG+QICN+VACEG DRVERHETL+QW  RF S+G +  HL
Sbjct  483  VPNS-------QDKVMSEVYLGKQICNLVACEGPDRVERHETLSQWGNRFGSSGLAPAHL  535

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLL++F  G GYRVEE++G L LGWHTRPLI TSAWKL++
Sbjct  536  GSNAFKQASMLLSVFNSGQGYRVEESNGCLMLGWHTRPLITTSAWKLST  584



>ref|XP_004140302.1| PREDICTED: DELLA protein GAI-like [Cucumis sativus]
Length=597

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGAIEKVL  ++  KP+IVT+VEQEANHNGP+F+DRFTE+LHYYS LFDSLEG
Sbjct  432  LHRLLARPGAIEKVLGSIKTTKPKIVTIVEQEANHNGPIFLDRFTEALHYYSNLFDSLEG  491

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +S G     +D ++SEVYLG+QICNVVACEG +RVERHE+L+QWR+R +S+GF  VHL
Sbjct  492  --SSSGFEPGSEDVLLSEVYLGKQICNVVACEGTNRVERHESLSQWRSRMESSGFDPVHL  549

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIAT-SAWKL  163
            G NA+KQASMLLALFAGG+GYRVEEN+G L LGWHTRPLIA+ S W L
Sbjct  550  GSNAFKQASMLLALFAGGEGYRVEENNGCLMLGWHTRPLIASRSEWTL  597



>ref|XP_003560731.1| PREDICTED: DELLA protein SLN1 [Brachypodium distachyon]
Length=623

 Score =   260 bits (665),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 140/174 (80%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LL++PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  449  MHRLLSQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  508

Query  483  CAA-----SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              +     S G A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  509  AGSGQSEISPGAAAGATDQVMSEVYLGRQICNVVACEGPERTERHETLGQWRGRLGQAGF  568

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGY+VEE DG LTLGWHTRPLIATSAW++ +
Sbjct  569  ETVHLGSNAYKQASTLLALFAGGDGYKVEEKDGCLTLGWHTRPLIATSAWRMAA  622



>ref|XP_004503135.1| PREDICTED: DELLA protein GAI-like [Cicer arietinum]
Length=622

 Score =   259 bits (663),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 150/178 (84%), Gaps = 6/178 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LARPG+IEKVL+ V+ +KP+IVT+VEQEANHNGPVF+DRFTE+LHYYS+LFDSLEG
Sbjct  447  LHSMLARPGSIEKVLNTVKRIKPKIVTIVEQEANHNGPVFVDRFTEALHYYSSLFDSLEG  506

Query  483  CAASEGGAVCD----QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
             +++   +       QD +MSE+YLGRQICNVVA EGVDRVERHETL+QWR+R  +AGF 
Sbjct  507  SSSNSSSSTGSGSSGQDLLMSELYLGRQICNVVAYEGVDRVERHETLSQWRSRMGAAGFD  566

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTES  142
             VHLG NA+KQAS LLALFAGGDGYRVEEN+G L LGWHTR LIATSAWKL   L+ES
Sbjct  567  PVHLGSNAFKQASTLLALFAGGDGYRVEENNGCLMLGWHTRSLIATSAWKLP--LSES  622



>gb|EMS65108.1| hypothetical protein TRIUR3_18790 [Triticum urartu]
Length=407

 Score =   253 bits (647),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  228  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  287

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  288  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  347

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  348  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  406



>ref|XP_002466594.1| hypothetical protein SORBIDRAFT_01g010660 [Sorghum bicolor]
 gb|EER93592.1| hypothetical protein SORBIDRAFT_01g010660 [Sorghum bicolor]
Length=627

 Score =   259 bits (662),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  453  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  512

Query  483  CAASEG-----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              + +       A    D+VMSEVYLGRQICNVVACEG +R ERHETL+QWR R   +GF
Sbjct  513  AGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLSQWRGRLVGSGF  572

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALF GGDGYRVEE DG LTLGWHTRPLIATSAW+L +
Sbjct  573  EPVHLGSNAYKQASTLLALFNGGDGYRVEEKDGCLTLGWHTRPLIATSAWRLAA  626



>ref|XP_010916517.1| PREDICTED: DELLA protein SLR1 isoform X1 [Elaeis guineensis]
 ref|XP_010916518.1| PREDICTED: DELLA protein SLR1 isoform X2 [Elaeis guineensis]
 ref|XP_010916519.1| PREDICTED: DELLA protein SLR1 isoform X3 [Elaeis guineensis]
Length=647

 Score =   259 bits (663),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 141/173 (82%), Gaps = 4/173 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL  V+ ++P IVTVVEQEANHN   F++RFTE+LHYYST+FDSLEG
Sbjct  467  LHRLLARPGALEKVLGTVRAVRPRIVTVVEQEANHNAGSFLERFTEALHYYSTMFDSLEG  526

Query  483  -CAASEGGAVC---DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFS  316
             C A+          QD+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF 
Sbjct  527  GCTAAAAEVAAGGGQQDRVMSEVYLGRQICNVVACEGAERTERHETLGQWRGRMTRAGFE  586

Query  315  AVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             VHLG NA+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  587  PVHLGSNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAT  639



>gb|AAZ08571.1| gibberellic acid-insensitive [Saccharum hybrid cultivar Co 419]
Length=618

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 138/174 (79%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  444  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  503

Query  483  CAASEG-----GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
              + +       A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   +GF
Sbjct  504  AGSGQSTDASPAAAGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGGSGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALF GGDGY+VEE DG LTLGWHTRPLIATSAW+L +
Sbjct  564  EPVHLGSNAYKQASTLLALFNGGDGYKVEEKDGCLTLGWHTRPLIATSAWRLAA  617



>ref|XP_010528540.1| PREDICTED: DELLA protein RGL1 [Tarenaya hassleriana]
Length=546

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 139/169 (82%), Gaps = 8/169 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEKV S ++ +KP+I+TVVEQEANHNG VF+DRFTESLHY S+LFDSLEG
Sbjct  385  LHRLLARTGSIEKVFSTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYSSSLFDSLEG  444

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD++MSE++LGRQI N+VACEG DRVERHETL+QWR RF SAGF  VHL
Sbjct  445  PPS--------QDRIMSELFLGRQILNLVACEGPDRVERHETLSQWRIRFGSAGFEPVHL  496

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NAYKQASMLLALFAG DGYRVEENDG L LGW  RPLI TSAW+L +
Sbjct  497  GSNAYKQASMLLALFAGADGYRVEENDGCLLLGWQMRPLIGTSAWRLAA  545



>ref|NP_001234365.1| DELLA protein GAI [Solanum lycopersicum]
 sp|Q7Y1B6.1|GAI_SOLLC RecName: Full=DELLA protein GAI; AltName: Full=Gibberellic acid-insensitive 
mutant protein [Solanum lycopersicum]
 gb|AAP22369.1| GAI-like protein [Solanum lycopersicum]
Length=588

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 147/187 (79%), Gaps = 12/187 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  400  LHRLLSRPGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLES  459

Query  483  CAAS---------EGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFK  331
              +S             V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  
Sbjct  460  SGSSSSASPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMN  519

Query  330  SAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*L  151
            S+GF  VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL   L
Sbjct  520  SSGFDPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKL---L  576

Query  150  TESDHGA  130
             +S  GA
Sbjct  577  PDSGTGA  583



>gb|AEI25530.1| gibberellic acid insensitive protein [Solanum tuberosum]
Length=588

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 143/177 (81%), Gaps = 9/177 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  400  LHRLLSRPGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLES  459

Query  483  CAASEGG---------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFK  331
              +S             V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  
Sbjct  460  SGSSSSASPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMN  519

Query  330  SAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            S+GF  VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL+
Sbjct  520  SSGFDPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKLS  576



>ref|XP_006364643.1| PREDICTED: DELLA protein GAI-like [Solanum tuberosum]
Length=588

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 143/177 (81%), Gaps = 9/177 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL+RPGAIEKVL+ ++ + P+IVT+VEQEANHN  VF+DRF E+LHYYST+FDSLE 
Sbjct  400  LHRLLSRPGAIEKVLNSIKQINPKIVTLVEQEANHNAGVFIDRFNEALHYYSTMFDSLES  459

Query  483  CAASEGG---------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFK  331
              +S             V +QD VMSEVYLGRQICNVVACEG DRVERHETL QWR R  
Sbjct  460  SGSSSSASPTGILPQPPVNNQDLVMSEVYLGRQICNVVACEGSDRVERHETLNQWRVRMN  519

Query  330  SAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            S+GF  VHLG NA+KQASMLLALFAGGDGYRVEENDG L LGWHTRPLIATSAWKL+
Sbjct  520  SSGFDPVHLGSNAFKQASMLLALFAGGDGYRVEENDGCLMLGWHTRPLIATSAWKLS  576



>ref|XP_002884379.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60638.1| hypothetical protein ARALYDRAFT_477591 [Arabidopsis lyrata subsp. 
lyrata]
Length=545

 Score =   256 bits (653),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 145/185 (78%), Gaps = 16/185 (9%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEK+L+ V+ +KP I+TVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  376  LHRLLARSGSIEKLLNTVKAIKPSIITVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-  434

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                + G++  QD+VMSEVYLGRQI NVVA EG DRVERHET+AQWR R KSAGF  VHL
Sbjct  435  ----DSGSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETVAQWRIRMKSAGFDPVHL  490

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTESDHGAIG  124
            G +A+KQASMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL            G
Sbjct  491  GSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKLA-----------G  539

Query  123  GSESR  109
            G ESR
Sbjct  540  GGESR  544



>ref|XP_006650473.1| PREDICTED: DELLA protein SLR1-like [Oryza brachyantha]
Length=618

 Score =   257 bits (656),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V  ++P I+TVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  444  LHRLLAQPGALEKVLGTVHAVRPRIITVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  503

Query  483  CAA-----SEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
             ++     S   A    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  GSSGQAELSPPAAGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  617



>gb|EEE59780.1| hypothetical protein OsJ_12286 [Oryza sativa Japonica Group]
Length=639

 Score =   257 bits (657),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  449  LHRLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  508

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
             ++ +        G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   A
Sbjct  509  GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRA  568

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS*LTE  145
            GF  VHLG NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ + L  
Sbjct  569  GFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAAALIA  628

Query  144  SDHGAI  127
            +D   +
Sbjct  629  NDRSGL  634



>ref|XP_004982031.1| PREDICTED: DELLA protein DWARF8-like [Setaria italica]
Length=621

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 136/172 (79%), Gaps = 6/172 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  446  LHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  505

Query  483  CAASEGGAVCDQ------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAG  322
              +    A          D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AG
Sbjct  506  AGSDNSAADASPAPAGGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRLGRAG  565

Query  321  FSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWK  166
            F  VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW+
Sbjct  566  FEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWR  617



>gb|AFD62376.1| reduced height-1 [Eragrostis tef]
 gb|AFD62377.1| reduced height-1 [Eragrostis tef]
 gb|AFD62378.1| reduced height-1 [Eragrostis tef]
Length=618

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 139/174 (80%), Gaps = 5/174 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P+IVTVVE EANHN   F+DRFT+SLHYYST+FDSLEG
Sbjct  444  MHRLLAQPGALEKVLGTVRAVRPKIVTVVEHEANHNSGSFLDRFTQSLHYYSTMFDSLEG  503

Query  483  -----CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGF  319
                   A+  GA    D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   AGF
Sbjct  504  GGSGQSDAASPGAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLVQWRNRLGRAGF  563

Query  318  SAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSA +L +
Sbjct  564  EPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSACRLAA  617



>emb|CBX87014.1| DELLA protein [Triticum aestivum]
Length=555

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  376  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  435

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  436  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  495

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  496  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  554



>ref|XP_006400288.1| hypothetical protein EUTSA_v100155351mg, partial [Eutrema salsugineum]
 gb|ESQ41741.1| hypothetical protein EUTSA_v100155351mg, partial [Eutrema salsugineum]
Length=459

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 142/169 (84%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG+IEK+L+ V+ +KP IVTVVEQEANHNG VF++RF E+LHYYS+LFDSLE 
Sbjct  240  LHPLLARPGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLERFNEALHYYSSLFDSLE-  298

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI NVVA EGV+RVERHETLAQWR R  SAGF+ V+L
Sbjct  299  ----DGLILPSQDRVMSEVYLGRQILNVVAAEGVERVERHETLAQWRKRMGSAGFNPVNL  354

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLALFAGGDGYRVEEN+G L L W T+PLIA SAWKL++
Sbjct  355  GSDAFKQASLLLALFAGGDGYRVEENEGSLMLAWQTKPLIAASAWKLSA  403



>gb|ABI84226.1| dwarf plant9 [Zea mays]
Length=622

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 138/177 (78%), Gaps = 8/177 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PG ++KVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  445  LHRLLAQPGTLDKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  504

Query  483  CA--------ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKS  328
                      AS   A    D+VMSEVYLGRQICN+VACEG +R ERHETL QWR R   
Sbjct  505  AGSGSGQPTDASSPAAAGGTDQVMSEVYLGRQICNIVACEGAERTERHETLVQWRGRLGG  564

Query  327  AGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            +GF  VHLG NAYKQAS LLALFAGGDGYRVE+ DG LTLGWHTRPLIATSAW++ +
Sbjct  565  SGFEPVHLGSNAYKQASTLLALFAGGDGYRVEKKDGCLTLGWHTRPLIATSAWRVAA  621



>emb|CBW30283.1| RHT-A1 protein [Triticum aestivum]
 gb|AGG68466.1| DELLA protein [Triticum aestivum]
Length=620

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|AHK61037.1| DELLA protein, partial [Psathyrostachys huashanica]
Length=617

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 139/178 (78%), Gaps = 9/178 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  439  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  498

Query  483  CAASEGGAVCD---------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFK  331
              +     V            D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R  
Sbjct  499  AGSGGPSEVSSGAAAAAPAATDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLG  558

Query  330  SAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  559  NAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  616



>gb|AGG68491.1| DELLA protein [Triticum aestivum]
 gb|AGG68492.1| DELLA protein [Triticum dicoccoides]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30285.1| RHT-B1 protein [Triticum aestivum]
 gb|AGG68484.1| DELLA protein [Triticum aestivum]
 gb|AGG68485.1| DELLA protein [Triticum aestivum]
 gb|AGG68535.1| DELLA protein [Triticum aestivum]
 gb|AGG68536.1| DELLA protein [Triticum aestivum]
 gb|AGG68537.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|AAX07462.1| gibberellic acid-insensitive [Oryza sativa Indica Group]
Length=625

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 139/176 (79%), Gaps = 7/176 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  449  LHRLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  508

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
             ++ +        G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   A
Sbjct  509  GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRA  568

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            GF  VHLG NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  569  GFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>gb|AGG68490.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30286.1| RHT-B1 protein [Triticum aestivum]
 gb|AGG68481.1| DELLA protein [Triticum aestivum]
 gb|AGG68482.1| DELLA protein [Triticum aestivum]
 gb|AGG68483.1| DELLA protein [Triticum aestivum]
 gb|AGG68530.1| DELLA protein [Triticum aestivum]
 gb|AGG68531.1| DELLA protein [Triticum aestivum]
 gb|AGG68532.1| DELLA protein [Triticum aestivum]
 gb|AGG68533.1| DELLA protein [Triticum aestivum]
 gb|AGG68534.1| DELLA protein [Triticum aestivum]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|AEV92815.1| DELLA protein [Triticum aestivum]
 emb|CBW30284.1| RHT-B1 protein [Triticum aestivum]
 gb|AFW04248.1| DELLA [Triticum aestivum]
 gb|AGG68486.1| DELLA protein [Triticum aestivum]
 gb|AGG68487.1| DELLA protein [Triticum aestivum]
 gb|AGG68488.1| DELLA protein [Triticum aestivum]
 gb|AGG68493.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68522.1| DELLA protein [Triticum aestivum]
 gb|AGG68523.1| DELLA protein [Triticum aestivum]
 gb|AGG68524.1| DELLA protein [Triticum aestivum]
 gb|AGG68525.1| DELLA protein [Triticum aestivum]
 gb|AGG68526.1| DELLA protein [Triticum aestivum]
 gb|AGG68527.1| DELLA protein [Triticum aestivum]
 gb|AGG68528.1| DELLA protein [Triticum aestivum]
 gb|AGG68529.1| DELLA protein [Triticum aestivum]
 gb|AGG68538.1| DELLA protein [Triticum aestivum]
 gb|AGG68539.1| DELLA protein [Triticum aestivum]
 gb|AGG68540.1| DELLA protein [Triticum aestivum]
 gb|AGO59330.1| DELLA protein [Triticum aestivum]
 gb|AGQ43578.1| DELLA [Triticum aestivum]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>emb|CBW30287.1| RHT-B1 protein [Triticum aestivum]
Length=621

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  442  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  501

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  502  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  561

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  562  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  620



>gb|EAY91579.1| hypothetical protein OsI_13213 [Oryza sativa Indica Group]
Length=625

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 139/176 (79%), Gaps = 7/176 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  449  LHRLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  508

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
             ++ +        G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   A
Sbjct  509  GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRA  568

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            GF  VHLG NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  569  GFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>ref|NP_001051032.1| Os03g0707600 [Oryza sativa Japonica Group]
 sp|Q7G7J6.1|SLR1_ORYSJ RecName: Full=DELLA protein SLR1; AltName: Full=Gibberellic acid-insensitive 
mutant protein; AltName: Full=OsGAI; AltName: 
Full=Protein SLENDER RICE1 [Oryza sativa Japonica Group]
 gb|AAK50137.1|AC087797_22 gibberellin-insensitive protein OsGAI [Oryza sativa Japonica 
Group]
 dbj|BAA90749.1| OsGAI [Oryza sativa Japonica Group]
 gb|ABF98475.1| gibberellin response modulator, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAE96289.1| DELLA protein [Oryza sativa Japonica Group]
 dbj|BAF12946.1| Os03g0707600 [Oryza sativa Japonica Group]
Length=625

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 139/176 (79%), Gaps = 7/176 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PGA+EKVL  V  ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  449  LHRLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  508

Query  483  CAASEG-------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSA  325
             ++ +        G     D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   A
Sbjct  509  GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLGRA  568

Query  324  GFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            GF  VHLG NAYKQAS LLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  569  GFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  624



>emb|CCD31540.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|ADM32428.1| DELLA protein Rht-A1 [Triticum aestivum]
 gb|AEV92814.1| DELLA protein [Triticum aestivum]
 emb|CBW30282.1| RHT-A1 protein [Triticum aestivum]
 gb|AFW04244.1| DELLA [Triticum aestivum]
 gb|AFW04253.1| DELLA [Triticum urartu]
 gb|AGG68461.1| DELLA protein [Triticum aestivum]
 gb|AGG68463.1| DELLA protein [Triticum aestivum]
 gb|AGG68465.1| DELLA protein [Triticum aestivum]
 gb|AGG68467.1| DELLA protein [Triticum aestivum]
 gb|AGG68468.1| DELLA protein [Triticum aestivum]
 gb|AGG68469.1| DELLA protein [Triticum aestivum]
 gb|AGG68470.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68471.1| DELLA protein [Triticum dicoccoides]
 gb|AGG68494.1| DELLA protein [Triticum aestivum]
 gb|AGG68495.1| DELLA protein [Triticum aestivum]
 gb|AGG68496.1| DELLA protein [Triticum aestivum]
 gb|AGG68497.1| DELLA protein [Triticum aestivum]
 gb|AGG68498.1| DELLA protein [Triticum aestivum]
 gb|AGG68499.1| DELLA protein [Triticum aestivum]
 gb|AGG68500.1| DELLA protein [Triticum aestivum]
 gb|AGG68501.1| DELLA protein [Triticum aestivum]
 gb|AGG68502.1| DELLA protein [Triticum aestivum]
 gb|AGG68503.1| DELLA protein [Triticum aestivum]
 gb|AGG68504.1| DELLA protein [Triticum aestivum]
 gb|AGG68505.1| DELLA protein [Triticum aestivum]
 gb|AGG68506.1| DELLA protein [Triticum aestivum]
 gb|AGG68507.1| DELLA protein [Triticum aestivum]
 gb|AGG68508.1| DELLA protein [Triticum aestivum]
 gb|AGG68509.1| DELLA protein [Triticum aestivum]
 gb|AGG68510.1| DELLA protein [Triticum aestivum]
 gb|AGG68511.1| DELLA protein [Triticum aestivum]
 gb|AGG68512.1| DELLA protein [Triticum aestivum]
 gb|AGG68513.1| DELLA protein [Triticum aestivum]
 gb|AGG68514.1| DELLA protein [Triticum aestivum]
 gb|AGG68515.1| DELLA protein [Triticum aestivum]
 gb|AGG68516.1| DELLA protein [Triticum aestivum]
 gb|AGG68517.1| DELLA protein [Triticum aestivum]
 gb|AGG68518.1| DELLA protein [Triticum aestivum]
 gb|AGG68519.1| DELLA protein [Triticum aestivum]
 gb|AGG68520.1| DELLA protein [Triticum aestivum]
 gb|AGG68521.1| DELLA protein [Triticum aestivum]
 gb|AGO59332.1| DELLA protein [Triticum aestivum]
 gb|AGO59333.1| DELLA protein [Triticum turgidum subsp. durum]
 gb|AGQ43577.1| DELLA [Triticum aestivum]
 emb|CCD31541.1| Reduced height-1 protein [Triticum aestivum]
 emb|CCD31542.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   255 bits (652),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|AGO59331.1| DELLA protein [Triticum turgidum subsp. durum]
Length=620

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>gb|AGG68464.1| DELLA protein [Triticum aestivum]
 emb|CCD31543.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>sp|Q8W127.1|SLN1_HORVU RecName: Full=DELLA protein SLN1; AltName: Full=Slender protein 
1 [Hordeum vulgare]
 gb|AAL66734.1|AF460219_1 nuclear transcription factor SLN1 [Hordeum vulgare subsp. vulgare]
 dbj|BAK03262.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=618

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  439  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG  498

Query  483  CAASEGGAVCDQ----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  499  GSSGGPSEVSSGGAAPAAAAGTDQVMSEVYLGRQICNVVACEGTERTERHETLGQWRNRL  558

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  559  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  617



>gb|AEV92816.1| DELLA protein [Triticum aestivum]
 gb|AEW07388.1| mutant DELLA protein [Triticum aestivum]
 gb|AEW07389.1| mutant DELLA protein [Triticum aestivum]
 gb|AGE81922.1| DELLA [Triticum aestivum]
 gb|AGE81923.1| DELLA [Triticum aestivum]
 gb|AGQ43579.1| DELLA [Triticum aestivum]
Length=651

 Score =   255 bits (652),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  472  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  531

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  532  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  591

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  592  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  650



>ref|XP_009413642.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=605

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 138/172 (80%), Gaps = 3/172 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR GA+EKVL  ++ M+P IVTVVEQEANHNG  F++RFTE+LHYYST+FDSLEG
Sbjct  431  LHRLLARQGALEKVLGTIRAMRPRIVTVVEQEANHNGETFLERFTEALHYYSTMFDSLEG  490

Query  483  CAASEGGAVCD---QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
              ++   A      +D+ MSEVYLGRQICNVVACEG DR ERHE LAQWR R   AGF  
Sbjct  491  GVSAAPDAAGGGGRRDQAMSEVYLGRQICNVVACEGADRTERHEALAQWRVRMGRAGFEP  550

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            V +G NA+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLI TSAW++ S
Sbjct  551  VPIGSNAFKQASMLLALFAGGDGYRVEEKDGSLTLGWHTRPLITTSAWRIAS  602



>emb|CBI84063.1| DELLA protein RHT1 [Triticum aestivum]
Length=555

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 139/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYS +FDSLEG
Sbjct  376  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSAMFDSLEG  435

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  436  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  495

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  496  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  554



>gb|AGG68462.1| DELLA protein [Triticum aestivum]
 emb|CCD31539.1| Reduced height-1 protein [Triticum aestivum]
Length=620

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 140/179 (78%), Gaps = 10/179 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  441  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNYGTFLDRFTESLHYYSTMFDSLEG  500

Query  483  CAASEGGAVCD----------QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRF  334
             ++     V             D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R 
Sbjct  501  GSSGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRL  560

Query  333  KSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
             +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  561  GNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  619



>ref|XP_009390245.1| PREDICTED: DELLA protein SLR1-like [Musa acuminata subsp. malaccensis]
Length=612

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 141/172 (82%), Gaps = 4/172 (2%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGA+EKVL  V+ ++P IVTVVEQEANHNG  F++RFTE+LHYYST+FDSLEG
Sbjct  431  LHGLLARPGALEKVLGTVRAVQPRIVTVVEQEANHNGGTFVERFTEALHYYSTMFDSLEG  490

Query  483  CAASEGGAVCD---QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
             A +   A C    +D+  SEVYLGRQICNVV+CEGV+R ERHETLAQWR R   AGF  
Sbjct  491  GALA-ADAACGGGRRDQAFSEVYLGRQICNVVSCEGVERTERHETLAQWRVRMGRAGFDP  549

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            V +G NA+KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  550  VAIGSNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA  601



>ref|XP_009380281.1| PREDICTED: DELLA protein SLN1-like [Musa acuminata subsp. malaccensis]
Length=595

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA++KVL  V+ ++P IVTVVEQEANHNG  F +RFTE+LHYYST+FDSLEG
Sbjct  415  LHRLLARPGALDKVLGTVRAVRPRIVTVVEQEANHNGGTFQERFTEALHYYSTMFDSLEG  474

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             AA+ G      D+ +SEVYLGRQICNVVACEG +R ERHETLAQWR R   AGF  V +
Sbjct  475  GAAAAGADDGGPDQALSEVYLGRQICNVVACEGAERTERHETLAQWRGRMDRAGFEPVPI  534

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G NA+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  535  GSNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAA  583



>ref|XP_008644580.1| PREDICTED: DELLA protein DWARF8-like [Zea mays]
 gb|ABI84225.1| dwarf plant9 [Zea mays]
 gb|AFW67870.1| dwarf plant9 [Zea mays]
Length=625

 Score =   253 bits (646),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 137/180 (76%), Gaps = 11/180 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PG ++KVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  445  LHRLLAQPGTLDKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  504

Query  483  CA-----------ASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTR  337
                          ++       D+VMSEVYLGRQICN+VACEG +R ERHETL QWR R
Sbjct  505  AGSGSGSGSGSGQPTDASPPAGTDQVMSEVYLGRQICNIVACEGAERTERHETLVQWRGR  564

Query  336  FKSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
               +GF  VHLG NAYKQAS LLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++ +
Sbjct  565  LGGSGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRVAA  624



>ref|NP_186995.1| DELLA protein RGL2 [Arabidopsis thaliana]
 sp|Q8GXW1.2|RGL2_ARATH RecName: Full=DELLA protein RGL2; AltName: Full=GRAS family protein 
15; Short=AtGRAS-15; AltName: Full=RGA-like protein 2; 
AltName: Full=Scarecrow-like protein 19; Short=AtSCL19 [Arabidopsis 
thaliana]
 gb|AAF01590.1|AC009895_11 RGA1-like protein [Arabidopsis thaliana]
 gb|AEE73945.1| DELLA protein RGL2 [Arabidopsis thaliana]
Length=547

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  385  LHRLLARSGSIEKLLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-  443

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHET AQWR R KSAGF  +HL
Sbjct  444  ----DSYSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHL  499

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL
Sbjct  500  GSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKL  546



>dbj|BAC42642.1| putative RGA1 [Arabidopsis thaliana]
Length=547

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  385  LHRLLARSGSIEKLLNTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-  443

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHET AQWR R KSAGF  +HL
Sbjct  444  ----DSYSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETAAQWRIRMKSAGFDPIHL  499

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL+L+A GDGYRVEENDG L +GW TRPLI TSAWKL
Sbjct  500  GSSAFKQASMLLSLYATGDGYRVEENDGCLMIGWQTRPLITTSAWKL  546



>ref|XP_008809806.1| PREDICTED: DELLA protein SLR1 [Phoenix dactylifera]
Length=656

 Score =   252 bits (644),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 139/175 (79%), Gaps = 8/175 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL  V+ ++P IVT VEQEANHN   F++RFTE+LHYYST+FDSLEG
Sbjct  471  LHRLLARPGALEKVLGTVRAVRPRIVTAVEQEANHNAGSFLERFTEALHYYSTMFDSLEG  530

Query  483  CAASEGGAVC--------DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKS  328
               + G A           QD+VMSEVYLGRQICNVVACEG +R ERHETL QWR R   
Sbjct  531  GCTATGAAAAAEVATGGGQQDRVMSEVYLGRQICNVVACEGAERTERHETLGQWRGRMTR  590

Query  327  AGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            AGF  VHLG NA+KQASMLLALFAGGDGYRVEE DG LTLGWHTRPLIATSAW++
Sbjct  591  AGFEPVHLGSNAFKQASMLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRV  645



>ref|XP_003538395.1| PREDICTED: DELLA protein GAI1 [Glycine max]
Length=595

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 143/170 (84%), Gaps = 1/170 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++LAR G+++KVL  V+ + P+IVT+VEQEANHNGP F+DRFTE+LHYYS+LFDSLEG
Sbjct  417  LHRMLARSGSVDKVLDTVKKINPQIVTIVEQEANHNGPGFLDRFTEALHYYSSLFDSLEG  476

Query  483  CAASEGGAVCD-QDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
             ++S  G     QD +MSE+YLGRQICNVVA EG DRVERHETL QWR R  SAGF  VH
Sbjct  477  SSSSSTGLGSPSQDLLMSELYLGRQICNVVAYEGPDRVERHETLTQWRGRLDSAGFDPVH  536

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            LG NA+KQASMLLALFAGGDGYRVEEN+G L LGWHTRPLIATSAWKL S
Sbjct  537  LGSNAFKQASMLLALFAGGDGYRVEENNGCLMLGWHTRPLIATSAWKLPS  586



>emb|CDY55037.1| BnaCnng28010D [Brassica napus]
Length=507

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+ +L  ++ +KP+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  345  LHRLLAHPGSIDNILLTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYYSSLFDSLEG  404

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             ++        QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V +
Sbjct  405  PSS--------QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVSI  456

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G  AYKQASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  457  GSYAYKQASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>gb|AGA16543.1| DELLA protein RGL2, partial [Sisymbrium officinale]
Length=533

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 138/167 (83%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  364  LHRLLARTGSIEKLLATVKAVKPSIVTVVEQEANHNGNVFLDRFNEALHYYSSLFDSLE-  422

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQW++R  S GF  V L
Sbjct  423  ----DSYSLPSQDRVMSEVYLGRQIVNVVAAEGSDRVERHETLAQWKSRMGSVGFDPVPL  478

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL++FAGGDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  479  GSSAFKQASMLLSVFAGGDGYRVEENDGCLMLGWQTRPLITTSAWKL  525



>ref|XP_008782281.1| PREDICTED: DELLA protein SLR1-like [Phoenix dactylifera]
Length=649

 Score =   251 bits (640),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 139/177 (79%), Gaps = 8/177 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL  V+ ++P IVTVVEQEANHN   F++RFTE+LHYYST+FDSLEG
Sbjct  463  LHRLLARPGALEKVLGTVRAVRPRIVTVVEQEANHNAGSFLERFTEALHYYSTMFDSLEG  522

Query  483  CAASEGGAVC--------DQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKS  328
               +   A           QD+VMSEVYLGRQICNVV CEG +R ERHETL QWR R   
Sbjct  523  GGTAGAAAAEGAVGASGGQQDQVMSEVYLGRQICNVVPCEGTERTERHETLGQWRERMTR  582

Query  327  AGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            AGF  VHLG NA+KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++ +
Sbjct  583  AGFEPVHLGSNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVPA  639



>ref|XP_006408301.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
 gb|ESQ49754.1| hypothetical protein EUTSA_v10020431mg [Eutrema salsugineum]
Length=554

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 137/167 (82%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+K+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  384  LHRLLASPGSIDKLLATVKAVKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-  442

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQWR R  SAGF  V L
Sbjct  443  ----DSYSLPSQDRVMSEVYLGRQILNVVAAEGSDRVERHETLAQWRIRMGSAGFDPVSL  498

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL+LFAGGDGYRVEE DG L LGW TRPLI TSAWKL
Sbjct  499  GSSAFKQASMLLSLFAGGDGYRVEEKDGCLMLGWQTRPLITTSAWKL  545



>ref|NP_176809.1| DELLA protein RGL1 [Arabidopsis thaliana]
 sp|Q9C8Y3.1|RGL1_ARATH RecName: Full=DELLA protein RGL1; AltName: Full=GRAS family protein 
9; Short=AtGRAS-9; AltName: Full=RGA-like protein 1; 
Short=RGA-like protein [Arabidopsis thaliana]
 gb|AAG52171.1|AC020665_16 gibberellin regulatory protein, putative; 49974-51509 [Arabidopsis 
thaliana]
 gb|AAL05911.1| RGL1 protein [Arabidopsis thaliana]
 gb|AAL49792.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AAM20156.1| putative gibberellin regulatory protein [Arabidopsis thaliana]
 gb|AEE34499.1| DELLA protein RGL1 [Arabidopsis thaliana]
Length=511

 Score =   246 bits (629),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+K LS ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  349  LHRLLAHPGSIDKFLSTIKSIRPDIMTVVEQEANHNGTVFLDRFTESLHYYSSLFDSLEG  408

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF   GF  V +
Sbjct  409  PPS--------QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGLGGFKPVSI  460

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLAL+AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  461  GSNAYKQASMLLALYAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  508



>ref|XP_006302161.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
 gb|EOA35059.1| hypothetical protein CARUB_v10020171mg [Capsella rubella]
Length=505

 Score =   246 bits (628),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/167 (69%), Positives = 136/167 (81%), Gaps = 8/167 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+K LS ++ ++P+I+T+VEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  347  LHRLLAHPGSIDKFLSTIRSIRPDIMTIVEQEANHNGTVFLDRFTESLHYYSSLFDSLEG  406

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++
Sbjct  407  SPS--------QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNI  458

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NAYKQASMLLAL AG DGY V+EN+G L LGW TRPLIATSAW L
Sbjct  459  GSNAYKQASMLLALHAGADGYSVDENEGCLLLGWQTRPLIATSAWSL  505



>ref|XP_010420475.1| PREDICTED: DELLA protein RGL3 [Camelina sativa]
Length=528

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LA+PG+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  361  LHPVLAQPGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLED  420

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD+VMSEVYLGRQI NVVA EG+DRVERHETL QWR R  +AGF  V+L
Sbjct  421  SVVIPG-----QDRVMSEVYLGRQILNVVAAEGIDRVERHETLDQWRRRMGTAGFDPVNL  475

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLALF GGDGYRVEENDG L L W T+PL+A SAWKL +
Sbjct  476  GYDAFKQASLLLALFGGGDGYRVEENDGSLMLAWQTKPLVAASAWKLAA  524



>ref|XP_010453948.1| PREDICTED: DELLA protein RGL3-like [Camelina sativa]
Length=527

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LA+PG+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  360  LHPVLAQPGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLED  419

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A   G     QD+V+SEVYLGRQI NVVA EG DRVERHETL QWR R  SAGF  V+L
Sbjct  420  SAVIPG-----QDRVLSEVYLGRQILNVVAAEGTDRVERHETLDQWRRRMGSAGFDPVNL  474

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLALF GGDGYRVEENDG L L W T+PL+A SAWKL +
Sbjct  475  GYDAFKQASLLLALFGGGDGYRVEENDGSLMLAWQTKPLVAASAWKLAA  523



>gb|AFC88482.1| DELLA protein [Rosa lucieae]
Length=564

 Score =   247 bits (630),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 138/169 (82%), Gaps = 6/169 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPGAIEKV++ ++ M P+IVT+VEQEANHNGPVF+DRF ESLHYYS+LFDSLEG
Sbjct  399  LHCLLARPGAIEKVMASIKAMNPKIVTMVEQEANHNGPVFLDRFNESLHYYSSLFDSLEG  458

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             + S       +D VMSEVYLGRQICNVVAC+G DRVERHETL QWR R   AGF  VHL
Sbjct  459  SSGSS------EDLVMSEVYLGRQICNVVACDGGDRVERHETLTQWRNRLSRAGFEPVHL  512

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G N +KQA  LLAL+AGG GY+VEEN+G L LGWHTRPLIATSAW+L S
Sbjct  513  GSNVFKQAKTLLALYAGGGGYQVEENNGSLMLGWHTRPLIATSAWQLAS  561



>ref|XP_010926472.1| PREDICTED: DELLA protein SLR1-like [Elaeis guineensis]
Length=651

 Score =   249 bits (635),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 138/175 (79%), Gaps = 8/175 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVL  V+ ++P IVT+VEQEANHN   F++RFTE+LHYYST+FDSLEG
Sbjct  463  LHRLLARPGALEKVLGTVRAVRPRIVTMVEQEANHNAGSFLERFTEALHYYSTMFDSLEG  522

Query  483  CAASEGG--------AVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKS  328
               +           ++  QD VMSEVYLGRQICNVV CEG +R ERHETL QWR R   
Sbjct  523  GGTAAAAAAEAAVGASMGQQDLVMSEVYLGRQICNVVPCEGTERTERHETLGQWRGRMTR  582

Query  327  AGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            AGF  VHLG NA+KQASMLLALFAGGDGYRVEE +G LTLGWHTRPLIATSAW++
Sbjct  583  AGFEPVHLGSNAFKQASMLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRV  637



>emb|CDY70426.1| BnaCnng68300D [Brassica napus]
Length=507

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+ +L  ++ +KP+I+TVVEQEA+HNG VF DRFTESLHYYS+LFDSLEG
Sbjct  345  LHRLLAHPGSIDNILLTIKSIKPDIITVVEQEADHNGAVFFDRFTESLHYYSSLFDSLEG  404

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V++
Sbjct  405  PPS--------QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVNI  456

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G  AYKQASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  457  GSYAYKQASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>ref|XP_008457015.1| PREDICTED: DELLA protein GAI-like [Cucumis melo]
Length=563

 Score =   246 bits (629),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/168 (70%), Positives = 137/168 (82%), Gaps = 7/168 (4%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA  GAIEKVL+ ++++ P+I+TVVEQ ANHNGP F+DRFTE+LHYYS+LFDSLEG
Sbjct  392  LHRLLAHSGAIEKVLTTIKELNPKIITVVEQVANHNGPSFVDRFTEALHYYSSLFDSLEG  451

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              A E      +D V SE YLGRQI NVVACEG DRVERHET+AQWR+R  S+GF  VHL
Sbjct  452  SPAGE------EDVVRSEEYLGRQIYNVVACEGSDRVERHETVAQWRSRLSSSGFEMVHL  505

Query  303  GXNAYKQASMLL-ALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G NA+ QAS LL ALF GG+GYRVEEN+G LTLGWHTRPLIATSAW +
Sbjct  506  GSNAFNQASTLLAALFGGGNGYRVEENNGSLTLGWHTRPLIATSAWTV  553



>ref|XP_010492705.1| PREDICTED: DELLA protein RGL3-like [Camelina sativa]
Length=529

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +LA+PG+IE++L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  362  LHPVLAQPGSIEELLATVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLED  421

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                 G     QD+VMSEVYLGRQI NVVA EG +RVERHETL QWR R +SAGF  V+L
Sbjct  422  SVVIPG-----QDRVMSEVYLGRQILNVVAAEGTERVERHETLDQWRRRMRSAGFDPVNL  476

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLALF GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  477  GYDAFKQASLLLALFGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  525



>ref|XP_009127484.1| PREDICTED: DELLA protein RGL1 [Brassica rapa]
Length=507

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 135/168 (80%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+ +L  ++ +KP+I+TVVEQEA+HNG VF DRFTESLHYYS+LFDSLEG
Sbjct  345  LHRLLAHPGSIDNILLTIKSIKPDIITVVEQEADHNGAVFFDRFTESLHYYSSLFDSLEG  404

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE+YLGRQI N+VACEG DRVERHETLAQWR RF   GF +V +
Sbjct  405  PPS--------QDRVMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVSI  456

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G  AYKQASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  457  GSYAYKQASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  504



>ref|XP_010511563.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score =   244 bits (624),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 138/168 (82%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PG+I+K +S ++ ++P+I+TVVEQEANHNG VF++RFTESLHYYS+LFDSLEG
Sbjct  346  LHRLLAQPGSIDKFISTIRSIRPDIMTVVEQEANHNGTVFVERFTESLHYYSSLFDSLEG  405

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++
Sbjct  406  PLS--------QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNI  457

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLAL AG +GY VEENDG L LGW TRPLIATSAW++ 
Sbjct  458  GSNAYKQASMLLALHAGANGYNVEENDGCLLLGWQTRPLIATSAWRIN  505



>gb|KFK41051.1| hypothetical protein AALP_AA2G079000 [Arabis alpina]
Length=506

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/168 (69%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLAR G+I+KVL  ++ + P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  343  LHHLLARTGSIDKVLLTIKSINPDIMTVVEQEANHNGDVFLDRFTESLHYYSSLFDSLEG  402

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE+YLGRQI N VACEG DRVERHETL QWR RF SAGF  V++
Sbjct  403  PPS--------QDRVMSELYLGRQILNFVACEGEDRVERHETLVQWRNRFGSAGFKPVNI  454

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASML+AL+AG DGY+VEEN+G L LGW TR LIATSAW++ 
Sbjct  455  GSNAYKQASMLVALYAGADGYKVEENEGCLLLGWQTRLLIATSAWRIN  502



>ref|XP_006299072.1| hypothetical protein CARUB_v10015212mg [Capsella rubella]
 gb|EOA31970.1| hypothetical protein CARUB_v10015212mg [Capsella rubella]
Length=552

 Score =   245 bits (626),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/167 (70%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLAR G+IEK+L  V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  386  LHRLLARSGSIEKLLETVKAVKPSIVTVVEQEANHNGVVFLDRFNEALHYYSSLFDSLE-  444

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHETL QW+ R +S GF  V+L
Sbjct  445  ----DSYSLPSQDRVMSEVYLGRQILNVVAAEGYDRVERHETLPQWKNRMRSGGFDPVNL  500

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G ++YKQASMLL++FA GDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  501  GSSSYKQASMLLSVFATGDGYRVEENDGCLMLGWQTRPLITTSAWKL  547



>ref|XP_002887024.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63283.1| hypothetical protein ARALYDRAFT_475738 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   244 bits (623),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+K LS ++ ++P I+TVVEQEANHNG  F+DRFTESLHYYS+LFDSLEG
Sbjct  349  LHRLLAHPGSIDKFLSTIKSIRPNIMTVVEQEANHNGANFLDRFTESLHYYSSLFDSLEG  408

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF S GF  V++
Sbjct  409  PPS--------QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGSRGFKPVNI  460

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLAL+AG DGY VEE++G L LGW TRPLIATSAW++ 
Sbjct  461  GSNAYKQASMLLALYAGADGYNVEEDEGCLLLGWQTRPLIATSAWRIN  508



>gb|EPS58722.1| hypothetical protein M569_16090, partial [Genlisea aurea]
Length=520

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGA-IEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLE  487
            LH LLA+P A I +VL +V+++KPEI TVVEQEAN +G  F+DRFTE+LHYYS +FDSLE
Sbjct  356  LHPLLAKPPAEIGRVLQLVRELKPEIFTVVEQEANLSGNFFLDRFTEALHYYSAIFDSLE  415

Query  486  GCAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVH  307
             C    GGA   +DK+MSEVYLGRQICNVV+CEG DR ER+ETL +W+ R   AGF  V 
Sbjct  416  SC----GGAASGEDKMMSEVYLGRQICNVVSCEGADRFERYETLERWKRRLGRAGFQPVR  471

Query  306  LGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            LG N YKQA +LLALFAGGDGYRVEENDG L LGWHTRP+IATSAWKL+
Sbjct  472  LGSNVYKQAILLLALFAGGDGYRVEENDGCLMLGWHTRPIIATSAWKLS  520



>gb|KFK38060.1| hypothetical protein AALP_AA3G064800 [Arabis alpina]
Length=545

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH++L++ G+IEK+L+ V+ +KP IVTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  376  LHRVLSKSGSIEKLLTTVKAIKPSIVTVVEQEANHNGIVFLDRFNEALHYYSSLFDSLE-  434

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +  ++  QD+VMSEVYLGRQI NVVA EG DRVERHET  QW+ R  SAGF  V L
Sbjct  435  ----DSYSLLSQDRVMSEVYLGRQILNVVAAEGSDRVERHETFTQWKGRLGSAGFDPVPL  490

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL+LFAGGDGYRVEENDG L LGW TRPLI TSAWKL
Sbjct  491  GSSAFKQASMLLSLFAGGDGYRVEENDGCLMLGWQTRPLITTSAWKL  537



>emb|CDY38434.1| BnaA10g17240D [Brassica napus]
Length=510

 Score =   243 bits (621),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 5/168 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LHQLLA+PG+IEK+L+ V+ +KP I+TVVEQEANHNG VF++RF E+LHYYS+LFDSLE 
Sbjct  340  LHQLLAQPGSIEKLLATVKAVKPSILTVVEQEANHNGVVFLERFNEALHYYSSLFDSLE-  398

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI NVVA EG DR+ERHETL QWR R  SAGF  V L
Sbjct  399  ----DGVIIPSQDRVMSEVYLGRQILNVVAAEGTDRIERHETLDQWRKRMGSAGFDPVSL  454

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G +A+KQAS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWK++
Sbjct  455  GSDAFKQASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKVS  502



>ref|XP_010470510.1| PREDICTED: DELLA protein RGL1 isoform X1 [Camelina sativa]
 ref|XP_010470511.1| PREDICTED: DELLA protein RGL1 isoform X2 [Camelina sativa]
Length=508

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PG+I+K +S ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  346  LHRLLAQPGSIDKFISTIRSIRPDIMTVVEQEANHNGTVFVDRFTESLHYYSSLFDSLEG  405

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LG+QI N+VACEG DRVERHETL QWR RF S GF  V++
Sbjct  406  PPS--------QDRVMSELFLGQQILNLVACEGEDRVERHETLNQWRNRFGSGGFKPVNI  457

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLA  AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  458  GSNAYKQASMLLAFHAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  505



>emb|CAA12242.1| RGA-like [Arabidopsis thaliana]
Length=662

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA PG+I+K LS ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  500  LHRLLAHPGSIDKFLSTIKSIRPDIMTVVEQEANHNGTVFLDRFTESLHYYSSLFDSLEG  559

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHETL QWR RF   GF  V +
Sbjct  560  PPS--------QDRVMSELFLGRQILNLVACEGEDRVERHETLNQWRNRFGLGGFKPVSI  611

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLAL+AG DGY VEEN+G L LGW TRPLIATSAW++ 
Sbjct  612  GSNAYKQASMLLALYAGADGYNVEENEGCLLLGWQTRPLIATSAWRIN  659



>ref|XP_009107522.1| PREDICTED: DELLA protein RGL3 [Brassica rapa]
Length=525

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG+IEK+L+ V+ +KP +VTVVEQEANHNG VF++RF E+LHYYS+LFDSLE 
Sbjct  355  LHPLLARPGSIEKLLATVKAVKPSVVTVVEQEANHNGVVFLERFNEALHYYSSLFDSLE-  413

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI NVVA EG DR+ERHETL QWR R  SAGF  V L
Sbjct  414  ----DGVIIPSQDRVMSEVYLGRQILNVVAAEGTDRIERHETLDQWRKRLGSAGFDPVSL  469

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G +A+KQAS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWK++
Sbjct  470  GSDAFKQASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKVS  517



>emb|CDY16915.1| BnaC09g40420D [Brassica napus]
Length=525

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 135/168 (80%), Gaps = 5/168 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH LLARPG+IEK+L+ V+ +KP IVTVVEQEANHNG VF++RF E+LHYYS+LFDSLE 
Sbjct  355  LHPLLARPGSIEKLLATVKAVKPSIVTVVEQEANHNGVVFLERFNEALHYYSSLFDSLE-  413

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI NVVA EG DR+ERHETL QWR R  SAGF  V L
Sbjct  414  ----DGVIIPSQDRVMSEVYLGRQILNVVAAEGTDRIERHETLDQWRKRLGSAGFDPVSL  469

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G +A+KQAS+LLAL  GGDGYRV+ENDG L L W T+PLIA SAWK++
Sbjct  470  GSDAFKQASLLLALSGGGDGYRVDENDGSLMLAWQTKPLIAASAWKVS  517



>ref|XP_009130367.1| PREDICTED: LOW QUALITY PROTEIN: DELLA protein RGL2 [Brassica 
rapa]
Length=543

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LL R G+IEK+L+ V+ ++P I+T+VEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  379  LHRLLNRSGSIEKLLTTVKTVRPSILTMVEQEANHNGVVFLDRFNEALHYYSSLFDSLE-  437

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +   +  QD+VMSEVYLGRQI NVVA EG DRVERHETLAQW+ R  S GF  V L
Sbjct  438  ----DSYTLPSQDRVMSEVYLGRQIVNVVAAEGTDRVERHETLAQWKARMGSVGFDPVPL  493

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            G +A+KQASMLL++FAGGDGYRVEENDG L LGW TRPLIATSAWKL
Sbjct  494  GSSAFKQASMLLSVFAGGDGYRVEENDGCLMLGWQTRPLIATSAWKL  540



>ref|NP_197251.1| DELLA protein RGL3 [Arabidopsis thaliana]
 sp|Q9LF53.1|RGL3_ARATH RecName: Full=DELLA protein RGL3; AltName: Full=GRAS family protein 
27; Short=AtGRAS-27; AltName: Full=RGA-like protein 3 
[Arabidopsis thaliana]
 emb|CAC01893.1| RGA-like protein [Arabidopsis thaliana]
 dbj|BAC41902.1| RGA-like protein [Arabidopsis thaliana]
 gb|AAO64840.1| At5g17490 [Arabidopsis thaliana]
 gb|AED92433.1| DELLA protein RGL3 [Arabidopsis thaliana]
Length=523

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +L++PG+IEK+L+ V+ +KP +VTVVEQEANHNG VF+DRF E+LHYYS+LFDSLE 
Sbjct  356  LHPVLSQPGSIEKLLATVKAVKPGLVTVVEQEANHNGDVFLDRFNEALHYYSSLFDSLE-  414

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI N+VA EG DR+ERHETLAQWR R  SAGF  V+L
Sbjct  415  ----DGVVIPSQDRVMSEVYLGRQILNLVATEGSDRIERHETLAQWRKRMGSAGFDPVNL  470

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  471  GSDAFKQASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  519



>ref|XP_010415179.1| PREDICTED: DELLA protein RGL1-like [Camelina sativa]
Length=508

 Score =   242 bits (617),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 137/168 (82%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA+PG+I+K +S ++ ++P+I+TVVEQEANHNG VF+DRFTESLHYYS+LFDSLEG
Sbjct  346  LHRLLAQPGSIDKFISTIRSIRPDIMTVVEQEANHNGTVFVDRFTESLHYYSSLFDSLEG  405

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE++LGRQI N+VACEG DRVERHE+L QWR RF S GF  V++
Sbjct  406  PPS--------QDRVMSELFLGRQILNLVACEGEDRVERHESLNQWRNRFGSGGFKPVNI  457

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NAYKQASMLLAL AG DGY VEEN+G L LGW TRPLIA SAW++ 
Sbjct  458  GSNAYKQASMLLALHAGVDGYNVEENEGCLLLGWQTRPLIAASAWQIN  505



>ref|XP_006391387.1| hypothetical protein EUTSA_v10018436mg [Eutrema salsugineum]
 gb|ESQ28673.1| hypothetical protein EUTSA_v10018436mg [Eutrema salsugineum]
Length=502

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 136/168 (81%), Gaps = 8/168 (5%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLA  G+IEK LS ++ ++P+I+TVVEQEANHNG  F+DRFTESLHYYS+LFDSLEG
Sbjct  340  LHRLLANSGSIEKFLSAIKLIEPDIMTVVEQEANHNGANFLDRFTESLHYYSSLFDSLEG  399

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
              +        QD+VMSE+YLGRQI N+VACEG DRVERHETL QWR R  S+GF  V++
Sbjct  400  PPS--------QDRVMSELYLGRQILNLVACEGEDRVERHETLNQWRNRLGSSGFKPVNI  451

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLT  160
            G NA+KQASMLLAL+AG DGY+VEEN+G L LGW TRPLIATSAW+  
Sbjct  452  GSNAFKQASMLLALYAGADGYKVEENEGCLLLGWQTRPLIATSAWRFN  499



>gb|ADO60988.1| DELLA protein 2 [Helianthus annuus]
 gb|ADO60989.1| DELLA protein 2, partial [Helianthus annuus]
Length=171

 Score =   231 bits (588),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 125/170 (74%), Gaps = 21/170 (12%)
 Frame = -3

Query  609  QDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEGCAASEG------------  466
            + M PEI+TVVEQEANHNG  F++RFTESLHYYSTLFDSLE     +G            
Sbjct  1    KQMSPEILTVVEQEANHNGTSFLERFTESLHYYSTLFDSLESSGGGDGGVGGGAAVNGGV  60

Query  465  ---------GAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSA  313
                       V  +D+ MSEVYLG+QICNVVACEGVDRVERHETL QW+TR  SAGF A
Sbjct  61   DVGVNGGGVSPVSSEDRFMSEVYLGKQICNVVACEGVDRVERHETLTQWKTRLDSAGFEA  120

Query  312  VHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
            VHLG NA+KQASMLLALFAGGDGYRV E DG L LGWHTRPLI TSAWK+
Sbjct  121  VHLGSNAFKQASMLLALFAGGDGYRVVEEDGCLMLGWHTRPLITTSAWKI  170



>gb|AAM15895.1|AF492578_1 GIA/RGA-like gibberellin response modulator [Calycadenia multiglandulosa]
Length=540

 Score =   242 bits (618),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH+LLARPGA+EKVLS +  MKP+IVT+VEQE+NHNG VFMDRF E+LHYYST+FDSLE 
Sbjct  392  LHRLLARPGAVEKVLSSITSMKPKIVTLVEQESNHNGVVFMDRFNEALHYYSTMFDSLES  451

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
             A ++  +   QD VMSEVYLGRQICNVVACEG DRVERHETL QWRTR  SAGF  VHL
Sbjct  452  SALTQPNS--QQDLVMSEVYLGRQICNVVACEGPDRVERHETLTQWRTRMISAGFEPVHL  509

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGL  214
            G NA+KQASMLLALFAGGDGYRVEENDG L
Sbjct  510  GSNAFKQASMLLALFAGGDGYRVEENDGCL  539



>ref|XP_002873832.1| hypothetical protein ARALYDRAFT_488615 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50091.1| hypothetical protein ARALYDRAFT_488615 [Arabidopsis lyrata subsp. 
lyrata]
Length=506

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 137/169 (81%), Gaps = 5/169 (3%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            LH +L++PG+IEK+L+ V  +KP +VTVVEQEANHNG  F+DRF E+LHYYS+LFDSLE 
Sbjct  339  LHPVLSQPGSIEKLLATVNAVKPGLVTVVEQEANHNGAGFLDRFNEALHYYSSLFDSLE-  397

Query  483  CAASEGGAVCDQDKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTRFKSAGFSAVHL  304
                +G  +  QD+VMSEVYLGRQI NVVA EG+DR+ERHETLAQWR R ++AGF  V+L
Sbjct  398  ----DGVVIPSQDRVMSEVYLGRQILNVVAAEGIDRIERHETLAQWRKRMENAGFDPVNL  453

Query  303  GXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
            G +A+KQAS+LLAL  GGDGYRVEENDG L L W T+PLIA SAWKL +
Sbjct  454  GSDAFKQASLLLALSGGGDGYRVEENDGSLMLAWQTKPLIAASAWKLAA  502



>gb|ADP02183.1| Rht-D1b [Triticum aestivum]
Length=559

 Score =   242 bits (618),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 140/178 (79%), Gaps = 11/178 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  379  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  438

Query  483  CAASEGGAVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTR  337
             ++  G +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R
Sbjct  439  GSSGGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNR  498

Query  336  FKSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKL  163
              +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L
Sbjct  499  LGNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRL  556



>gb|AGG68478.1| DELLA protein [Triticum aestivum]
Length=623

 Score =   243 bits (621),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 141/180 (78%), Gaps = 11/180 (6%)
 Frame = -3

Query  663  LHQLLARPGAIEKVLSVVQDMKPEIVTVVEQEANHNGPVFMDRFTESLHYYSTLFDSLEG  484
            +H+LLA+PGA+EKVL  V+ ++P IVTVVEQEANHN   F+DRFTESLHYYST+FDSLEG
Sbjct  443  MHRLLAQPGALEKVLGTVRAVRPRIVTVVEQEANHNSGTFLDRFTESLHYYSTMFDSLEG  502

Query  483  CAASEGGAVCDQ-----------DKVMSEVYLGRQICNVVACEGVDRVERHETLAQWRTR  337
             ++  G +               D+VMSEVYLGRQICNVVACEG +R ERHETL QWR R
Sbjct  503  GSSGGGPSEVSSGAAAAPAAAGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNR  562

Query  336  FKSAGFSAVHLGXNAYKQASMLLALFAGGDGYRVEENDGGLTLGWHTRPLIATSAWKLTS  157
              +AGF  VHLG NAYKQAS LLALFAGGDGY+VEE +G LTLGWHTRPLIATSAW+L +
Sbjct  563  LGNAGFETVHLGSNAYKQASTLLALFAGGDGYKVEEKEGCLTLGWHTRPLIATSAWRLAA  622



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140