BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030I21

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004242803.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    182   6e-51   Solanum lycopersicum
ref|XP_009591201.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    181   2e-50   Nicotiana tomentosiformis
ref|XP_006362449.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    180   2e-50   Solanum tuberosum [potatoes]
ref|XP_009760674.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    180   3e-50   Nicotiana sylvestris
ref|XP_009588089.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...    180   3e-50   Nicotiana tomentosiformis
emb|CDP19091.1|  unnamed protein product                                177   2e-49   Coffea canephora [robusta coffee]
ref|XP_002265238.2|  PREDICTED: probable tyrosine--tRNA ligase, m...    174   2e-48   Vitis vinifera
ref|XP_010110726.1|  Tyrosine--tRNA ligase                              173   5e-48   Morus notabilis
ref|XP_004303944.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    171   3e-47   Fragaria vesca subsp. vesca
gb|KDP41896.1|  hypothetical protein JCGZ_26914                         171   4e-47   Jatropha curcas
ref|XP_007022036.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    169   3e-46   
ref|XP_002512791.1|  tyrosyl-tRNA synthetase, putative                  167   7e-46   
ref|XP_007222608.1|  hypothetical protein PRUPE_ppa004925mg             166   2e-45   Prunus persica
ref|XP_003574045.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    167   2e-45   Brachypodium distachyon [annual false brome]
ref|XP_008218548.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    166   4e-45   Prunus mume [ume]
ref|XP_006645923.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    166   4e-45   
gb|KCW55733.1|  hypothetical protein EUGRSUZ_I01565                     165   4e-45   Eucalyptus grandis [rose gum]
ref|NP_001043131.1|  Os01g0500900                                       166   5e-45   
gb|EMT07165.1|  Tyrosyl-tRNA synthetase                                 166   5e-45   
ref|XP_008339493.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    165   5e-45   
ref|XP_006375482.1|  hypothetical protein POPTR_0014s13650g             162   5e-45   
ref|XP_008339494.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    165   6e-45   
ref|XP_004146892.1|  PREDICTED: tyrosine--tRNA ligase-like              165   7e-45   Cucumis sativus [cucumbers]
dbj|BAK00149.1|  predicted protein                                      165   7e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004166614.1|  PREDICTED: tyrosine--tRNA ligase-like              165   8e-45   
ref|XP_010028900.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    165   8e-45   Eucalyptus grandis [rose gum]
ref|XP_008453844.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    164   9e-45   
gb|EAZ12037.1|  hypothetical protein OsJ_01916                          165   1e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004299915.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    164   1e-44   Fragaria vesca subsp. vesca
gb|EMS54027.1|  Tyrosyl-tRNA synthetase                                 166   2e-44   Triticum urartu
ref|XP_008361702.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    163   2e-44   
ref|XP_009355254.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    163   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_009355255.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   4e-44   Pyrus x bretschneideri [bai li]
ref|XP_009348745.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   5e-44   Pyrus x bretschneideri [bai li]
ref|XP_009348746.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   6e-44   Pyrus x bretschneideri [bai li]
ref|XP_010683748.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    162   6e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004500343.1|  PREDICTED: tyrosine--tRNA ligase-like              162   7e-44   Cicer arietinum [garbanzo]
gb|KHN08832.1|  Tyrosine--tRNA ligase                                   162   7e-44   Glycine soja [wild soybean]
gb|KJB12925.1|  hypothetical protein B456_002G045400                    162   7e-44   Gossypium raimondii
gb|KEH32330.1|  tyrosyl-tRNA synthetase                                 162   8e-44   Medicago truncatula
ref|XP_003544330.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   8e-44   Glycine max [soybeans]
ref|XP_008347911.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   9e-44   
ref|XP_009414004.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010276894.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010927782.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    162   1e-43   Elaeis guineensis
ref|NP_001141566.1|  hypothetical protein                               162   1e-43   Zea mays [maize]
ref|XP_011033705.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    161   2e-43   Populus euphratica
ref|XP_002447960.1|  hypothetical protein SORBIDRAFT_06g018870          160   4e-43   
ref|XP_004982893.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    160   6e-43   Setaria italica
ref|XP_006468947.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    160   6e-43   Citrus sinensis [apfelsine]
ref|XP_007022035.1|  Tyrosyl-tRNA synthetase, class Ib, bacterial...    159   6e-43   
ref|XP_006446866.1|  hypothetical protein CICLE_v10015023mg             159   6e-43   Citrus clementina [clementine]
gb|KEH34424.1|  tyrosyl-tRNA synthetase                                 160   7e-43   Medicago truncatula
gb|KDO63480.1|  hypothetical protein CISIN_1g037749mg                   159   8e-43   Citrus sinensis [apfelsine]
ref|XP_007022034.1|  Tyrosyl-tRNA synthetase isoform 1                  159   1e-42   
ref|XP_003519285.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    158   3e-42   Glycine max [soybeans]
gb|KHN40972.1|  Tyrosine--tRNA ligase                                   153   3e-42   Glycine soja [wild soybean]
ref|XP_008801775.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    157   5e-42   Phoenix dactylifera
ref|XP_008783116.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    155   4e-41   Phoenix dactylifera
gb|EYU42284.1|  hypothetical protein MIMGU_mgv1a005712mg                154   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_011071261.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    154   6e-41   
emb|CAN64191.1|  hypothetical protein VITISV_016956                     156   1e-40   Vitis vinifera
ref|XP_007142062.1|  hypothetical protein PHAVU_008G249300g             153   1e-40   Phaseolus vulgaris [French bean]
gb|EYU24457.1|  hypothetical protein MIMGU_mgv1a005745mg                152   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_010500039.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    152   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010500171.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    152   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010463686.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    152   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_002884331.1|  tRNA synthetase class I family protein             151   7e-40   Arabidopsis lyrata subsp. lyrata
gb|EPS58486.1|  hypothetical protein M569_16327                         149   3e-39   Genlisea aurea
ref|XP_009134705.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    149   7e-39   Brassica rapa
ref|NP_186915.1|  tyrosyl-tRNA synthetase                               149   7e-39   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74240.1|  BnaA03g28070D                                          149   7e-39   
ref|XP_009134703.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    149   8e-39   Brassica rapa
ref|XP_010549888.1|  PREDICTED: tyrosine--tRNA ligase, mitochondrial    148   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_010485586.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    148   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006297370.1|  hypothetical protein CARUB_v10013389mg             148   1e-38   
ref|XP_006408394.1|  hypothetical protein EUTSA_v10020578mg             147   2e-38   Eutrema salsugineum [saltwater cress]
ref|XP_009118453.1|  PREDICTED: probable tyrosine--tRNA ligase, m...    147   3e-38   Brassica rapa
ref|XP_006826574.1|  hypothetical protein AMTR_s00138p00020780          141   3e-36   Amborella trichopoda
ref|XP_002992920.1|  hypothetical protein SELMODRAFT_136175             128   1e-31   
ref|XP_002980036.1|  hypothetical protein SELMODRAFT_111886             128   1e-31   Selaginella moellendorffii
ref|XP_001699082.1|  hypothetical protein CHLREDRAFT_139405             124   2e-30   Chlamydomonas reinhardtii
emb|CBI22389.3|  unnamed protein product                                124   3e-30   Vitis vinifera
ref|XP_005848281.1|  hypothetical protein CHLNCDRAFT_48743              123   7e-30   Chlorella variabilis
ref|XP_002955541.1|  hypothetical protein VOLCADRAFT_83275              121   6e-29   Volvox carteri f. nagariensis
ref|XP_005650588.1|  tyrosyl-tRNA synthetase                            119   1e-28   Coccomyxa subellipsoidea C-169
gb|KIZ02509.1|  tyrosyl-tRNA synthetase                                 114   2e-28   Monoraphidium neglectum
ref|XP_003059850.1|  predicted protein                                  118   3e-28   Micromonas pusilla CCMP1545
ref|XP_002504529.1|  predicted protein                                  116   3e-27   Micromonas commoda
ref|XP_001751567.1|  predicted protein                                  114   3e-26   
ref|XP_001416448.1|  Tyrosyl-tRNA synthetase, probable                  103   1e-22   Ostreococcus lucimarinus CCE9901
ref|XP_003075033.1|  TyrS Tyrosyl-tRNA synthetase, probable (IC)        101   8e-22   Ostreococcus tauri
ref|WP_032125960.1|  tyrosyl-tRNA synthetase                          99.0    3e-21   Candidatus Protochlamydia massiliensis
ref|WP_042279297.1|  tyrosyl-tRNA synthetase                          97.8    8e-21   Candidatus Protochlamydia sp. R18
ref|WP_011175719.1|  tyrosyl-tRNA synthetase                          97.8    8e-21   Candidatus Protochlamydia amoebophila
ref|WP_039359281.1|  tyrosyl-tRNA synthetase                          97.8    9e-21   Candidatus Protochlamydia amoebophila
gb|KIC71389.1|  Tyrosine--tRNA ligase                                 97.8    1e-20   Candidatus Protochlamydia amoebophila
ref|WP_013182397.1|  tyrosyl-tRNA synthetase                          95.1    7e-20   Waddlia chondrophila
ref|XP_010229641.1|  PREDICTED: LOW QUALITY PROTEIN: probable tyr...  94.7    2e-19   
ref|WP_042103652.1|  tyrosyl-tRNA synthetase                          93.6    2e-19   Parachlamydiaceae bacterium HS-T3
ref|WP_006340872.1|  tyrosyl-tRNA synthetase                          93.2    4e-19   Parachlamydia acanthamoebae
emb|CDZ80947.1|  Tyrosine--tRNA ligase                                84.7    5e-16   Candidatus Rubidus massiliensis
ref|WP_013943141.1|  tyrosyl-tRNA synthetase                          84.7    5e-16   Simkania negevensis
ref|WP_039384881.1|  tyrosyl-tRNA synthetase                          84.3    6e-16   Neochlamydia sp. TUME1
ref|WP_042240888.1|  tyrosyl-tRNA synthetase                          84.0    7e-16   Neochlamydia sp. S13
ref|XP_005713019.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  84.3    1e-15   Chondrus crispus [carageen]
ref|WP_039376683.1|  tyrosyl-tRNA synthetase                          83.6    1e-15   
gb|KIC73976.1|  Tyrosine--tRNA ligase                                 83.2    1e-15   Neochlamydia sp. EPS4
ref|XP_005538192.1|  tyrosine--tRNA ligase, mitochondrial or chlo...  80.5    2e-14   Cyanidioschyzon merolae strain 10D
ref|XP_007509051.1|  tyrosyl-tRNA synthetase                          79.3    5e-14   Bathycoccus prasinos
ref|XP_009516786.1|  hypothetical protein PHYSODRAFT_552811           78.6    6e-14   Phytophthora sojae
ref|XP_008910914.1|  tyrosine-tRNA ligase                             77.4    2e-13   Phytophthora parasitica INRA-310
gb|ETI39233.1|  tyrosine-tRNA ligase                                  77.4    2e-13   Phytophthora parasitica P1569
ref|XP_011397334.1|  Tyrosine-tRNA ligase                             77.4    2e-13   Auxenochlorella protothecoides
ref|WP_022848286.1|  tyrosyl-tRNA synthetase                          77.0    2e-13   Anaerolineaceae bacterium oral taxon 439
ref|WP_040313631.1|  tyrosyl-tRNA synthetase                          75.5    7e-13   Actinomyces cardiffensis
gb|ENO19082.1|  tyrosine--tRNA ligase                                 75.5    8e-13   Actinomyces cardiffensis F0333
ref|WP_022864835.1|  tyrosyl-tRNA synthetase                          74.7    1e-12   Varibaculum cambriense
ref|XP_002907836.1|  tyrosyl-tRNA synthetase, putative                74.3    2e-12   Phytophthora infestans T30-4
ref|WP_041017153.1|  tyrosyl-tRNA synthetase                          73.6    3e-12   Criblamydia sequanensis
ref|WP_024058184.1|  tyrosyl-tRNA synthetase                          73.2    5e-12   Varibaculum cambriense
gb|AFG55784.1|  hypothetical protein 0_14069_01                       70.1    6e-12   Pinus taeda
gb|AFG55783.1|  hypothetical protein 0_14069_01                       70.1    6e-12   Pinus taeda
gb|AFG55790.1|  hypothetical protein 0_14069_01                       70.1    7e-12   Pinus taeda
gb|AEW07904.1|  hypothetical protein 0_14069_01                       70.1    7e-12   Pinus radiata
ref|WP_018200080.1|  tyrosyl-tRNA synthetase                          72.0    1e-11   
ref|XP_009837943.1|  tyrosine-tRNA ligase                             71.2    2e-11   Aphanomyces astaci
ref|WP_029668640.1|  tyrosyl-tRNA synthetase                          71.2    2e-11   
ref|WP_013600598.1|  tyrosyl-tRNA synthetase                          71.2    3e-11   Pseudarthrobacter phenanthrenivorans
ref|WP_034510938.1|  tyrosyl-tRNA synthetase                          70.9    3e-11   Actinomyces sp. S4-C9
gb|AEP11643.1|  tyrosyl-tRNA synthetase                               70.9    3e-11   Chloracidobacterium thermophilum B
ref|WP_041569078.1|  tyrosyl-tRNA synthetase                          70.9    3e-11   Chloracidobacterium thermophilum
ref|WP_044150629.1|  tyrosyl-tRNA synthetase                          67.8    6e-11   
ref|WP_016445042.1|  tyrosyl-tRNA synthetase                          69.7    7e-11   Actinomyces europaeus
ref|WP_042457579.1|  tyrosyl-tRNA synthetase                          69.7    7e-11   Streptacidiphilus jiangxiensis
dbj|BAI65246.1|  tyrosyl-tRNA synthetase                              67.4    7e-11   Rothia mucilaginosa DY-18
ref|WP_037604940.1|  tyrosyl-tRNA synthetase                          69.7    7e-11   Streptacidiphilus rugosus
ref|WP_024332044.1|  tyrosyl-tRNA synthetase                          69.3    9e-11   
ref|XP_004334902.1|  tyrosine-tRNA ligase                             69.3    1e-10   Acanthamoeba castellanii str. Neff
ref|XP_008605106.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Saprolegnia diclina VS20
ref|WP_021271485.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Bacteriovorax sp. BSW11_IV
ref|WP_008470064.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Lactobacillus hominis
ref|WP_013132266.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Thermobispora bispora
ref|WP_024366580.1|  tyrosyl-tRNA synthetase                          68.9    1e-10   Arthrobacter sp. TB 26
ref|WP_043455304.1|  tyrosyl-tRNA synthetase                          68.6    2e-10   Pseudarthrobacter phenanthrenivorans
gb|KDO34878.1|  tyrosyl-tRNA synthetase                               68.6    2e-10   Saprolegnia parasitica CBS 223.65
emb|CCQ46715.1|  tyrosyl-tRNA synthetase                              68.2    2e-10   Pseudarthrobacter siccitolerans
ref|WP_024963599.1|  tyrosyl-tRNA synthetase                          68.2    2e-10   Trueperella pyogenes
ref|WP_042380116.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Streptacidiphilus melanogenes
ref|WP_017176881.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Actinomyces timonensis
ref|XP_005707106.1|  tyrosyl-tRNA synthetase                          68.2    3e-10   Galdieria sulphuraria
gb|KDQ21806.1|  hypothetical protein BOTBODRAFT_99200                 68.2    3e-10   Botryobasidium botryosum FD-172 SS1
ref|WP_007000220.1|  tyrosyl-tRNA synthetase                          67.8    3e-10   Actinobaculum massiliense
ref|WP_025295943.1|  tyrosyl-tRNA synthetase                          67.8    3e-10   Trueperella pyogenes
ref|WP_013559196.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Anaerolinea thermophila
ref|WP_021275481.1|  tyrosyl-tRNA synthetase                          67.0    6e-10   Bacteriovorax sp. Seq25_V
ref|WP_039240672.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Arthrobacter sp. MWB30
ref|WP_030504916.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Microbispora rosea
ref|WP_010528768.1|  tyrosyl-tRNA synthetase                          67.0    7e-10   Thermophagus xiamenensis
ref|WP_018771549.1|  tyrosyl-tRNA synthetase                          66.6    8e-10   Arthrobacter sp. 162MFSha1.1
ref|WP_030266695.1|  tyrosyl-tRNA synthetase                          66.6    8e-10   Streptacidiphilus jeojiense
ref|WP_042427072.1|  tyrosyl-tRNA synthetase                          66.6    8e-10   Streptacidiphilus anmyonensis
ref|WP_015936720.1|  tyrosyl-tRNA synthetase                          66.6    8e-10   Pseudarthrobacter chlorophenolicus
ref|WP_003798662.1|  tyrosyl-tRNA synthetase                          66.6    9e-10   Arthrobacter globiformis
ref|XP_008868076.1|  tyrosine-tRNA ligase                             66.2    1e-09   Aphanomyces invadans
ref|WP_017614427.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Nocardiopsis salina
ref|WP_009199613.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Actinomyces sp. oral taxon 848
ref|WP_021277367.1|  tyrosine--tRNA ligase domain protein             63.9    1e-09   
ref|WP_005987818.1|  tyrosyl-tRNA synthetase                          66.2    1e-09   Actinomyces graevenitzii
ref|WP_021604636.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   Actinomyces graevenitzii
ref|WP_012892535.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   Streptosporangium roseum
ref|WP_035732891.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   
ref|WP_043536564.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   Actinomyces polynesiensis
ref|WP_044496612.1|  tyrosyl-tRNA synthetase                          65.9    1e-09   Nesterenkonia massiliensis
gb|AAP58586.1|  putative tyrosyl-tRNA synthetase                      65.9    1e-09   uncultured Acidobacteria bacterium
ref|WP_028931561.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Pseudonocardia asaccharolytica
ref|WP_018763582.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Arthrobacter sp. 135MFCol5.1
ref|WP_018779124.1|  tyrosyl-tRNA synthetase                          65.9    2e-09   Arthrobacter sp. 161MFSha2.1
ref|WP_017197962.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Arthrobacter sp. M2012083
ref|WP_034277502.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Amycolatopsis halophila
ref|WP_042369585.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Streptacidiphilus neutrinimicus
gb|EKY16477.1|  tyrosine--tRNA ligase                                 65.1    2e-09   Actinomyces sp. oral taxon 181 str. F0379
ref|WP_007324558.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Rhodopirellula baltica
ref|WP_016998371.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   
ref|WP_018657964.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Actinomadura flavalba
ref|WP_012825381.1|  tyrosyl-tRNA synthetase                          65.5    2e-09   Haliangium ochraceum
ref|WP_011122161.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula baltica
ref|WP_008661113.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula europaea
ref|WP_037274388.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Kibdelosporangium aridum
ref|WP_007332625.1|  tyrosyl-tRNA synthetase                          65.1    3e-09   Rhodopirellula baltica
ref|WP_034251080.1|  tyrosyl-tRNA synthetase                          64.7    3e-09   Actinomyces sp. oral taxon 181
ref|WP_043622222.1|  tyrosyl-tRNA synthetase                          64.7    3e-09   Nonomuraea candida
ref|WP_028851238.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Thermocrispum municipale
ref|WP_028912082.1|  tyrosyl-tRNA synthetase                          64.7    4e-09   Prevotella sp. MA2016
emb|CCA26043.1|  unnamed protein product                              64.7    4e-09   Albugo laibachii Nc14
ref|WP_019127035.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Actinomyces sp. ph3
ref|WP_041818421.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Lactobacillus johnsonii
ref|WP_023589348.1|  tyrosyl-tRNA synthetase                          64.3    5e-09   Streptomyces thermolilacinus
gb|AHA96684.1|  tyrosyl-tRNA synthase                                 64.3    5e-09   Lactobacillus johnsonii N6.2
ref|WP_029722869.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Saccharopolyspora rectivirgula
ref|WP_004898658.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   
ref|WP_006256112.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Alloprevotella tannerae
ref|WP_020871768.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Streptomyces rapamycinicus
ref|WP_028274405.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Atopococcus tabaci
ref|WP_005507143.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Rothia
ref|WP_014567013.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Lactobacillus johnsonii
ref|WP_024936535.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Actinomadura madurae
ref|WP_037233127.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Rothia aeria
ref|WP_005507861.1|  tyrosyl-tRNA synthetase                          63.9    6e-09   Rothia
ref|WP_031072446.1|  tyrosyl-tRNA synthetase                          63.9    7e-09   Streptomyces sp. NRRL S-118
ref|WP_026541624.1|  tyrosyl-tRNA synthetase                          63.9    8e-09   Paenarthrobacter nicotinovorans
ref|WP_014243863.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   Halobacteriovorax marinus
ref|WP_026547366.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   Paenarthrobacter nicotinovorans
ref|WP_021842733.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   
ref|WP_014921325.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   Arthrobacter sp. Rue61a
gb|AAS08157.1|  tyrosyl-tRNA synthetase                               63.5    8e-09   Lactobacillus johnsonii NCC 533
ref|WP_004806341.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   
ref|WP_044496576.1|  tyrosine--tRNA ligase                            63.5    8e-09   Lactobacillus johnsonii
ref|WP_006823030.1|  tyrosyl-tRNA synthetase                          63.5    8e-09   Corynebacterium
gb|ERT67692.1|  tyrosine--tRNA ligase                                 63.5    9e-09   Rothia aeria F0184
ref|WP_006889016.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   Rothia
ref|WP_026538365.1|  tyrosyl-tRNA synthetase                          63.5    9e-09   Arthrobacter sp. 9MFCol3.1
ref|WP_028927384.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Pseudonocardia acaciae
ref|WP_035794877.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Kitasatospora mediocidica
ref|WP_021949404.1|  tyrosyl-tRNA synthetase                          63.5    1e-08   
gb|ABJ59589.1|  tyrosyl-tRNA synthetase                               63.2    1e-08   Lactobacillus gasseri ATCC 33323 = JCM 1131
ref|WP_021314877.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Lactobacillus gasseri
ref|WP_003650704.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Lactobacillus gasseri
ref|WP_005448890.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Saccharomonospora azurea
ref|WP_022513249.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   
ref|WP_005439705.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Saccharomonospora azurea
ref|WP_016335378.1|  tyrosyl-tRNA synthetase                          63.2    1e-08   Amycolatopsis keratiniphila
ref|WP_012852510.1|  tyrosyl-tRNA synthetase                          62.8    1e-08   Thermomonospora curvata
ref|WP_022286111.1|  tyrosyl-tRNA synthetase                          62.8    1e-08   
ref|WP_038511529.1|  tyrosyl-tRNA synthetase                          62.8    1e-08   Amycolatopsis japonica
ref|WP_020629629.1|  tyrosyl-tRNA synthetase                          62.8    1e-08   Amycolatopsis alba
ref|WP_012845555.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Lactobacillus johnsonii
ref|WP_028277280.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Arthrobacter sp. I3
ref|WP_020502358.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Sciscionella marina
ref|WP_022146920.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   
ref|WP_005989039.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Desulfovibrio africanus
ref|WP_039775270.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Bifidobacterium adolescentis
ref|WP_004896025.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Lactobacillus johnsonii
ref|WP_011743273.1|  tyrosyl-tRNA synthetase                          62.8    2e-08   Bifidobacterium adolescentis
ref|WP_028846608.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Thermocrispum agreste
ref|WP_022016119.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_018774401.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Arthrobacter sp. 131MFCol6.1
gb|AJC07291.1|  tyrosyl-tRNA synthase                                 62.4    2e-08   
ref|WP_014790868.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Ornithobacterium rhinotracheale
ref|WP_039155571.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   
ref|WP_021474284.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Arthrobacter
ref|WP_005163244.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Amycolatopsis azurea
ref|WP_007338393.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Rhodopirellula baltica
ref|WP_003649560.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Lactobacillus paragasseri
ref|WP_012398612.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Kocuria rhizophila
ref|WP_030173661.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Spirillospora albida
ref|WP_042166486.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Streptomyces sp. NBRC 110035
ref|WP_017832867.1|  tyrosyl-tRNA synthetase                          62.4    2e-08   Kocuria
ref|WP_021267070.1|  tyrosyl-tRNA synthetase                          62.0    2e-08   Bacteriovorax sp. BAL6_X
ref|WP_037345658.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Amycolatopsis
ref|WP_013838509.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Isoptericola variabilis
gb|EKD32119.1|  hypothetical protein ACD_77C00174G0009                62.0    3e-08   uncultured bacterium
ref|WP_020547072.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Nonomuraea coxensis
ref|WP_007028024.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Amycolatopsis decaplanina
ref|WP_034321665.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Amycolatopsis lurida
ref|WP_022873629.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Nesterenkonia alba
ref|WP_033513851.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Bifidobacterium pullorum
ref|WP_017981997.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Amycolatopsis methanolica
ref|WP_004338209.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Prevotella bivia
ref|WP_008674495.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Rhodopirellula sallentina
ref|WP_016188948.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Thermobifida fusca
ref|WP_036886463.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Prevotella bivia
ref|WP_036863366.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Prevotella bivia
ref|WP_027454742.1|  tyrosyl-tRNA synthetase                          62.0    3e-08   Prevotella brevis
gb|AAZ56076.1|  tyrosyl-tRNA synthetase                               62.0    3e-08   Thermobifida fusca YX
ref|WP_035929596.1|  tyrosyl-tRNA synthetase                          61.6    3e-08   Kocuria polaris
ref|WP_036910525.1|  tyrosyl-tRNA synthetase                          61.6    3e-08   Prevotella
ref|WP_026980036.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   Flavobacterium suncheonense
ref|WP_024820416.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   Arthrobacter sp. 31Y
ref|WP_031523987.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_011774354.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_026404207.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_036333822.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
gb|ETK30431.1|  tyrosyl-tRNA synthetase                               61.6    4e-08   
ref|WP_036867594.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_028271895.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_031129511.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_010468888.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_036847792.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_036865421.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_036788433.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_033317774.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_020806596.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_027017834.1|  tyrosyl-tRNA synthetase                          61.6    4e-08   
ref|WP_021352198.1|  tyrosyl-tRNA synthetase                          61.2    4e-08   
ref|WP_026460182.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_043480242.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_023019532.1|  MULTISPECIES: tyrosyl-tRNA synthetase            61.2    5e-08   
ref|WP_028903046.1|  MULTISPECIES: tyrosyl-tRNA synthetase            61.2    5e-08   
ref|WP_027930652.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_028266666.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_025000389.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_013064850.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_020420432.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_033150736.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_028905488.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_023925721.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_014709256.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_004362948.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_030695010.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_027367168.1|  tyrosyl-tRNA synthetase                          61.2    5e-08   
ref|WP_021913337.1|  MULTISPECIES: tyrosyl-tRNA synthetase            61.2    6e-08   
ref|WP_028906618.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_025780404.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_011691372.1|  tyrosyl-tRNA synthetase                          61.2    6e-08   
ref|WP_004355960.1|  tyrosyl-tRNA synthetase                          60.8    6e-08   
ref|WP_014157010.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.8    6e-08   
ref|WP_004366699.1|  tyrosyl-tRNA synthetase                          60.8    6e-08   
ref|WP_010636965.1|  tyrosyl-tRNA synthetase                          60.8    6e-08   
ref|WP_013515994.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_008824157.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_039206777.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_003655654.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
ref|WP_014259706.1|  tyrosyl-tRNA synthetase                          60.8    7e-08   
gb|EXX57162.1|  tyrosine--tRNA ligase MSY1                            60.5    8e-08   
ref|WP_038993706.1|  tyrosyl-tRNA synthetase                          60.8    8e-08   
ref|WP_008403815.1|  tyrosyl-tRNA synthetase                          60.1    8e-08   
ref|WP_013151006.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.5    8e-08   
ref|WP_013398793.1|  tyrosyl-tRNA synthetase                          60.5    8e-08   
ref|WP_034466497.1|  tyrosyl-tRNA synthetase                          60.5    8e-08   
ref|WP_012996195.1|  tyrosyl-tRNA synthetase                          60.5    8e-08   
ref|WP_030063911.1|  tyrosyl-tRNA synthetase                          60.5    9e-08   
ref|WP_003795411.1|  tyrosyl-tRNA synthetase                          60.5    9e-08   
ref|WP_003716179.1|  tyrosyl-tRNA synthetase                          60.5    9e-08   
ref|WP_043462324.1|  tyrosyl-tRNA synthetase                          60.5    9e-08   
gb|ESA01810.1|  hypothetical protein GLOINDRAFT_39208                 60.5    9e-08   
ref|WP_009103310.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_033503787.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_042198650.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_044279722.1|  tyrosine--tRNA ligase                            60.5    1e-07   
ref|WP_003947378.1|  MULTISPECIES: tyrosyl-tRNA synthetase            60.5    1e-07   
ref|WP_031177575.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_026420795.1|  tyrosyl-tRNA synthetase                          60.5    1e-07   
ref|WP_003657064.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_042409186.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_013670661.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_030040096.1|  tyrosyl-tRNA synthetase                          58.5    1e-07   
ref|WP_031165781.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_018470483.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_019310944.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_018659753.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_003848988.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_018296313.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_039102177.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_020556141.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_006043715.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
ref|WP_044339444.1|  tyrosine--tRNA ligase                            60.1    1e-07   
ref|WP_037313083.1|  tyrosyl-tRNA synthetase                          60.1    1e-07   
gb|EPB83669.1|  tyrosyl-tRNA synthetase                               60.1    1e-07   
ref|WP_026407733.1|  tyrosyl-tRNA synthetase                          59.7    1e-07   
ref|WP_044851982.1|  tyrosyl-tRNA synthetase                          59.7    1e-07   
ref|WP_041649506.1|  tyrosyl-tRNA synthetase                          59.7    1e-07   
emb|CBT75367.1|  tyrosine--tRNA ligase                                59.7    2e-07   
ref|WP_009381144.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_025065363.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_025067875.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_020645475.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_041314757.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_030431057.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_035280995.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_006548833.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_004354427.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_027449259.1|  tyrosyl-tRNA synthetase                          59.7    2e-07   
ref|WP_027944975.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_010417949.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_036856724.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_024991409.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_021584875.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
gb|EMI16363.1|  tyrosyl-tRNA synthetase                               59.3    2e-07   
ref|WP_004006304.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_040770420.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_023392472.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_018921741.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_003099613.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_014366981.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_022875807.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
emb|CCH33827.1|  Tyrosyl-tRNA synthetase                              59.3    2e-07   
ref|WP_035455359.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_015786857.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_026503264.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_043585078.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_014523269.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_031426654.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_006281183.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_041887384.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
ref|WP_021756583.1|  tyrosyl-tRNA synthetase                          59.3    2e-07   
dbj|GAF41443.1|  tyrosyl-tRNA synthetase                              59.3    2e-07   
ref|WP_030996324.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_027453266.1|  tyrosyl-tRNA synthetase                          59.3    3e-07   
ref|WP_007174743.1|  tyrosyl-tRNA synthetase                          59.3    3e-07   
ref|WP_009347608.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_006294734.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_035809282.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_018911465.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_004384512.1|  MULTISPECIES: tyrosyl-tRNA synthetase            58.9    3e-07   
ref|WP_007573255.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_018226442.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_010313559.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_026466510.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_013227826.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
gb|EGJ78331.1|  putative tyrosyl-tRNA synthetase                      58.9    3e-07   
ref|WP_043256456.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_021897094.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_033435726.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_021852743.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_009612411.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_021927795.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_007263360.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_040353255.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
gb|KIJ59875.1|  hypothetical protein HYDPIDRAFT_117962                58.2    3e-07   
ref|WP_003810282.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_006681555.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
ref|WP_030204930.1|  tyrosyl-tRNA synthetase                          58.9    3e-07   
gb|EAQ78434.1|  tyrosyl-tRNA synthetase                               58.9    3e-07   
gb|KIJ67809.1|  hypothetical protein HYDPIDRAFT_107314                58.5    3e-07   
ref|WP_009079585.1|  tyrosyl-tRNA synthetase                          58.5    3e-07   
ref|WP_021853510.1|  tyrosyl-tRNA synthetase                          58.5    3e-07   
ref|WP_039198550.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_014517766.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_013439025.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_024989478.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_025895947.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
emb|CEP12620.1|  hypothetical protein                                 58.5    4e-07   
ref|WP_011543583.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
gb|EHE91484.1|  Tyrosine--tRNA ligase                                 58.5    4e-07   
emb|CDH56280.1|  tyrosine-trna ligase                                 58.5    4e-07   
ref|WP_033501038.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_002877898.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
gb|KIK27679.1|  hypothetical protein PISMIDRAFT_8081                  58.5    4e-07   
ref|WP_035175588.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_016395907.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_014564560.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_011956798.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_014558675.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_015415854.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_022245234.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_020660335.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_011677971.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_013241818.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_036893143.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_033498773.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
gb|EHE88055.1|  Tyrosine--tRNA ligase                                 58.5    4e-07   
ref|WP_031173814.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_020672041.1|  tyrosyl-tRNA synthetase                          58.5    4e-07   
ref|WP_032100398.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_023572950.1|  tyrosyl-tRNA synthetase                          58.5    5e-07   
ref|WP_025252737.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_033442848.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_044380654.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_006947867.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_026316880.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_023058571.1|  MULTISPECIES: tyrosyl-tRNA synthetase            58.2    5e-07   
gb|EJU04247.1|  hypothetical protein DACRYDRAFT_48409                 58.2    5e-07   
ref|WP_016457404.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_013170168.1|  tyrosyl-tRNA synthetase                          58.2    5e-07   
ref|WP_014202306.1|  tyrosyl-tRNA synthetase                          58.2    6e-07   
ref|WP_009106812.1|  tyrosyl-tRNA synthetase                          58.2    6e-07   
ref|WP_016896392.1|  tyrosyl-tRNA synthetase                          58.2    6e-07   
ref|WP_004350641.1|  tyrosyl-tRNA synthetase                          58.2    6e-07   
ref|WP_021964934.1|  tyrosyl-tRNA synthetase                          58.2    6e-07   
ref|WP_005457874.1|  tyrosyl-tRNA synthetase                          57.8    6e-07   
ref|WP_034999926.1|  tyrosyl-tRNA synthetase                          57.8    6e-07   
ref|WP_019619039.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_006908464.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_029291161.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_033505817.1|  MULTISPECIES: tyrosyl-tRNA synthetase            57.8    7e-07   
ref|WP_018464157.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_044086309.1|  tyrosine--tRNA ligase                            57.8    7e-07   
ref|WP_032087326.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_026859655.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_004328414.1|  MULTISPECIES: tyrosyl-tRNA synthetase            57.8    7e-07   
ref|WP_030456950.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_004222339.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_036873075.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_005529362.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
ref|WP_003143076.1|  tyrosyl-tRNA synthetase                          57.8    7e-07   
emb|CDS06680.1|  hypothetical protein LRAMOSA09207                    57.8    8e-07   
ref|WP_031544395.1|  tyrosyl-tRNA synthetase                          57.8    8e-07   
ref|WP_036079386.1|  tyrosyl-tRNA synthetase                          57.8    8e-07   
ref|WP_035963198.1|  tyrosyl-tRNA synthetase                          57.8    8e-07   
ref|WP_023577906.1|  tyrosyl-tRNA synthetase                          57.8    8e-07   
dbj|GAN10745.1|  tyrosine-tRNA ligase                                 57.8    8e-07   
ref|WP_034501447.1|  tyrosyl-tRNA synthetase                          57.8    8e-07   
ref|WP_040106654.1|  tyrosyl-tRNA synthetase                          57.4    8e-07   
ref|WP_030318353.1|  tyrosyl-tRNA synthetase                          57.4    8e-07   
gb|KIM69757.1|  hypothetical protein SCLCIDRAFT_1172175               57.8    8e-07   
ref|WP_026866815.1|  tyrosyl-tRNA synthetase                          57.4    8e-07   
ref|WP_043934087.1|  tyrosine--tRNA ligase                            57.4    8e-07   
ref|WP_006953261.1|  tyrosyl-tRNA synthetase                          57.4    8e-07   
ref|WP_034235592.1|  tyrosyl-tRNA synthetase                          57.4    8e-07   



>ref|XP_004242803.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Solanum 
lycopersicum]
Length=521

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLD KTIEGIA+DVPSCS  + QV 
Sbjct  393  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYEQVL  452

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDI D KV+L SAGK
Sbjct  453  DIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGK  512

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  513  KNKMVVRIS  521



>ref|XP_009591201.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
tomentosiformis]
Length=522

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLD KTIEGIA+DVPSCS  + QV 
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVL  453

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +IS+LDL VSSGLLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDI D KV+L SAGK
Sbjct  454  NISILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGK  513

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_006362449.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Solanum tuberosum]
Length=522

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLD KTIEGIA+DVPSCS    QV 
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNHEQVL  453

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VDSE+KKIE DDI D KV+L SAGK
Sbjct  454  NIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDSESKKIEADDIVDDKVILLSAGK  513

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_009760674.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nicotiana 
sylvestris]
Length=522

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLD KTIEGIA+DVPSCS  + QV 
Sbjct  394  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMNYDQVL  453

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I +LDL VSSGLLESKSAARRMLKQGGLYLNNA+VD E+KKIE DDI D KV+L SAGK
Sbjct  454  NIPILDLYVSSGLLESKSAARRMLKQGGLYLNNAKVDGESKKIEADDIVDDKVILLSAGK  513

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  514  KNKMVVRIS  522



>ref|XP_009588089.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Nicotiana tomentosiformis]
Length=521

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEAL+PGNADTKLD KTIEGIA+DVPSCS  + QV 
Sbjct  393  QRRLAEEVTRFVHGQEGLEEALKATEALKPGNADTKLDWKTIEGIAADVPSCSMKYDQVL  452

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I +LDL VS GLLESKSAARRMLKQGGLYLNN +VDSE+KKIE DDI D KV+L SAGK
Sbjct  453  NIPILDLYVSGGLLESKSAARRMLKQGGLYLNNGKVDSESKKIEADDIVDDKVILLSAGK  512

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  513  KNKMVVRIS  521



>emb|CDP19091.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+TRFVHGQEGLDEALKATEALRPG A TKLD KTIEGI  DVPSCS P+ QV 
Sbjct  398  QRRLAEEITRFVHGQEGLDEALKATEALRPGAA-TKLDAKTIEGIGEDVPSCSLPYDQVL  456

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            S+S+LDLSVSSGLLESKSAARR+LKQGGLYLNN+RVDSEAKKIE +DI DGKV+L SAGK
Sbjct  457  SLSLLDLSVSSGLLESKSAARRLLKQGGLYLNNSRVDSEAKKIEANDIIDGKVILLSAGK  516

Query  161  KNKXVVRIS  135
            KNK VVR+S
Sbjct  517  KNKMVVRVS  525



>ref|XP_002265238.2| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Vitis 
vinifera]
Length=485

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE TRFVHGQEGLDEALKATEALRPG A+TKLD KTIEGIA DVPSCS  + +V 
Sbjct  358  QRRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVL  416

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLS+S+GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DI DGKVLL SAGK
Sbjct  417  NLSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGK  476

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  477  KNKVVVRIS  485



>ref|XP_010110726.1| Tyrosine--tRNA ligase [Morus notabilis]
 gb|EXC27891.1| Tyrosine--tRNA ligase [Morus notabilis]
Length=481

 Score =   173 bits (439),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL EALKATEALRPG A+TKLD KTIEGIA DVPSCS  + +  
Sbjct  354  QRRLAEEVTRFVHGEEGLREALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYAEAI  412

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVS+GLLESKSAARR+LKQGGLYLNNARVDSE+K++E DDI DGKVLL SAGK
Sbjct  413  GLSLVDLSVSAGLLESKSAARRLLKQGGLYLNNARVDSESKRVEADDIVDGKVLLLSAGK  472

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  473  KNKVVVRIS  481



>ref|XP_004303944.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD KT++ I+ DVPSCS P+ QV 
Sbjct  352  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWKTMQAISEDVPSCSFPYHQVL  410

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +SV+DLSVSSGL +SKSAARR+LKQGGLYLNN+RVDSE+K+IE  D+ DGK+LL SAGK
Sbjct  411  DLSVVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDSESKRIEPQDVVDGKLLLLSAGK  470

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  471  KNKVLVRIS  479



>gb|KDP41896.1| hypothetical protein JCGZ_26914 [Jatropha curcas]
Length=509

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 116/129 (90%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG A+TKLD KTIEGIA DVPSCS  + QV 
Sbjct  382  QRRLAEEVTRFVHGEDGLSEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVL  440

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVS+GLLESKSAARR+LKQGGLYLNN+RVDSE+K++E +DI DGKVLL SAGK
Sbjct  441  NLSLVDLSVSAGLLESKSAARRLLKQGGLYLNNSRVDSESKRVEAEDIVDGKVLLLSAGK  500

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  501  KNKVVVRIS  509



>ref|XP_007022036.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 ref|XP_007022037.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13561.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
 gb|EOY13562.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
3 [Theobroma cacao]
Length=491

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TRFVHG++GL+EALKATEALRPG ++TKLD KTIEGIA DVPSC+ P+ QV 
Sbjct  364  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  422

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DI DGKVLL SAGK
Sbjct  423  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  482

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  483  KNKVVVRIS  491



>ref|XP_002512791.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF49294.1| tyrosyl-tRNA synthetase, putative [Ricinus communis]
Length=492

 Score =   167 bits (424),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GL EA+KATEALRPG A+TKLD KTIEGIA DVPSCS  + QV 
Sbjct  365  QRRLAEEVTRFVHGQDGLLEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDQVL  423

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSV++GL++SKSAARR+LKQGGLYLNN+RVDSE+K++E  DI +GKVLL SAGK
Sbjct  424  NLSLVDLSVTAGLIDSKSAARRLLKQGGLYLNNSRVDSESKRVESQDIVEGKVLLLSAGK  483

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  484  KNKVIVRIS  492



>ref|XP_007222608.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
 gb|EMJ23807.1| hypothetical protein PRUPE_ppa004925mg [Prunus persica]
Length=485

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEALRPG ADTKLD KTI+ I+ DVPSCS P+ QV 
Sbjct  355  QRRLAEEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVL  413

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DI DGK+LL SAGK
Sbjct  414  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGK  473

Query  161  KNKXVVRI  138
            KNK +V+I
Sbjct  474  KNKVLVQI  481



>ref|XP_003574045.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=512

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCS P+ QV 
Sbjct  385  QRILAEEVTRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  443

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DI DGKVLL SAGK
Sbjct  444  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNIKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  504  KNKMVVRIS  512



>ref|XP_008218548.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218549.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
 ref|XP_008218550.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Prunus 
mume]
Length=485

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 113/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA+EVTRFVHGQ+GLDEALKATEALRPG ADTKLD KTI+ I+ DVPSCS P+ QV 
Sbjct  355  QRRLAQEVTRFVHGQDGLDEALKATEALRPG-ADTKLDWKTIQAISEDVPSCSFPYNQVL  413

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVD+E K++E  DI DGK+LL SAGK
Sbjct  414  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDNENKRVEPQDIVDGKLLLLSAGK  473

Query  161  KNKXVVRI  138
            KNK +V+I
Sbjct  474  KNKVLVQI  481



>ref|XP_006645923.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Oryza brachyantha]
Length=485

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCS P+ QV 
Sbjct  358  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  416

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+ +GKVLL SAGK
Sbjct  417  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVNGKVLLLSAGK  476

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  477  KNKMVVRIS  485



>gb|KCW55733.1| hypothetical protein EUGRSUZ_I01565, partial [Eucalyptus grandis]
Length=479

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG A+TKLD KTIEGIA DVPSCS  +  V 
Sbjct  352  QRRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVL  410

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSV +GL+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DI DGKVLL SAGK
Sbjct  411  NCSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGK  470

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  471  KNKVVVRIS  479



>ref|NP_001043131.1| Os01g0500900 [Oryza sativa Japonica Group]
 dbj|BAB64064.1| putative tyrosine-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF05045.1| Os01g0500900 [Oryza sativa Japonica Group]
 gb|EAY74203.1| hypothetical protein OsI_02083 [Oryza sativa Indica Group]
 dbj|BAG90095.1| unnamed protein product [Oryza sativa Japonica Group]
Length=497

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC  P+ QV 
Sbjct  370  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVL  428

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+ DGKVLL SAGK
Sbjct  429  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGK  488

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  489  KNKMVVRIS  497



>gb|EMT07165.1| Tyrosyl-tRNA synthetase [Aegilops tauschii]
Length=512

 Score =   166 bits (419),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCS  + QV 
Sbjct  385  QRRLAEEVTRFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLRYDQVL  443

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+ S+GLL SKSAARR++KQGGLYLNN ++DSE K +EE DI DGKVLL SAGK
Sbjct  444  KSPLVDLAASTGLLASKSAARRLIKQGGLYLNNMKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  504  KNKMVVRIS  512



>ref|XP_008339493.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Malus domestica]
Length=486

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLD  TI+ I+ DVPSCS P+ QV 
Sbjct  357  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVL  415

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGK+LL SAGK
Sbjct  416  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  475

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  476  KNKVLVQIS  484



>ref|XP_006375482.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
 gb|ERP53279.1| hypothetical protein POPTR_0014s13650g [Populus trichocarpa]
Length=329

 Score =   162 bits (409),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+VT FVHG++GL+EALKATEALRPG A+TKLD KT EGIA DVPSCS    QV 
Sbjct  202  QRRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVL  260

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +IS++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGKVLL SAGK
Sbjct  261  NISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGK  320

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  321  KNKVIVRIT  329



>ref|XP_008339494.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Malus domestica]
Length=482

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLD  TI+ I+ DVPSCS P+ QV 
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPSCSFPYHQVL  411

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGK+LL SAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_004146892.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
 gb|KGN53185.1| hypothetical protein Csa_4G025150 [Cucumis sativus]
Length=493

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEAL+PG A+TKLD KTIEGIA DVP CS  + QV 
Sbjct  366  QRRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++SV+DLSV+SGLLESKSAARR+LKQGGLYLNN RVDSE+K++E  DI DGKVLL SAGK
Sbjct  425  NLSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIVDGKVLLLSAGK  484

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  485  KNKVVVRIS  493



>dbj|BAK00149.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04905.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=512

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT FVHGQEGL+EALKATEALRPG A T+LD +TIEGIA DVPSCS P+ QV 
Sbjct  385  QRRLAEEVTLFVHGQEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  443

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DI DGKVLL SAGK
Sbjct  444  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGK  503

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  504  KNKMVVRIS  512



>ref|XP_004166614.1| PREDICTED: tyrosine--tRNA ligase-like [Cucumis sativus]
Length=493

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 100/129 (78%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEAL+PG A+TKLD KTIEGIA DVP CS  + QV 
Sbjct  366  QRRLAEEVTRFVHGEDGLREALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++SV+DLSV+SGLLESKSAARR+LKQGGLYLNN RVDSE+K++E  DI DGKVLL SAGK
Sbjct  425  NLSVVDLSVTSGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDIIDGKVLLLSAGK  484

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  485  KNKVVVRIS  493



>ref|XP_010028900.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
Length=506

 Score =   165 bits (417),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG A+TKLD KTIEGIA DVPSCS  +  V 
Sbjct  379  QRRLAEEVTRFVHGEDGLQEALKATEALRPG-AETKLDWKTIEGIAEDVPSCSLNYDDVL  437

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSV +GL+ESKSAARR+LKQGG+YLNN RVD E+K+IE +DI DGKVLL SAGK
Sbjct  438  NCSLVDLSVLAGLMESKSAARRLLKQGGMYLNNGRVDGESKRIEAEDIVDGKVLLLSAGK  497

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  498  KNKVVVRIS  506



>ref|XP_008453844.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Cucumis 
melo]
Length=493

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+ GL EALKATEAL+PG A+TKLD KTIEGIA DVP CS  + QV 
Sbjct  366  QRRLAEEVTRFVHGENGLSEALKATEALKPG-AETKLDWKTIEGIAEDVPCCSLEYDQVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++SV+DLSV++GLLESKSAARR+LKQGGLYLNN RVDSE+K++E  D+ DGKVLL SAGK
Sbjct  425  NLSVVDLSVTTGLLESKSAARRLLKQGGLYLNNGRVDSESKRVEAVDVIDGKVLLLSAGK  484

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  485  KNKVVVRIS  493



>gb|EAZ12037.1| hypothetical protein OsJ_01916 [Oryza sativa Japonica Group]
Length=545

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSC  P+ QV 
Sbjct  418  QRRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCFLPYGQVL  476

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA RR++KQGGLYLNN R+DSE K +EE D+ DGKVLL SAGK
Sbjct  477  KSPLVDLAVSTGLLASKSAVRRLIKQGGLYLNNIRIDSEDKLVEEGDVVDGKVLLLSAGK  536

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  537  KNKMVVRIS  545



>ref|XP_004299915.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
 ref|XP_011464831.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ GLDEALKATEA+RPG ADT LD  T++ I+ DVPSCS P+ QV 
Sbjct  357  QRRLAEEVTRFVHGQNGLDEALKATEAMRPG-ADTNLDWNTMQAISEDVPSCSFPYHQVL  415

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + V+DLSVSSGL ++KSAARR+LKQGGLY+NN RV+SE+K+IE  DI DGK+LL SAGK
Sbjct  416  DLPVVDLSVSSGLFDTKSAARRLLKQGGLYMNNLRVESESKRIEPQDIVDGKLLLLSAGK  475

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  476  KNKVLVRIS  484



>gb|EMS54027.1| Tyrosyl-tRNA synthetase [Triticum urartu]
Length=796

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEG++EALKATEALRPG A T+LD +TIEGIA DVPSCS P+ QV 
Sbjct  669  QRRLAEEVTRFVHGQEGVEEALKATEALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQVL  727

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+ S+GLL SKSA RR++KQGGLYLNN ++DSE K +EE DI DGKVLL SAGK
Sbjct  728  KSPLVDLAASTGLLASKSAVRRLIKQGGLYLNNKKIDSEDKLVEEGDIVDGKVLLLSAGK  787

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  788  KNKMVVRIS  796



>ref|XP_008361702.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG AD KLD  TI+ I+ DVP CS P+ QV 
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADXKLDWNTIKAISEDVPXCSFPYHQVL  411

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGK+LL SAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_009355254.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD   I+ I+ DVPSCS P+ +V 
Sbjct  357  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVL  415

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DI DGK+LL SAGK
Sbjct  416  NLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  475

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  476  KNKVLVQIS  484



>ref|XP_009355255.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355256.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355257.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009355258.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD   I+ I+ DVPSCS P+ +V 
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNAIKAISEDVPSCSFPYHEVL  411

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DI DGK+LL SAGK
Sbjct  412  NLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  471

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_009348745.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Pyrus x bretschneideri]
Length=486

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD  TI+ I+ DVPSCS P+ QV 
Sbjct  357  QCRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVL  415

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGK+LL SAGK
Sbjct  416  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  475

Query  161  KNKXVVRIS  135
            KNK +V+I+
Sbjct  476  KNKVLVQIN  484



>ref|XP_009348746.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348747.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348748.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009348749.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Pyrus x bretschneideri]
Length=482

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD  TI+ I+ DVPSCS P+ QV 
Sbjct  353  QCRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFPYHQVL  411

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGK+LL SAGK
Sbjct  412  DLSLVDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSENKRIEPQDIVDGKLLLLSAGK  471

Query  161  KNKXVVRIS  135
            KNK +V+I+
Sbjct  472  KNKVLVQIN  480



>ref|XP_010683748.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683749.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683750.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683751.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=498

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEE+TRFVHG+EGL EA+KATEALRPG A+TKLD KTIEGIA DVPSCS  +  V 
Sbjct  371  QIRLAEELTRFVHGEEGLKEAIKATEALRPG-AETKLDWKTIEGIAEDVPSCSLAYDDVL  429

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSV SGLLES+SA RRMLKQGGLYLNN R+D+E+K+IE DDI DGKVLL SAGK
Sbjct  430  NLSIVDLSVLSGLLESRSAVRRMLKQGGLYLNNTRIDNESKRIEVDDIVDGKVLLLSAGK  489

Query  161  KNKXVVRIS  135
            KNK VVR+S
Sbjct  490  KNKMVVRVS  498



>ref|XP_004500343.1| PREDICTED: tyrosine--tRNA ligase-like [Cicer arietinum]
Length=501

 Score =   162 bits (411),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL+EA+KATEALRPG ++TKLD KTIEGIA DVPSCS  + +V 
Sbjct  374  QRRLAEEVTRFVHGEDGLNEAIKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVL  432

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVSSGL +SKSAARR+LKQGGLYLNN+RVD+E K++E  DI DGKVLL SAGK
Sbjct  433  NQSLVDLSVSSGLFDSKSAARRLLKQGGLYLNNSRVDNENKRVEAADIVDGKVLLLSAGK  492

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  493  KNKVLVRIA  501



>gb|KHN08832.1| Tyrosine--tRNA ligase [Glycine soja]
Length=482

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG ++TKLD KTIEGIA DVPSCS  +  V 
Sbjct  355  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVL  413

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVSSGL ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DI DGKVLL SAGK
Sbjct  414  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGK  473

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  474  KNKVLVRIA  482



>gb|KJB12925.1| hypothetical protein B456_002G045400 [Gossypium raimondii]
Length=491

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 114/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+TRFVHG++GL EALKATEALRPG ++TKLD +TIEGIA DVPS S P+ +V 
Sbjct  364  QRKLAEEITRFVHGEDGLTEALKATEALRPG-SETKLDWETIEGIAEDVPSRSLPYTEVL  422

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVSSGL ESKSAARR+LKQGG+YLNN RVD+E+K+IE +DI DGKVLL SAGK
Sbjct  423  NLSIVDLSVSSGLFESKSAARRLLKQGGIYLNNNRVDNESKRIEAEDIVDGKVLLLSAGK  482

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  483  KNKVVVRIS  491



>gb|KEH32330.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=482

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EAL+ATEALRPG ++TKLD KTIEGIA DVPSCS  + +V 
Sbjct  355  QRRLAEEVTRFVHGEDGLSEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDEVL  413

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVSSGL +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DI DGKVLL SAGK
Sbjct  414  NQSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEAADIVDGKVLLLSAGK  473

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  474  KNKVLVRIA  482



>ref|XP_003544330.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=490

 Score =   162 bits (410),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG ++TKLD KTIEGIA DVPSCS  +  V 
Sbjct  363  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDAVL  421

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVSSGL ESKSAARR+LKQGGLYLNN RVDSE+K+IE  DI DGKVLL SAGK
Sbjct  422  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNNRVDSESKRIEAADIVDGKVLLLSAGK  481

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  482  KNKVLVRIA  490



>ref|XP_008347911.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347912.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008347913.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365305.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365306.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
 ref|XP_008365307.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Malus 
domestica]
Length=482

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQ+GLDEALKATEA+RPG ADTKLD  TI+ I+ DVPSCS  + QV 
Sbjct  353  QRRLAEEVTRFVHGQDGLDEALKATEAMRPG-ADTKLDWNTIKAISEDVPSCSFLYHQVL  411

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S+LDLSVSSGLL+SKSAARR+LKQGGLYLNN++VDSE K+IE +DI DGK+LL SAGK
Sbjct  412  DLSILDLSVSSGLLDSKSAARRLLKQGGLYLNNSKVDSENKRIEPEDIVDGKLLLLSAGK  471

Query  161  KNKXVVRIS  135
            KNK +V+IS
Sbjct  472  KNKVLVQIS  480



>ref|XP_009414004.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Musa 
acuminata subsp. malaccensis]
Length=535

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG A+T+LD +TIEGI+ DVPSCS  + QV 
Sbjct  408  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-AETRLDAETIEGISEDVPSCSLAYYQVL  466

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVS+GLL +KSA RR++KQGGLYLNN RVD+E K++EE DI DGK+LL SAGK
Sbjct  467  NSSLIDLSVSTGLLSTKSAVRRLMKQGGLYLNNKRVDTEEKRVEEADIIDGKILLLSAGK  526

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  527  KNKMVVRIS  535



>ref|XP_010276894.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Nelumbo 
nucifera]
Length=531

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 110/129 (85%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL EALKATEALRPG A+T LD KTIEGIA DVPSC+  + QV 
Sbjct  404  QRRLAEEVTRFVHGEEGLLEALKATEALRPG-AETVLDWKTIEGIAEDVPSCTLDYKQVL  462

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVS+GLLESKSAARR+LKQGGLYLNN RV+SE + IE  DI DGKVLL SAGK
Sbjct  463  NASLVDLSVSTGLLESKSAARRLLKQGGLYLNNIRVESEIRSIEVGDIIDGKVLLLSAGK  522

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  523  KNKMIVRIS  531



>ref|XP_010927782.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Elaeis 
guineensis]
Length=544

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL EALKATE LRPG A+TKLD +TIEGIA DVPSC   + QV 
Sbjct  417  QRRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCCLAYDQVL  475

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVS+GLL SKSAARR++KQGGLYLNN RVD+EAK IE  DI DGK+LL SAGK
Sbjct  476  NSSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEAKMIEAGDIVDGKLLLLSAGK  535

Query  161  KNKXVVRIS  135
            KNK V+RIS
Sbjct  536  KNKIVIRIS  544



>ref|NP_001141566.1| hypothetical protein [Zea mays]
 gb|ACF86629.1| unknown [Zea mays]
 tpg|DAA37471.1| TPA: hypothetical protein ZEAMMB73_107188 [Zea mays]
Length=496

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCS  + QV 
Sbjct  369  QKRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVF  427

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +EE DI DGKVLL SAGK
Sbjct  428  KSPLIDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEEGDIVDGKVLLLSAGK  487

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  488  KNKMVVRIS  496



>ref|XP_011033705.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Populus euphratica]
Length=502

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+VT FVHG++GL+EALKATEALRPG A+TKLD KT EGIA DVPSCS    QV 
Sbjct  375  QRRLAEQVTLFVHGEDGLNEALKATEALRPG-AETKLDWKTFEGIAEDVPSCSLASDQVL  433

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +IS++DLSVSSGLL+SKSAARR+LKQGGLYLNN+RVDSE K+IE  DI DGKVLL SAGK
Sbjct  434  NISLIDLSVSSGLLDSKSAARRLLKQGGLYLNNSRVDSETKRIEPQDIVDGKVLLLSAGK  493

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  494  KNKVIVRIT  502



>ref|XP_002447960.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
 gb|EES12288.1| hypothetical protein SORBIDRAFT_06g018870 [Sorghum bicolor]
Length=521

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 108/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL+EALKATEALRPG A T+LD +TIEGIA DVPSCS  + QV 
Sbjct  394  QKRLAEEVTRFVHGEEGLEEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVF  452

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +E+ DI DGKVLL SAGK
Sbjct  453  KSPLVDLAVSTGLLTSKSAVKRLIKQGGLYLNNVRIDSEDKLVEDGDIVDGKVLLLSAGK  512

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  513  KNKMVVRIS  521



>ref|XP_004982893.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Setaria italica]
Length=494

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL EALKATEALRPG A T+LD +TIEGIA DVPSCS  + QV 
Sbjct  367  QKRLAEEVTRFVHGEEGLVEALKATEALRPG-AQTQLDAQTIEGIADDVPSCSLAYDQVL  425

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL+VS+GLL SKSA +R++KQGGLYLNN R+DSE K +EE DI DGKVLL SAGK
Sbjct  426  KSPLVDLAVSTGLLASKSAVKRLIKQGGLYLNNIRIDSEDKLVEEGDIVDGKVLLLSAGK  485

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  486  KNKMVVRIS  494



>ref|XP_006468947.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Citrus sinensis]
Length=493

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG++GL+EA+KATEALRPG A+TKLD KTIE IA DVPSCS  + QV 
Sbjct  366  QQRLAEEVTRFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DI D KVLL SAGK
Sbjct  425  NVSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  484

Query  161  KNKXVVRIS  135
            KNK VVRI+
Sbjct  485  KNKVVVRIA  493



>ref|XP_007022035.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
 gb|EOY13560.1| Tyrosyl-tRNA synthetase, class Ib, bacterial/mitochondrial isoform 
2 [Theobroma cacao]
Length=486

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TRFVHG++GL+EALKATEALRPG ++TKLD KTIEGIA DVPSC+ P+ QV 
Sbjct  364  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  422

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DI DGKVLL SAGK
Sbjct  423  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  482

Query  161  KNK  153
            KNK
Sbjct  483  KNK  485



>ref|XP_006446866.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
 gb|ESR60106.1| hypothetical protein CICLE_v10015023mg [Citrus clementina]
Length=493

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT FVHG++GL+EA+KATEALRPG A+TKLD KTIE IA DVPSCS  + QV 
Sbjct  366  QRRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DI D KVLL SAGK
Sbjct  425  NVSLVDLSVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  484

Query  161  KNKXVVRIS  135
            KNK VVRI+
Sbjct  485  KNKVVVRIA  493



>gb|KEH34424.1| tyrosyl-tRNA synthetase [Medicago truncatula]
Length=500

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT+FVHG++GL+EAL+ATEALRPG ++TKLD KTIEGIA DVPSCS  +  V 
Sbjct  373  QRRLAEEVTKFVHGEDGLNEALRATEALRPG-SETKLDWKTIEGIAEDVPSCSLAYDDVL  431

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVSSGL +SKSAARR+LKQGG+YLNN+RVDSE K+IE  DI DGKVLL SAGK
Sbjct  432  NQSLVDLSVSSGLFDSKSAARRLLKQGGVYLNNSRVDSENKRIEVADIVDGKVLLLSAGK  491

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  492  KNKVLVRIA  500



>gb|KDO63480.1| hypothetical protein CISIN_1g037749mg [Citrus sinensis]
Length=495

 Score =   159 bits (403),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT FVHG++GL+EA+KATEALRPG A+TKLD KTIE IA DVPSCS  + QV 
Sbjct  368  QRRLAEEVTHFVHGEDGLNEAVKATEALRPG-AETKLDWKTIEAIAEDVPSCSLAYDQVL  426

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DL+VS+GL ESKSAARR+LKQGG+YLNN RVDSE+K+IE  DI D KVLL SAGK
Sbjct  427  NVSLVDLAVSAGLFESKSAARRLLKQGGVYLNNNRVDSESKRIEPQDIVDDKVLLLSAGK  486

Query  161  KNKXVVRIS  135
            KNK VVRI+
Sbjct  487  KNKVVVRIA  495



>ref|XP_007022034.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY13559.1| Tyrosyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=542

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 109/123 (89%), Gaps = 1/123 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TRFVHG++GL+EALKATEALRPG ++TKLD KTIEGIA DVPSC+ P+ QV 
Sbjct  420  QQRLAEEITRFVHGEDGLNEALKATEALRPG-SETKLDWKTIEGIAEDVPSCTLPYNQVV  478

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSV SGL ESKSAARR+LKQGGLYLNN RVD+E K+IE +DI DGKVLL SAGK
Sbjct  479  NLSIVDLSVCSGLFESKSAARRLLKQGGLYLNNNRVDNEIKRIEAEDIVDGKVLLLSAGK  538

Query  161  KNK  153
            KNK
Sbjct  539  KNK  541



>ref|XP_003519285.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial-like 
[Glycine max]
Length=496

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATEALRPG ++TKLD KTIEGIA DVP CS  +  V 
Sbjct  369  QRRLAEEVTRFVHGEDGLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAVL  427

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DL VSSGL ESKSAARR+LKQGGLYLNN RVD+E K+IE  DI DGKVLL SAGK
Sbjct  428  NLSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAGK  487

Query  161  KNKXVVRI  138
            KNK +VRI
Sbjct  488  KNKVLVRI  495



>gb|KHN40972.1| Tyrosine--tRNA ligase [Glycine soja]
Length=279

 Score =   153 bits (387),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEG-LDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LAEEVTRFVHG++G L EALKATEALRPG ++TKLD KTIEGIA DVP CS  +  V
Sbjct  151  QRRLAEEVTRFVHGEDGFLAEALKATEALRPG-SETKLDWKTIEGIAEDVPCCSLAYDAV  209

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++S++DL VSSGL ESKSAARR+LKQGGLYLNN RVD+E K+IE  DI DGKVLL SAG
Sbjct  210  LNLSLVDLLVSSGLFESKSAARRLLKQGGLYLNNNRVDNEGKRIEAADIVDGKVLLLSAG  269

Query  164  KKNKXVVRI  138
            KKNK +VRI
Sbjct  270  KKNKVLVRI  278



>ref|XP_008801775.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=544

 Score =   157 bits (398),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL EALKATE LRPG A+TKLD +TIEGIA DVPSCS  + QV 
Sbjct  417  QRRLAEEVTRFVHGEEGLAEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVL  475

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVS+GLL SKSAARR++KQGGLYLNN RVD+E K IE  DI D KVLL SAGK
Sbjct  476  NSSLVDLSVSTGLLSSKSAARRLMKQGGLYLNNRRVDNEEKVIEAGDIVDEKVLLLSAGK  535

Query  161  KNKXVVRI  138
            KNK V+RI
Sbjct  536  KNKMVIRI  543



>ref|XP_008783116.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
 ref|XP_008783117.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Phoenix 
dactylifera]
Length=543

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 108/128 (84%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EALKATE LRPG A+TKLD +TIEGIA DVPSCS  + QV 
Sbjct  416  QRRLAEEVTRFVHGEDGLTEALKATETLRPG-AETKLDWETIEGIAEDVPSCSLAYGQVL  474

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSVS+GLL SKSAARR+++QGGLYLNN RVD+EAK IE  DI D K+LL SAGK
Sbjct  475  NSSLVDLSVSTGLLSSKSAARRLMEQGGLYLNNRRVDNEAKVIEAGDIVDEKILLLSAGK  534

Query  161  KNKXVVRI  138
            KNK V++I
Sbjct  535  KNKMVIKI  542



>gb|EYU42284.1| hypothetical protein MIMGU_mgv1a005712mg [Erythranthe guttata]
Length=473

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLD  +IE IA DVPS S    QV 
Sbjct  346  QRKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLGKDQVL  404

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLSV SGLL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDI DGKV+L SAGK
Sbjct  405  NLSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGK  464

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  465  KNKMIVRIS  473



>ref|XP_011071261.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Sesamum 
indicum]
Length=503

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 108/125 (86%), Gaps = 1/125 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGLDEALKAT+ALRPG A+TKLD KTIE IA DVPS S    QV 
Sbjct  340  QRRLAEEVTRFVHGEEGLDEALKATQALRPG-AETKLDWKTIETIAEDVPSISLQQDQVL  398

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLSV +GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DI DGKV+L SAGK
Sbjct  399  NLSLLDLSVRTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEPNDIVDGKVILLSAGK  458

Query  161  KNKXV  147
            KNK +
Sbjct  459  KNKMI  463



>emb|CAN64191.1| hypothetical protein VITISV_016956 [Vitis vinifera]
Length=868

 Score =   156 bits (395),  Expect = 1e-40, Method: Composition-based stats.
 Identities = 94/119 (79%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE TRFVHGQEGLDEALKATEALRPG A+TKLD KTIEGIA DVPSCS  + +V 
Sbjct  358  QRRLAEEATRFVHGQEGLDEALKATEALRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVL  416

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
            ++S+LDLS+S+GLLESKSAARR+LKQGGLYLNN R+DSEAK+IE +DI DGKVLL SAG
Sbjct  417  NLSLLDLSISTGLLESKSAARRLLKQGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAG  475



>ref|XP_007142062.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
 gb|ESW14056.1| hypothetical protein PHAVU_008G249300g [Phaseolus vulgaris]
Length=478

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 111/129 (86%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+EVT FVHG++GL EAL+ATEAL+PG+  TKLD K+IEGIA D+PSCS P+  V 
Sbjct  351  QQRLAKEVTLFVHGEDGLAEALQATEALKPGSG-TKLDWKSIEGIAEDLPSCSLPYEDVL  409

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S++DLSVSSGL ESKSAARR+LKQGGLYLNN+RVD+E K+IE  DI DGKVLL SAGK
Sbjct  410  NLSLVDLSVSSGLFESKSAARRLLKQGGLYLNNSRVDNEGKRIEAADIVDGKVLLLSAGK  469

Query  161  KNKXVVRIS  135
            KNK +VRI+
Sbjct  470  KNKVLVRIA  478



>gb|EYU24457.1| hypothetical protein MIMGU_mgv1a005745mg [Erythranthe guttata]
Length=472

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL+EA+KAT ALRPG ++TKLD  +IE IA DVPS S    +V 
Sbjct  345  QRKLAEEVTRFVHGEEGLEEAMKATMALRPG-SETKLDWNSIESIAEDVPSVSLEKDRVL  403

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            ++S+LDLSV SGLL+SKSAARRMLKQGGLYLNN RVDSE ++IE DDI DGKV+L SAGK
Sbjct  404  NLSLLDLSVCSGLLDSKSAARRMLKQGGLYLNNNRVDSEGRRIEIDDIVDGKVILLSAGK  463

Query  161  KNKXVVRIS  135
            KNK +VRIS
Sbjct  464  KNKMIVRIS  472



>ref|XP_010500039.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
 ref|XP_010500108.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Camelina sativa]
Length=511

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS P  +VS
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DI +GK L+ SAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_010500171.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Camelina sativa]
Length=505

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS P  +VS
Sbjct  378  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  436

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DI +GK L+ SAGK
Sbjct  437  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  496

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  497  KNKVVVRIS  505



>ref|XP_010463686.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010463687.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS P  +VS
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DI +GK L+ SAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_002884331.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60590.1| tRNA synthetase class I family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS P  +VS
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DI +GK L+ SAGK
Sbjct  443  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  503  KNKVVVRIS  511



>gb|EPS58486.1| hypothetical protein M569_16327, partial [Genlisea aurea]
Length=428

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEE+TRFVHG+EGL EA+KAT AL PGN +T L  ++IEGIA DVPSC     QV 
Sbjct  302  QIRLAEELTRFVHGEEGLAEAVKATRALNPGN-ETNLRWESIEGIAGDVPSCRLNRNQVL  360

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSV++GL+ES+SAARR+LKQGGLYLNN RVD+E KKIE+DDI DGK+LL SAGK
Sbjct  361  NSSLVDLSVATGLVESRSAARRLLKQGGLYLNNVRVDNEGKKIEDDDIVDGKILLLSAGK  420

Query  161  KNKXVVRI  138
            KNK VVRI
Sbjct  421  KNKMVVRI  428



>ref|XP_009134705.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134706.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
 ref|XP_009134707.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X2 [Brassica rapa]
Length=500

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+P+CS P  +V+
Sbjct  373  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  431

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DI +GK L+ S+GK
Sbjct  432  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  491

Query  161  KNKXVVRIS  135
            KNK V+RIS
Sbjct  492  KNKVVIRIS  500



>ref|NP_186915.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AAF32473.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 dbj|BAD95182.1| putative tyrosyl-tRNA synthetase [Arabidopsis thaliana]
 gb|ABK32110.1| At3g02660 [Arabidopsis thaliana]
 gb|AEE73845.1| tyrosyl-tRNA synthetase [Arabidopsis thaliana]
Length=511

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS P  +VS
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLPIDRVS  442

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K+++E+DI +G+ L+ SAGK
Sbjct  443  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVDEEDIVEGRGLVLSAGK  502

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  503  KNKVVVRIS  511



>emb|CDX74240.1| BnaA03g28070D [Brassica napus]
Length=500

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+P+CS P  +V+
Sbjct  373  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  431

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DI +GK L+ S+GK
Sbjct  432  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  491

Query  161  KNKXVVRIS  135
            KNK V+RIS
Sbjct  492  KNKVVIRIS  500



>ref|XP_009134703.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial isoform 
X1 [Brassica rapa]
Length=520

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+P+CS P  +V+
Sbjct  393  QMKLAEEVTRFVHGEEGLKEAMKATEALRPG-AETKLDWNLIERIAEDIPTCSLPVDRVA  451

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++D+SVS+GL ESKSAARRMLKQGG+Y+NN RVD E K++EE DI +GK L+ S+GK
Sbjct  452  GVSIVDVSVSAGLFESKSAARRMLKQGGVYMNNERVDDENKRVEEGDIVEGKGLVLSSGK  511

Query  161  KNKXVVRIS  135
            KNK V+RIS
Sbjct  512  KNKVVIRIS  520



>ref|XP_010549888.1| PREDICTED: tyrosine--tRNA ligase, mitochondrial [Tarenaya hassleriana]
Length=516

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 109/129 (84%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL EA++ATEALRPG  +TKLD K IE IA D+PSCS    +V 
Sbjct  388  QKKLAEEVTRFVHGEEGLREAIRATEALRPGT-ETKLDWKMIEKIAEDIPSCSLAKEEVL  446

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++D++VSSGLLES+SAARRM+KQGG+YLNN RV+ E+K++ +DDI +GKVLL SAGK
Sbjct  447  NSSIIDIAVSSGLLESRSAARRMMKQGGIYLNNERVEEESKRVGDDDIVEGKVLLLSAGK  506

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  507  KNKIVVRIS  515



>ref|XP_010485586.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
 ref|XP_010485587.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Camelina 
sativa]
Length=511

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+PSCS    +VS
Sbjct  384  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPSCSLSIDRVS  442

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E K++EE+DI +GK L+ SAGK
Sbjct  443  GSSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENKRVEEEDIVEGKGLVLSAGK  502

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  503  KNKVVVRIS  511



>ref|XP_006297370.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
 gb|EOA30268.1| hypothetical protein CARUB_v10013389mg, partial [Capsella rubella]
Length=548

 Score =   148 bits (374),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 89/129 (69%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE I+ D+PSCS P  +V 
Sbjct  421  QIKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERISEDIPSCSLPIDRVL  479

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++DLSVS+GL ESKSAARRMLKQGG Y+NN RVD E +++EE+DI +GK L+ SAGK
Sbjct  480  GLSIVDLSVSAGLFESKSAARRMLKQGGFYMNNERVDDENRRVEEEDIVEGKGLVLSAGK  539

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  540  KNKVVVRIS  548



>ref|XP_006408394.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 ref|XP_006408395.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49847.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
 gb|ESQ49848.1| hypothetical protein EUTSA_v10020578mg [Eutrema salsugineum]
Length=499

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LA EVTRFVHG+EGL EA+KATEALRPG A+TKL+   IE IA D+PSCS P  +VS
Sbjct  372  QIKLAAEVTRFVHGEEGLKEAIKATEALRPG-AETKLEWNLIERIAEDIPSCSLPIDRVS  430

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              SV+DLSVS+GL ESKSAA+RMLKQGG+Y+NNARVD E K++EE DI DGK L+ S+GK
Sbjct  431  GFSVVDLSVSAGLFESKSAAKRMLKQGGIYMNNARVDDENKRVEEADIIDGKGLVLSSGK  490

Query  161  KNKXVVRIS  135
            KNK VVRIS
Sbjct  491  KNKVVVRIS  499



>ref|XP_009118453.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118460.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118468.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
 ref|XP_009118475.1| PREDICTED: probable tyrosine--tRNA ligase, mitochondrial [Brassica 
rapa]
Length=503

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+EGL EA+KATEALRPG A+TKLD   IE IA D+P+CS P  +VS
Sbjct  376  QMKLAEEVTRFVHGEEGLKEAIKATEALRPG-AETKLDWNLIERIAEDIPTCSLPIDRVS  434

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +S++D+SVS+GL ESKSAARR LKQGG+Y+NN RVD E K++EE+DI +GK L+ S+GK
Sbjct  435  GVSIVDVSVSAGLFESKSAARRTLKQGGVYMNNQRVDDENKRVEEEDIVEGKGLVLSSGK  494

Query  161  KNKXVVRIS  135
            KNK V+RIS
Sbjct  495  KNKVVIRIS  503



>ref|XP_006826574.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
 gb|ERM93811.1| hypothetical protein AMTR_s00138p00020780 [Amborella trichopoda]
Length=495

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL EA+KATEAL+PG ++ KLD K IE I +DVPSC   + +V 
Sbjct  366  QRRLAEEVTRFVHGKDGLLEAVKATEALKPG-SEAKLDSKIIEEIGADVPSCCLDYHEVL  424

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DLSV+SGLLESKSAARR++KQGGLYLNN RV+ E   +EE+DI DGKVLL SAGK
Sbjct  425  NRSLVDLSVASGLLESKSAARRLMKQGGLYLNNKRVNGEDILVEEEDIVDGKVLLLSAGK  484

Query  161  KNKXVVRI  138
            KNK V++I
Sbjct  485  KNKMVIKI  492



>ref|XP_002992920.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
 gb|EFJ06009.1| hypothetical protein SELMODRAFT_136175 [Selaginella moellendorffii]
Length=467

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL+EALK T+AL PG+  T LD   IE I+ DVPSC+     V 
Sbjct  341  QRRLAEEVTRFVHGEDGLEEALKVTQALSPGST-TTLDWTAIEAISRDVPSCTLD-SSVV  398

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+DL VS GL  SK+ ARR++KQGG+Y+NNA+VD E   + E DI DGK+LL SAGK
Sbjct  399  VGPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGK  458

Query  161  KNKXVVRI  138
            KNK VVRI
Sbjct  459  KNKMVVRI  466



>ref|XP_002980036.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
 gb|EFJ18906.1| hypothetical protein SELMODRAFT_111886 [Selaginella moellendorffii]
Length=467

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG++GL+EALK T+AL PG+  T LD   IE I+ DVPSC+     + 
Sbjct  341  QRRLAEEVTRFVHGEDGLEEALKVTQALAPGST-TTLDWTAIEAISKDVPSCTLD-SSIV  398

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+DL VS GL  SK+ ARR++KQGG+Y+NNA+VD E   + E DI DGK+LL SAGK
Sbjct  399  VGPVVDLCVSCGLAPSKAVARRLIKQGGIYMNNAKVDDERLLVAESDIIDGKMLLLSAGK  458

Query  161  KNKXVVRI  138
            KNK VVRI
Sbjct  459  KNKMVVRI  466



>ref|XP_001699082.1| hypothetical protein CHLREDRAFT_139405 [Chlamydomonas reinhardtii]
 gb|EDO98937.1| predicted protein [Chlamydomonas reinhardtii]
Length=492

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL +ALKATEAL+PG A T+LD  T+E +A D PS S P   V+
Sbjct  364  QKRLAEEVTRFVHGEEGLAQALKATEALKPGAA-TQLDAATLEEVAGDAPSASLPRASVA  422

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               + D+ V+  L  SKSAAR+++K GG+YLNNA+V  E   +  +D+ DG++LL +AGK
Sbjct  423  GAPLADVMVAIKLQPSKSAARKLIKGGGVYLNNAKVVEELYVVRPEDLIDGRLLLVAAGK  482

Query  161  KNKXVVRI  138
            KNK +VRI
Sbjct  483  KNKMLVRI  490



>emb|CBI22389.3| unnamed protein product [Vitis vinifera]
Length=399

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 91/104 (88%), Gaps = 1/104 (1%)
 Frame = -1

Query  446  EALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvssisvldlsvssglleSKSAARRMLK  267
            + +RPG A+TKLD KTIEGIA DVPSCS  + +V ++S+LDLS+S+GLLESKSAARR+LK
Sbjct  297  DVVRPG-AETKLDWKTIEGIAKDVPSCSLSYDEVLNLSLLDLSISTGLLESKSAARRLLK  355

Query  266  QGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGKKNKXVVRIS  135
            QGGLYLNN R+DSEAK+IE +DI DGKVLL SAGKKNK VVRIS
Sbjct  356  QGGLYLNNNRIDSEAKRIEAEDIVDGKVLLLSAGKKNKVVVRIS  399



>ref|XP_005848281.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
 gb|EFN56179.1| hypothetical protein CHLNCDRAFT_48743 [Chlorella variabilis]
Length=440

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL +ALKATEAL PG A TKLD  ++E  A D PS S P  QV 
Sbjct  313  QRRLAEEVTRFVHGEEGLRQALKATEALAPGAA-TKLDADSLEAAAGDAPSASLPRDQVV  371

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               + D+ V+ G+  SK+A RRM+K GG+ +NN +VD E   + EDD+ DG+++L +AGK
Sbjct  372  GAPLADVMVAVGMQPSKAAVRRMIKGGGVRVNNEKVDDELAALGEDDLIDGRLVLIAAGK  431

Query  161  KNKXVVRIS  135
            KNK +VR++
Sbjct  432  KNKMLVRVA  440



>ref|XP_002955541.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
 gb|EFJ43394.1| hypothetical protein VOLCADRAFT_83275 [Volvox carteri f. nagariensis]
Length=520

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG+EGL +A+KATEAL+PG A T+LD  T+E +A D PS +     V 
Sbjct  391  QRRLAEEVTRFVHGEEGLAQAIKATEALKPGAA-TQLDAATLETVAGDAPSATLTRGSVE  449

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + + D+ V+  L  SKSAAR+++K GG+YLNNA+V  E   ++  D+ DG++LL +AGK
Sbjct  450  GVPLADILVAVKLQPSKSAARKLIKGGGVYLNNAKVSEELYTVKPSDLIDGRLLLIAAGK  509

Query  161  KNKXVVRIS  135
            KNK +VR++
Sbjct  510  KNKMLVRVA  518



>ref|XP_005650588.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE26044.1| tyrosyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=450

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA EVTRFVHGQ GLD+AL AT+AL PG +DTKLD  T+E +A   P+   P  QV 
Sbjct  322  QRLLASEVTRFVHGQLGLDQALNATQALAPG-SDTKLDIDTLEAVAGSAPTVELPAGQVL  380

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              ++ D+ V+  L ESKSA RR++K GG+ +NN +V  E +++ EDD  DG++ L +AGK
Sbjct  381  GQTLADIMVAIKLQESKSAGRRLIKGGGVRVNNQKVSDEQRRLSEDDFIDGRLALIAAGK  440

Query  161  KNKXVVRIS  135
            KNK ++RIS
Sbjct  441  KNKMLLRIS  449



>gb|KIZ02509.1| tyrosyl-tRNA synthetase [Monoraphidium neglectum]
Length=155

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 89/128 (70%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE +T FVHG EGL  ALKATEALRPG A T+LD  T+E IA D P+CS    QV 
Sbjct  28   QRRLAEALTEFVHGPEGLATALKATEALRPGAA-TELDAATLEAIAGDAPTCSLKREQVE  86

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++D+ V+SG+L SK   RRM+K GG+YLNNA+V  + + +   D+ DG++ L + GK
Sbjct  87   GQLLVDVVVASGMLPSKGEVRRMVKNGGVYLNNAKVADDKRALTPADLIDGRLALLACGK  146

Query  161  KNKXVVRI  138
            KNK +VR+
Sbjct  147  KNKMLVRV  154



>ref|XP_003059850.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH55802.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=430

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+ GL +ALKATE L+PG ADT LD  T+E +A D+PS      +V 
Sbjct  304  QKRLAEEVTRFVHGEAGLSQALKATEGLKPG-ADTVLDADTLEALAGDIPSAELSLGEVV  362

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +V+D+  ++GL +SK  A+R++K GG  +NN +V+ E K IEE D+ DG+VLL +AGK
Sbjct  363  GRTVVDVMAATGLQKSKGEAKRLIKGGGARVNNVKVEDEGKVIEEGDVVDGRVLLLAAGK  422

Query  161  KNKXVVRI  138
            KNK +VR+
Sbjct  423  KNKLLVRV  430



>ref|XP_002504529.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65787.1| predicted protein [Micromonas sp. RCC299]
Length=506

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 93/128 (73%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL +ALKATE L+PG ADT LD  T+E +A D+P+      +V 
Sbjct  379  QKRLAEEVTRFVHGKEGLTQALKATEGLKPG-ADTVLDAATLEALAGDIPTAELARDEVV  437

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +V+D+  ++GL +SK  A+RM+K GG  LNN +V+ E   I EDD+ +G+VLL +AGK
Sbjct  438  GKTVVDVMAATGLQKSKGEAKRMIKGGGARLNNVKVEDEEATIGEDDVIEGRVLLLAAGK  497

Query  161  KNKXVVRI  138
            KNK +VR+
Sbjct  498  KNKLLVRV  505



>ref|XP_001751567.1| predicted protein [Physcomitrella patens]
 gb|EDQ83884.1| predicted protein [Physcomitrella patens]
Length=502

 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 98/129 (76%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG++GL EALKAT+AL P  A   LD +T+E IA DVPSCS  +  V 
Sbjct  375  QKRLAEEVTRFVHGEQGLTEALKATQALAP-GAAAALDSQTLEAIAQDVPSCSISY-SVV  432

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++D+SVS+GLL+SK+A RR++KQGGLYLNN +V+ E K +  +DI D K+ L SAGK
Sbjct  433  GKPLVDVSVSTGLLQSKAAVRRLIKQGGLYLNNVKVEDEGKTMVAEDIIDDKIFLLSAGK  492

Query  161  KNKXVVRIS  135
            KN+ VVR++
Sbjct  493  KNRLVVRVT  501



>ref|XP_001416448.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
 gb|ABO94741.1| Tyrosyl-tRNA synthetase, probable [Ostreococcus lucimarinus CCE9901]
Length=484

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/129 (49%), Positives = 86/129 (67%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHG +GL+EA  AT  L+PG ADT LD   +  +   VPS + P  QV 
Sbjct  357  QRRLAEEVTRFVHGVQGLEEAQAATSVLKPG-ADTDLDVTALTALEGIVPSATLPMQQVL  415

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             IS++ L+V  GL  SK A +R+++ GGL LNN +V S+   +   DI DG++LL +AGK
Sbjct  416  GISLVQLAVDVGLQPSKGATKRLIQGGGLRLNNIKVLSDEATVSMADIVDGRLLLLAAGK  475

Query  161  KNKXVVRIS  135
            KNK ++ ++
Sbjct  476  KNKLLISVT  484



>ref|XP_003075033.1| TyrS Tyrosyl-tRNA synthetase, probable (IC) [Ostreococcus tauri]
 emb|CAL52305.2| Aminoacyl-tRNA synthetase, class Ic [Ostreococcus tauri]
Length=488

 Score =   101 bits (251),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 65/128 (51%), Positives = 87/128 (68%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVTRFVHGQ+GLDEA++ATE+LRPG  +T LD   +E  +  +PS +     V 
Sbjct  358  QQILAAEVTRFVHGQDGLDEAIRATESLRPGT-ETVLDAAALELASDTIPSVAISRVAVV  416

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V D+ V SGLLESK AA+RML+ GG+ +NN +V  E + I E DI    +LL +AGK
Sbjct  417  DNLVTDVVVVSGLLESKGAAKRMLRNGGIRVNNNKVTDETRTIVEGDIIGDNMLLLAAGK  476

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  477  KNKLLIRL  484



>ref|WP_032125960.1| tyrosyl-tRNA synthetase [Chlamydia sp. 'Diamant']
Length=424

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 88/128 (69%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TR VHG EGL  A+K TE + PG + TKLD + +E +A+D+PSC   F  V 
Sbjct  296  QKRLAEEITRMVHGGEGLKTAIKVTEGIAPG-SQTKLDAEMLESLAADMPSCEMAFDSVV  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++DL V +GL  SK  A+R+L+ GG+Y+NN +++ E   + ++ +   +++L +AGK
Sbjct  355  NKKLIDLLVEAGLQASKGDAKRLLRNGGVYINNEKIEDENCVVGDNYLISNRLILLAAGK  414

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  415  KNKMLIRL  422



>ref|WP_042279297.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia sp. R18]
Length=425

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC      V 
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + +   +++L +AGK
Sbjct  355  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  415  KNKMIIRL  422



>ref|WP_011175719.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
 sp|Q6MC06.1|SYY_PARUW RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Candidatus Protochlamydia amoebophila 
UWE25]
 emb|CAF23893.1| probable tyrosine-tRNA ligase [Candidatus Protochlamydia amoebophila 
UWE25]
Length=425

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC      V 
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++DL V + L  SKS ARR+L+ GG+Y+NN +++ E   I  + +   +++L +AGK
Sbjct  355  NKKLIDLLVETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  415  KNKMIIRL  422



>ref|WP_039359281.1| tyrosyl-tRNA synthetase [Candidatus Protochlamydia amoebophila]
Length=425

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC      V 
Sbjct  296  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + +   +++L +AGK
Sbjct  355  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  414

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  415  KNKMIIRL  422



>gb|KIC71389.1| Tyrosine--tRNA ligase [Candidatus Protochlamydia amoebophila]
Length=437

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 84/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+TR VHG+EGL  A+K TE + PG + T L+   +E +A+D+PSC      V 
Sbjct  308  QKRLAEEITRLVHGEEGLKIAIKVTEGVAPG-SQTSLNADILEKLAADMPSCEMKLENVL  366

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++DL   + L  SKS ARR+L+ GG+Y+NN +++ E   I  + +   +++L +AGK
Sbjct  367  NKKLIDLLAETKLQTSKSEARRLLRNGGVYINNKKIEDENHIISVECLISSRLILLAAGK  426

Query  161  KNKXVVRI  138
            KNK ++R+
Sbjct  427  KNKMIIRL  434



>ref|WP_013182397.1| tyrosyl-tRNA synthetase [Waddlia chondrophila]
 gb|ADI38686.1| Tyrosyl-tRNA synthetase [Waddlia chondrophila WSU 86-1044]
 emb|CCB90919.1| tyrosyl-tRNA synthetase [Waddlia chondrophila 2032/99]
Length=427

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 86/132 (65%), Gaps = 1/132 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT+ VHG +GL  ALK TEA +PG  +T L+ + +E IA D+PS +    ++ 
Sbjct  296  QKRLAAEVTQMVHGDQGLKTALKVTEAAKPGR-ETDLNAEVLESIAHDMPSETFKAEEIV  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++D+ V +GL ESK  ARR+++ GG YLNN ++  E      DD  DG+++L + GK
Sbjct  355  NNKLIDVVVLTGLQESKGQARRLIRNGGCYLNNKKMTEENHVFTADDFVDGRLILLAVGK  414

Query  161  KNKXVVRIS*PI  126
            KNK ++R+  P+
Sbjct  415  KNKKLIRLDKPV  426



>ref|XP_010229641.1| PREDICTED: LOW QUALITY PROTEIN: probable tyrosine--tRNA ligase, 
mitochondrial [Brachypodium distachyon]
Length=473

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 51/58 (88%), Gaps = 1/58 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQ  348
            QR LAEE+TRFVHGQEGL+EALKAT+ALRPG A T+LD +TIEGIA DVPSCS P+ Q
Sbjct  385  QRILAEEITRFVHGQEGLEEALKATQALRPG-AQTQLDSQTIEGIADDVPSCSLPYDQ  441



>ref|WP_042103652.1| tyrosyl-tRNA synthetase [Parachlamydiaceae bacterium HS-T3]
Length=420

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTR VHG+EGL  A+K T+A +PG A T L  + +E ++ D+PS   P   + 
Sbjct  293  QKRLAEEVTRIVHGEEGLQTAIKVTQAAKPG-AQTDLSLEALEMLSRDMPSIQLPLADLV  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++D+   SGL  SKS AR+++K GG YLNN +V      I+  D+   K+LL + GK
Sbjct  352  NKKIVDVLALSGLQSSKSEARKLIKNGGFYLNNHQVLDIDAAIQPSDLIGEKMLLLAVGK  411

Query  161  KNKXVVRI  138
            KNK +V++
Sbjct  412  KNKLLVKV  419



>ref|WP_006340872.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|EFB41848.1| hypothetical protein pah_c022o146 [Parachlamydia acanthamoebae 
str. Hall's coccus]
 emb|CCB86267.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae UV-7]
Length=430

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ +     + 
Sbjct  296  QRKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENIL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++D+        SK   R+++K GG+YLNN R++ E   +    + DG ++L + GK
Sbjct  355  NRRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGK  414

Query  161  KNKXVVRIS  135
            KNK +VR+S
Sbjct  415  KNKILVRVS  423



>emb|CDZ80947.1| Tyrosine--tRNA ligase [Chlamydia sp. 'Rubis']
Length=419

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 82/129 (64%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  +T  VHG+  L  ALK T+ + PG A T+LD +T++ ++ D+ SC   + +V 
Sbjct  291  QKRLAHVMTELVHGENNLQLALKVTQGIAPG-AITQLDSQTLQALSKDLGSCQLSYKEVV  349

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  +LDL V SGL  SK+ AR+ +  GG+YLNN ++  E   + +  + DG +LL S GK
Sbjct  350  NHKILDLLVKSGLQPSKTQARKSMTSGGIYLNNEKITDEEAVLLDKHLIDGNMLLLSFGK  409

Query  161  KNKXVVRIS  135
            KNK VV+++
Sbjct  410  KNKIVVQLN  418



>ref|WP_013943141.1| tyrosyl-tRNA synthetase [Simkania negevensis]
 emb|CCB88674.1| tyrosyl-tRNA synthetase [Simkania negevensis Z]
Length=424

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 79/129 (61%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EG+  AL+ T A+ PG ++  LD + +E IA D+P  +    +V 
Sbjct  296  QKRLAEEVTRFVHGEEGVQIALRVTAAIAPG-SNASLDPEILEEIARDMPHVALDVSEVL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                 D+   +G + SKS A R+++ GG YLNN +V+  A  I +  +   K ++  +GK
Sbjct  355  DQKYTDVITKAGFVTSKSEAARLIQNGGAYLNNEKVEDPAFTITKKHLIGNKYVMLGSGK  414

Query  161  KNKXVVRIS  135
            K K +++I+
Sbjct  415  KKKMLIKIA  423



>ref|WP_039384881.1| tyrosyl-tRNA synthetase [Neochlamydia sp. TUME1]
 gb|KIC75964.1| Tyrosine--tRNA ligase [Neochlamydia sp. TUME1]
Length=424

 Score = 84.3 bits (207),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS       V 
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDATTLELMAQNMPSRILNNKTVI  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD+   +++L + GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGK  414

Query  161  KNKXVVRI  138
            KNK ++ I
Sbjct  415  KNKILISI  422



>ref|WP_042240888.1| tyrosyl-tRNA synthetase [Neochlamydia sp. S13]
Length=424

 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 80/128 (63%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS       V 
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVI  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD+   +++L + GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANRLMLLAVGK  414

Query  161  KNKXVVRI  138
            KNK ++ I
Sbjct  415  KNKILISI  422



>ref|XP_005713019.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
 emb|CDF33216.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Chondrus 
crispus]
Length=510

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 85/128 (66%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTR VHG++G+  AL AT A  PG+    L  + +E I++D+PS +     V 
Sbjct  383  QKRLAEEVTRMVHGEKGVVSALAATAAAAPGSKAV-LSVEALEAISADMPSATMTRADVV  441

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               +LDL V SGL +SK  ARR++K GG YLNN ++ +E   I E+D+  GK++L +AGK
Sbjct  442  GGGILDLMVQSGLQKSKGEARRLIKGGGAYLNNGKITTEKLSISEEDLVGGKLILLAAGK  501

Query  161  KNKXVVRI  138
            KNK VVR+
Sbjct  502  KNKLVVRV  509



>ref|WP_039376683.1| tyrosyl-tRNA synthetase [Parachlamydia acanthamoebae]
 gb|KIA77993.1| Tyrosine--tRNA ligase [Parachlamydia acanthamoebae]
Length=437

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 73/125 (58%), Gaps = 1/125 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTR VHG+EGL  ALK TE   PG A T LD + +  +A D+P+ +     + 
Sbjct  296  QRKLAEEVTRIVHGEEGLRIALKVTEGAAPGAA-TALDAEVLNNLADDMPNYTVSMENIL  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  ++D+        SK   R+++K GG+YLNN R++ E   +    + DG ++L + GK
Sbjct  355  NRRLVDVVSEITPERSKGDLRKLIKNGGVYLNNLRIEEENYILTPKALIDGNLMLIAFGK  414

Query  161  KNKXV  147
            K K +
Sbjct  415  KIKYL  419



>gb|KIC73976.1| Tyrosine--tRNA ligase [Neochlamydia sp. EPS4]
Length=424

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 79/128 (62%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+EVTR VHG+E L  AL  TEA  PG A   LD  T+E +A ++PS       V 
Sbjct  296  QKRLAKEVTRIVHGEENLKIALGVTEAAAPG-AKANLDAPTLELMAQNMPSRILNNKTVI  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +  +L+L    GLL SKS ARR+ + GG+YLNN +V+ E   I+ DD+    ++L + GK
Sbjct  355  NAKLLELICQVGLLPSKSEARRLARNGGIYLNNNKVEDENYIIQPDDLIANHLMLLAVGK  414

Query  161  KNKXVVRI  138
            KNK ++ I
Sbjct  415  KNKILISI  422



>ref|XP_005538192.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM82156.1| tyrosine--tRNA ligase, mitochondrial or chloroplast [Cyanidioschyzon 
merolae strain 10D]
Length=522

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 83/137 (61%), Gaps = 8/137 (6%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPG--------NADTKLDXKTIEGIASDVPSC  366
            Q+ LA EVTR VHG +G++ AL AT    PG        N  T+L    +E ++S +P  
Sbjct  384  QKLLAMEVTRIVHGDKGVETALAATAVAAPGHVPGGEHTNGSTRLRADVLEAVSSSLPGA  443

Query  365  SXPFXQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGK  186
            + P   +  + ++D+ V +GL +SK  ARR++  GG Y+N+ +V    + IE  D+ +G+
Sbjct  444  TLPRTALVGVPLVDVMVRAGLQKSKGEARRLIANGGAYVNDEKVSDSGRTIEATDLIEGR  503

Query  185  VLLXSAGKKNKXVVRIS  135
            +LL +AGKKNK +VR+S
Sbjct  504  LLLLAAGKKNKMLVRVS  520



>ref|XP_007509051.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
 emb|CCO19508.1| tyrosyl-tRNA synthetase [Bathycoccus prasinos]
Length=486

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAEEVTRFVHG+ GL +A+ AT+ L PG +DT+LD   +E +   VP+       + 
Sbjct  358  QVRLAEEVTRFVHGEVGLQKAITATKGLLPG-SDTELDIDVLESLIDVVPTAICARTDII  416

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             I ++D++V  GL +SK+  RRM+  GG+ +NN +V   +  I  +++  G++LL S GK
Sbjct  417  GIPIVDVAVKVGLRKSKAEVRRMIDGGGVRINNKKVLDVSTCISPEELIAGRMLLISMGK  476

Query  161  KNKXVVRI  138
            KNK ++++
Sbjct  477  KNKFLIQV  484



>ref|XP_009516786.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
 gb|EGZ29511.1| hypothetical protein PHYSODRAFT_552811 [Phytophthora sojae]
Length=428

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 80/128 (63%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P  +     V 
Sbjct  301  QKVLAEDITAMMHGQEGLKAALDATELLF-GKKSGPLTAEEMLRMAGDAPMSALSRADVV  359

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DL+V  G  +SK+  RR++K GG+YLNN RV+SEA ++E  ++ DGK+L+   G+
Sbjct  360  DQSLVDLAVRIGAAKSKAECRRLIKGGGVYLNNERVESEALRVEAANLLDGKLLVLRIGR  419

Query  161  KNKXVVRI  138
            +N  +V++
Sbjct  420  RNNFIVQV  427



>ref|XP_008910914.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
 gb|ETN03687.1| tyrosine-tRNA ligase [Phytophthora parasitica INRA-310]
Length=428

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P        V 
Sbjct  301  QKVLAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVV  359

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DL+V  G ++SK+  RR++K GG+YLNN RV+SEA ++E  ++ D KVL+   G+
Sbjct  360  DQSLVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGR  419

Query  161  KNKXVVRI  138
            +N  +V++
Sbjct  420  RNNFIVQV  427



>gb|ETI39233.1| tyrosine-tRNA ligase [Phytophthora parasitica P1569]
 gb|ETK79440.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL32852.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETL86112.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETM39261.1| tyrosine-tRNA ligase [Phytophthora parasitica]
 gb|ETO67974.1| tyrosine-tRNA ligase [Phytophthora parasitica P1976]
 gb|ETP09145.1| tyrosine-tRNA ligase [Phytophthora parasitica CJ01A1]
 gb|ETP37177.1| tyrosine-tRNA ligase [Phytophthora parasitica P10297]
Length=428

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 79/128 (62%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAE++T  +HGQEGL  AL ATE L  G     L  + +  +A D P        V 
Sbjct  301  QKVLAEDITVMMHGQEGLKAALDATELLF-GKKQGPLTAEEMLQMAGDAPMTILSRTDVV  359

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S++DL+V  G ++SK+  RR++K GG+YLNN RV+SEA ++E  ++ D KVL+   G+
Sbjct  360  DQSLVDLAVRIGAVKSKAECRRLIKGGGVYLNNERVESEALRVEPSNLLDDKVLMVRVGR  419

Query  161  KNKXVVRI  138
            +N  +V++
Sbjct  420  RNNFIVQV  427



>ref|XP_011397334.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM24446.1| Tyrosine-tRNA ligase [Auxenochlorella protothecoides]
Length=476

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 74/123 (60%), Gaps = 1/123 (1%)
 Frame = -1

Query  503  EVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIE-GIASDVPSCSXPFXQvssisvl  327
            EVTRFVHG+EGL  AL AT AL PG+++  +D +T+E  +A   P  +          ++
Sbjct  350  EVTRFVHGEEGLRGALAATRALAPGSSEGSVDLQTLEAAVAGGAPKFAVDREAALGGPLI  409

Query  326  dlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGKKNKXV  147
            DL V  G   SK AARR+++  GL +NN  V  E + +  DD+ DG++++ S GKK K V
Sbjct  410  DLLVRVGAQPSKGAARRLVQGRGLRVNNKVVTDEGRGLAADDLVDGRLVMVSLGKKKKLV  469

Query  146  VRI  138
            + +
Sbjct  470  LEL  472



>ref|WP_022848286.1| tyrosyl-tRNA synthetase [Chloroflexi bacterium oral taxon 439]
Length=430

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 4/132 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCS---XPFX  351
            QR LAEE+T  +HGQ+ LD+A +AT AL  G+ D  L    I+ I +DVPS +       
Sbjct  298  QRALAEEMTYLMHGQKALDKARQATSALFGGDID-GLSADDIQDIFADVPSKTIRPAELS  356

Query  350  QvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXS  171
                     LS +SG L+SK  ARR + +GG+YLNN R D+ A  +   D  +G  L+  
Sbjct  357  GAPVDLAAFLSETSGFLKSKGEARRAIAEGGIYLNNHRADNAAAIVTRSDFIEGAFLVLR  416

Query  170  AGKKNKXVVRIS  135
             GKKN  +VR+S
Sbjct  417  RGKKNYFLVRLS  428



>ref|WP_040313631.1| tyrosyl-tRNA synthetase [Actinomyces cardiffensis]
Length=420

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P       +  
Sbjct  295  QKALAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE--  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++D  V +GL + KSAARR L  GG YLNN +V+ E   I  +D+  G  +L   G+
Sbjct  353  -ATIIDALVETGLEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGR  411

Query  161  KNKXVVRIS  135
            +N  VV +S
Sbjct  412  RNLAVVELS  420



>gb|ENO19082.1| tyrosine--tRNA ligase [Actinomyces cardiffensis F0333]
Length=423

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVTR VHG+E LD  L AT AL  G     +D +T+    SD+P       +  
Sbjct  298  QKALAAEVTRLVHGEEELDRVLAATNALWGGGDLHAIDEQTLSSATSDLPQACLKLGE--  355

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++D  V +GL + KSAARR L  GG YLNN +V+ E   I  +D+  G  +L   G+
Sbjct  356  -ATIIDALVETGLEKGKSAARRTLASGGAYLNNIKVEDEDAPICVEDLLAGSRVLVRKGR  414

Query  161  KNKXVVRIS  135
            +N  VV +S
Sbjct  415  RNLAVVELS  423



>ref|WP_022864835.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
Length=421

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 74/122 (61%), Gaps = 3/122 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVTR VHGQE LD+ L ATEAL       ++D KT++G  + +PS +    ++ 
Sbjct  295  QKALAAEVTRLVHGQEALDQVLAATEALWGSGDLRQVDGKTLKGATAHLPSAT---VEIG  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL +++G  + + AA R +K GG YLNN ++    + I  +D+  G ++L   GK
Sbjct  352  KTNLVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKITDPDRTITSEDVLPGSLVLFRKGK  411

Query  161  KN  156
            +N
Sbjct  412  RN  413



>ref|XP_002907836.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
 gb|EEY64400.1| tyrosyl-tRNA synthetase, putative [Phytophthora infestans T30-4]
Length=428

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 77/127 (61%), Gaps = 1/127 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE+T  +HGQEGL  AL ATE L  G     L  + +  +A D P        V 
Sbjct  301  QKVLAEEITVMMHGQEGLKAALDATEMLF-GKKTGPLTSEEMLCMAGDAPMTVLSRADVI  359

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + S++DL+V  G  +SK+  RR++K GG+YLNN RV+S A +I + ++ D KVL+   G+
Sbjct  360  NQSLVDLAVRIGATKSKAECRRLIKSGGVYLNNERVESAALRIGKSNLLDDKVLVVRVGR  419

Query  161  KNKXVVR  141
            +N  +V+
Sbjct  420  RNNFIVQ  426



>ref|WP_041017153.1| tyrosyl-tRNA synthetase [Criblamydia sequanensis]
 emb|CDR33719.1| Tyrosyl-tRNA synthetase [Criblamydia sequanensis CRIB-18]
Length=420

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTRFVHG+EGL++AL AT+A  PG ++T LD  ++E    D+P          
Sbjct  293  QKKLAEEVTRFVHGEEGLEKALLATKAAAPG-SETVLDADSLEIAMKDMPYFEPELL--V  349

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL   SGL  SKSAARR++++GG+ LNN +++ E K I+ +D+   + ++ + GK
Sbjct  350  GSKLIDLIADSGLRPSKSAARRLIREGGVSLNNKKINDEEKVIQTEDLIGNRFVVVTLGK  409

Query  161  KNKXVVR  141
            K K +V+
Sbjct  410  KQKMLVK  416



>ref|WP_024058184.1| tyrosyl-tRNA synthetase [Varibaculum cambriense]
 gb|ETI82476.1| hypothetical protein Q618_VCMC00001G0057 [Varibaculum cambriense 
DORA_20]
Length=421

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVTR VHGQE LD+ L ATEAL       ++D  T++G  + +PS      ++ 
Sbjct  295  QKALAAEVTRLVHGQEALDQVLAATEALWGSGDLHQVDGNTLKGATAHLPSAK---VEIG  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL +++G  + + AA R +K GG YLNN +V    + I  +D+  G ++L   GK
Sbjct  352  KTNLVDLLIAAGFEKGRGAAMRTIKNGGAYLNNQKVTDPDRVITSEDVLPGSLVLFRKGK  411

Query  161  KNKXVVRI  138
            +N  V  +
Sbjct  412  RNLAVAYL  419



>gb|AFG55784.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55787.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPS  369
            QR LAEEVT FVHG+EGL EAL+ATEAL PG+  T LD KTI+ IA++VPS
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPS  132



>gb|AFG55783.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPS  369
            QR LAEEVT FVHG+EGL EAL+ATEAL PG+  T LD KTI+ IA++VPS
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPS  132



>gb|AFG55790.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55791.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55792.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55793.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55795.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55797.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPS  369
            QR LAEEVT FVHG+EGL EAL+ATEAL PG+  T LD KTI+ IA++VPS
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPS  132



>gb|AEW07904.1| hypothetical protein 0_14069_01, partial [Pinus radiata]
 gb|AFG55785.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55786.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55788.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55789.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55794.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55796.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55798.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
 gb|AFG55799.1| hypothetical protein 0_14069_01, partial [Pinus taeda]
Length=161

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPS  369
            QR LAEEVT FVHG+EGL EAL+ATEAL PG+  T LD KTI+ IA++VPS
Sbjct  83   QRKLAEEVTCFVHGEEGLKEALRATEALAPGS-KTHLDWKTIDAIANEVPS  132



>ref|WP_018200080.1| tyrosyl-tRNA synthetase [Candidatus Hydrogenedens terephthalicus]
Length=427

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA E+TR VHG+  L  A++A+EA+  G+   +L+   +E + SDVP    P   ++
Sbjct  298  QKALAREITRMVHGETALQSAIRASEAMFGGDLH-QLELSVLEDVFSDVPHAEAPINYIT  356

Query  341  sisvldlsvssg-lleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
                L   + +  +LESK   +R++K GGLY+NN RV  +  ++ E+ +  G +L+   G
Sbjct  357  ENQFLLDLLINTGILESKGEGKRLIKNGGLYINNERVTEDTLRLNENYLLGGSLLVIRLG  416

Query  164  KKNKXVVRI  138
            KK+  +++ 
Sbjct  417  KKDYRLIQF  425



>ref|XP_009837943.1| tyrosine-tRNA ligase [Aphanomyces astaci]
 gb|ETV72715.1| tyrosine-tRNA ligase [Aphanomyces astaci]
Length=439

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 69/129 (53%), Gaps = 3/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAE  TR +HG+  L  A  A + L  G+ D       ++ +A D P  S     V 
Sbjct  308  QQILAEHTTRMIHGEVALKAAQVAAKVLFGGSLD---GVDAVDILAIDAPRSSLALELVR  364

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+D+      + +K+  RR++K GG+Y+NN RVDS+A  IE   + +G+ +L   GK
Sbjct  365  GKRVVDVLALIRAVPTKAEGRRLIKAGGVYINNVRVDSDAAVIEASQVIEGRAVLVRVGK  424

Query  161  KNKXVVRIS  135
            +N  V+ IS
Sbjct  425  RNYHVLHIS  433



>ref|WP_029668640.1| tyrosyl-tRNA synthetase [Candidatus Ancillula trichonymphae]
Length=418

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT+FVHG+E   +A++A++AL    +  K+D  TI    S + +         
Sbjct  294  QRKLAEEVTKFVHGREAFVQAVEASDALFGRGSIEKIDEATIIAAISGLETSEANLGDKI  353

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            S   ++  +S+      +  R+ L  GG+Y+NN +V+S  + IE  DI +G+V+L   GK
Sbjct  354  SEQFVNTKLSASF----NDYRKTLSAGGVYVNNKKVESLDRAIENTDILNGQVVLLRKGK  409

Query  161  KNKXVVRIS  135
            KN   VRI+
Sbjct  410  KNIAAVRIT  418



>ref|WP_013600598.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|ADX72661.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans Sphe3]
Length=438

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG E  ++ + A+ AL  GN D T LD  T++   S++PS +    QV
Sbjct  311  QRKLAYEVTSLVHGVEATEKVIAASAALF-GNGDLTALDKTTLQAATSELPSATV---QV  366

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  367  DEMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  426

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  427  KKNLATVEVLVP  438



>ref|WP_034510938.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
 gb|KGE99688.1| tyrosyl-tRNA synthetase [Actinomyces sp. S4-C9]
Length=421

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT+ VHG+E L   L+AT+AL       K+D  T+    S++P+    F +  
Sbjct  295  QKALAAEVTKLVHGEETLQRVLEATDALWGSGDLKKVDAATLSAATSELPAGEVAFGE--  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIXDGKVLLXSAG  165
              +++D  V++GL + K AAR  +  GG YLNN RV+SE + I  ED + DG VL+   G
Sbjct  353  -ATIVDALVAAGLEKGKRAARTTVSSGGAYLNNERVESEDQIISAEDALADGTVLIRK-G  410

Query  164  KKNKXVVR  141
            ++N  VVR
Sbjct  411  RRNLAVVR  418



>gb|AEP11643.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum 
B]
Length=426

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 69/130 (53%), Gaps = 2/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXP--FXQ  348
            QR LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS   P     
Sbjct  293  QRSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFA  352

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
                   DL+V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + +  G+  +   
Sbjct  353  DDGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRK  412

Query  167  GKKNKXVVRI  138
            G +   ++R+
Sbjct  413  GARTYHLLRV  422



>ref|WP_041569078.1| tyrosyl-tRNA synthetase [Candidatus Chloracidobacterium thermophilum]
Length=425

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 69/130 (53%), Gaps = 2/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXP--FXQ  348
            QR LA  VT FVHG  GL  AL AT  L  G+  T +D  T+  +  D PS   P     
Sbjct  292  QRSLAAAVTEFVHGAAGLRTALAATNILFGGDPITDIDADTLLAVFHDAPSTEVPAALFA  351

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
                   DL+V++ L+ SKS ARR+++ GGLY NN RV+S   +I  + +  G+  +   
Sbjct  352  DDGALPSDLAVAARLVSSKSEARRLIEGGGLYFNNQRVESVHARITRERLIGGQYGVLRK  411

Query  167  GKKNKXVVRI  138
            G +   ++R+
Sbjct  412  GARTYHLLRV  421



>ref|WP_044150629.1| tyrosyl-tRNA synthetase, partial [Rothia mucilaginosa]
Length=211

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS   P     
Sbjct  86   QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLP---AD  142

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + ++ +    G  +S S ARR+LK+GG  +N  +V  E   I +DD+  G+  +   GK
Sbjct  143  RLDMISVLTELGFAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  202

Query  161  KNKXVVRI  138
            KN+  V +
Sbjct  203  KNQGAVEL  210



>ref|WP_016445042.1| tyrosyl-tRNA synthetase [Actinomyces europaeus]
 gb|EPD29409.1| tyrosine-tRNA ligase [Actinomyces europaeus ACS-120-V-Col10b]
Length=421

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT+ VHG+E L   L+AT+AL  G    K+D  T+    +++PS    F +  
Sbjct  295  QKTLAAEVTKLVHGEETLQRVLEATDALWGGGDLKKIDPATLSAATAELPSGKIVFGE--  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIE-EDDIXDGKVLLXSAG  165
              +++D  V++GL + K AAR  +  GG YLNN RV++E   I  ED + DG VL+   G
Sbjct  353  -ATIVDALVAAGLEKGKRAARTTVASGGAYLNNERVENEDLIISGEDALADGTVLIRK-G  410

Query  164  KKNKXVVR  141
            ++N  VVR
Sbjct  411  RRNLAVVR  418



>ref|WP_042457579.1| tyrosyl-tRNA synthetase [Streptacidiphilus jiangxiensis]
Length=421

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS         
Sbjct  295  QRALAEELTVLVHGQEQLDRAVAASKALFGQGELGELDERTLAAAVAELPSAQV----GE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL V++GL  S+SAARR + +GG Y+NNA+++ EA      D+  G+ L+   GK
Sbjct  351  LGEIVDLFVATGLSASRSAARRTVNEGGAYVNNAKIEDEAALATPADLLHGRWLVLRRGK  410

Query  161  KNKXVVRI  138
            +N   V +
Sbjct  411  RNLAAVEL  418



>dbj|BAI65246.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa DY-18]
Length=211

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS   P     
Sbjct  86   QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLP---AD  142

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + ++ +    G  +S S ARR+LK+GG  +N  +V  E   I +DD+  G+  +   GK
Sbjct  143  RLDMISVLTELGFAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  202

Query  161  KNKXVVRI  138
            KN+  V +
Sbjct  203  KNQGAVEL  210



>ref|WP_037604940.1| tyrosyl-tRNA synthetase [Streptacidiphilus rugosus]
Length=420

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 75/129 (58%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHGQE LD A+ A++AL       +LD +T+    +++PS         
Sbjct  295  QRALAEELTVMVHGQEQLDRAIAASKALFGQGELAELDERTLAAAVAELPSAKV----TE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D+  G+ L+   GK
Sbjct  351  LGEIVDLFVATGLSASRSAARRTVGEGGAYVNNTKVEDEAALATPADLLHGRWLVLRRGK  410

Query  161  KNKXVVRIS  135
            +N   V ++
Sbjct  411  RNLAAVELT  419



>ref|WP_024332044.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
Length=420

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 72/126 (57%), Gaps = 5/126 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LAE VTR VHG +  D+ L ATEAL  G  D K +D KT+   AS   S      +V
Sbjct  295  QKALAESVTRLVHGDQATDQVLAATEALW-GKGDLKAIDEKTL---ASATESLPATHFEV  350

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             + SV+DL V +GL   K AARR +K GG YLNN +V+ E + I   D+  G  +L   G
Sbjct  351  GTSSVVDLLVGTGLERGKGAARRTIKSGGAYLNNVKVEDEDRVISTSDLLSGGKVLIRKG  410

Query  164  KKNKXV  147
            K+N  V
Sbjct  411  KRNLAV  416



>ref|XP_004334902.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR12889.1| tyrosine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=480

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 0/129 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVTR V G++GL  ALKAT  +        L    +  +  DVPS + P   V 
Sbjct  350  QKVLAEEVTRLVRGEQGLHTALKATRVMFGDEPVDSLPPSELLAVLKDVPSVTLPRSSVV  409

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               +  L V+     SK  ARR++K GG+Y+N+ RV ++  ++  DD+    + +   GK
Sbjct  410  GQPLSGLMVACRATASKGEARRLVKGGGVYVNSKRVPNDDYQVGPDDVLGDALCVLRVGK  469

Query  161  KNKXVVRIS  135
            K+  +V+++
Sbjct  470  KSYFLVKLT  478



>ref|XP_008605106.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
 gb|EQC41392.1| tyrosyl-tRNA synthetase [Saprolegnia diclina VS20]
Length=429

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 75/131 (57%), Gaps = 3/131 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ +AE VT  +HG++ L++A +A + L  G+ D  +   T+  I  D P  +    QV 
Sbjct  302  QQTVAEHVTTLIHGKDALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVI  358

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+D+    G +++K+  RR++K GGLY+NN RV+S+A   E     +G+  L   GK
Sbjct  359  GQKVVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLVRTGK  418

Query  161  KNKXVVRIS*P  129
            +N  +++I+ P
Sbjct  419  RNYHIIQITTP  429



>ref|WP_021271485.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. BSW11_IV]
 gb|EQC46963.1| tyrosine--tRNA ligase [Bacteriovorax sp. BSW11_IV]
Length=423

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSX-PFXQv  345
            Q+ LAEEV + VHG+EGL+ AL+AT+    G A TK+  K +  I  DVPS         
Sbjct  295  QKTLAEEVVKLVHGEEGLEAALRATKFFF-GEAITKISDKEVAAIFEDVPSVKLDKALLE  353

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              I + +L V + L  SK  A+R L Q G+ LNN ++D  A K+  D++     L+   G
Sbjct  354  EGIEICELLVQTPLFPSKKEAKRSLDQKGVSLNNNKIDDTAMKVTRDNLVSETSLILRKG  413

Query  164  KKNKXVVRI  138
            KKN  VVR 
Sbjct  414  KKNYCVVRF  422



>ref|WP_008470064.1| tyrosyl-tRNA synthetase [Lactobacillus hominis]
 emb|CCI81347.1| Tyrosyl-tRNA synthetase [Lactobacillus hominis DSM 23910 = CRBIP 
24.179]
Length=420

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT+FVHGQEGLDEA   TEAL  GN    L    IE    + PS         
Sbjct  296  QRRLAEEVTKFVHGQEGLDEAQFITEALFKGNV-KDLSVAQIEQGFKNAPSTEAT---KE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + +++D  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK ++   GK
Sbjct  352  AKNIVDFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSAFDGKFVIIRKGK  411

Query  161  KNKXVVRI  138
            K   +VRI
Sbjct  412  KKYTLVRI  419



>ref|WP_013132266.1| tyrosyl-tRNA synthetase [Thermobispora bispora]
 gb|ADG88733.1| tyrosyl-tRNA synthetase [Thermobispora bispora DSM 43833]
Length=421

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 70/122 (57%), Gaps = 3/122 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+VT  VHG+E L+  + A+ AL       +LD +T+E   ++VP    P     
Sbjct  296  QRALAEDVTALVHGREELERVVAASRALFGHGTLQELDERTLEAALNEVPKAKVP---AL  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                +DL  +SG++ESKSAARR +++GG YLNN +V  E      DD+  G+ L+   GK
Sbjct  353  GAPYVDLLAASGIVESKSAARRAVREGGAYLNNVKVTDEDYVPTADDLLHGRFLVLRRGK  412

Query  161  KN  156
            K 
Sbjct  413  KT  414



>ref|WP_024366580.1| tyrosyl-tRNA synthetase [Arthrobacter sp. TB 26]
Length=437

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ AL  GN D T LD  T++   S++PS S      
Sbjct  310  QRKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDEATLKAATSELPSASV---DA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
            + + ++DL V++GL ESKSAARR + +GG Y+NNA+V      IE   +  G+ LL   G
Sbjct  366  AGLGIIDLLVATGLSESKSAARRTVGEGGAYVNNAKVSDPDALIERGQLLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   V +S
Sbjct  426  KKNLATVEVS  435



>ref|WP_043455304.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
 gb|KIC64694.1| tyrosyl-tRNA synthetase [Arthrobacter phenanthrenivorans]
Length=437

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 78/132 (59%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG E  ++ + A+ AL  GN D + LD  T++   S++PS +    QV
Sbjct  310  QRKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLSTLDKATLQAATSELPSTTV---QV  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  366  DEMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPDAVISESELLHGQYLLLRRG  425

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>gb|KDO34878.1| tyrosyl-tRNA synthetase [Saprolegnia parasitica CBS 223.65]
Length=429

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 73/131 (56%), Gaps = 3/131 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ +AE VT  +HG+  L++A +A + L  G+ D  +   T+  I  D P  +    QV 
Sbjct  302  QQTVAEHVTTLIHGKNALEQAQRAAKVLFGGSCD-GISAATMLSI--DAPKTALAPAQVI  358

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++D+    G +++K+  RR++K GGLY+NN RV+S+A   E     +G+  L   GK
Sbjct  359  GQKIVDVVGLLGAVKTKAEIRRLIKAGGLYINNVRVESDAAVFESHHAIEGQATLLRTGK  418

Query  161  KNKXVVRIS*P  129
            +N  ++ I+ P
Sbjct  419  RNYHIIHITTP  429



>emb|CCQ46715.1| tyrosyl-tRNA synthetase [Arthrobacter siccitolerans]
Length=437

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG E  ++ + A+ AL  GN D + LD +T++   S++PS +    QV
Sbjct  310  QRKLAFEVTALVHGVEATEKVIAASAALF-GNGDLSALDKQTLQAATSELPSTTV---QV  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++ ++DL V+SGL +SKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  366  DALGIVDLLVASGLSDSKSAARRTVGEGGAYVNNEKVLDPEAVISESELLHGQYLLLRRG  425

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_024963599.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
Length=418

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS         
Sbjct  295  QRVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASMNDAV  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++ L +  G      AARR +  GGLY+NN ++D   + IEE D+  G ++L   GK
Sbjct  355  VDVLVSLGLEKGA----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGK  410

Query  161  KNKXVVRI  138
            KN   + I
Sbjct  411  KNMTAIHI  418



>ref|WP_042380116.1| tyrosyl-tRNA synthetase [Streptacidiphilus melanogenes]
Length=420

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 74/128 (58%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHGQ+ LD A+ A++AL      ++LD  T+    +++PS         
Sbjct  295  QRALAEELTVLVHGQDQLDRAVAASKALFGQGDLSELDAPTLAAAVAELPSAQV----GE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D+  G+ L+   GK
Sbjct  351  LGELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATAAPADLLHGRWLVLRRGK  410

Query  161  KNKXVVRI  138
            +N   V +
Sbjct  411  RNLAAVEL  418



>ref|WP_017176881.1| tyrosyl-tRNA synthetase [Actinomyces timonensis]
Length=420

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 65/127 (51%), Gaps = 3/127 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA EVTR+VHG+  L +A  AT AL      T +D  T+    +D+PS      + +
Sbjct  295  QRALAREVTRWVHGEAALAQAEVATAALWGRGDLTGIDEATMAAATADLPSAELVVGEST  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + +L  +        + AARR +  GG YLNNA+V  E   + E D+  G V+L   G+
Sbjct  355  IVDLLVGAGLEKG---RGAARRTIAAGGAYLNNAKVTDEEAVVTESDLLAGGVVLVRKGR  411

Query  161  KNKXVVR  141
            +   V R
Sbjct  412  RTLSVAR  418



>ref|XP_005707106.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
 gb|EME30586.1| tyrosyl-tRNA synthetase [Galdieria sulphuraria]
Length=501

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 75/128 (59%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNA--DTKLDXKTIEGIASDVPSCSXPFXQ  348
            Q+ LAEEVTR VHG EG+  A + T A  PG    ++ LD  T+  +  ++PS       
Sbjct  370  QKLLAEEVTRLVHGDEGVKFAQRVTSASSPGRLVEESILDFDTLRQLKDEIPSKEIRKEH  429

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
            +   S++++ V  G+++SKS A+R +  GG Y+NN RV+   + I ++D+ +  +LL   
Sbjct  430  LLKKSLIEVLVECGIMKSKSEAKRFIINGGCYINNRRVEELDRSIGQEDLVENSMLLLGI  489

Query  167  GKKNKXVV  144
            GKK K ++
Sbjct  490  GKKQKILL  497



>gb|KDQ21806.1| hypothetical protein BOTBODRAFT_99200 [Botryobasidium botryosum 
FD-172 SS1]
Length=473

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 0/128 (0%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA EVT  VHG+EG+ +A   T AL   +         I+ + +D      P  +V 
Sbjct  344  QRMLASEVTELVHGEEGVKQAEATTRALFDTDPSNVRASDVIKALQNDPRLVLVPAAEVL  403

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               +  LS +     S+S AR++L  GGLYLNN+R+    K +++ D+ DG++ +  AGK
Sbjct  404  DEPLTKLSSNFKQTRSRSEARKLLLAGGLYLNNSRIQDVNKVLQQSDLIDGRLAILRAGK  463

Query  161  KNKXVVRI  138
             N  ++ +
Sbjct  464  DNHLIIAL  471



>ref|WP_007000220.1| tyrosyl-tRNA synthetase [Actinobaculum massiliense]
 gb|EKU95914.1| tyrosine-tRNA ligase [Actinobaculum massiliae ACS-171-V-Col2]
Length=424

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA +VT +VHG E  +    A+ AL  G    +LD  T+    +++PS      Q  
Sbjct  295  QRTLARDVTTWVHGAEATERVEAASRALFGGEELFELDVATLRDAVAELPSTGAEVGQPV  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                +      G+     AARR +  GGLY+NN +VD +A  +  + I DG ++L   GK
Sbjct  355  VELFVGTGQERGI----GAARRTVASGGLYINNQKVDDDAAVLSAEQILDGGLVLLRKGK  410

Query  161  KNKXVVRI  138
            KN  V R+
Sbjct  411  KNLAVARV  418



>ref|WP_025295943.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AHU89057.1| tyrosyl-tRNA synthetase [Trueperella pyogenes]
 gb|AJC69525.1| tyrosyl-tRNA synthetase [Trueperella pyogenes TP8]
Length=418

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT +VHG E  + A +A+  L        LD +T+    +++PS         
Sbjct  295  QRVLAEEVTTWVHGAEATERAKRASLVLFGKAEPAGLDEQTLRDATAELPSGKASVNDAV  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++ L +  G      AARR +  GGLY+NN ++D   + IEE D+  G ++L   GK
Sbjct  355  VDVLVSLGLEKGA----GAARRTIAGGGLYINNVKIDDPERVIEEGDVLPGSIVLLRKGK  410

Query  161  KNKXVVRI  138
            KN   + I
Sbjct  411  KNMTAIHI  418



>ref|WP_013559196.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila]
 dbj|BAJ62803.1| tyrosyl-tRNA synthetase [Anaerolinea thermophila UNI-1]
Length=426

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 69/130 (53%), Gaps = 3/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
             R LA  +T+ +HG+  L  A +A++AL  G  +T L    I  I S+VPSC  P  Q+ 
Sbjct  296  HRALARAMTQMIHGETALARAEQASQALFGGELET-LTAAEIADIFSEVPSCEVPRHQLE  354

Query  341  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
                  + +      +KS   ARR +++GG+Y+NN RV+   + +   D   G+ ++   
Sbjct  355  GEGYPLVDLLVTAGVAKSKGEARRNIQEGGIYVNNRRVEDLNRAVHLQDALQGQFVVLRK  414

Query  167  GKKNKXVVRI  138
            G+KN  +VR+
Sbjct  415  GRKNYTLVRL  424



>ref|WP_021275481.1| tyrosyl-tRNA synthetase [Bacteriovorax sp. Seq25_V]
 gb|EQC43871.1| tyrosine--tRNA ligase [Bacteriovorax sp. Seq25_V]
Length=423

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 69/128 (54%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EV + VHG+EGL  AL+AT +   G     +  K I  I  DVPS +     ++
Sbjct  296  QKTLASEVVKLVHGEEGLASALRAT-SFFFGEKIENVTDKEISSIFEDVPSVTLSKDFLN  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                L+    + L +SK  ARR ++Q G+ +NN +V +  KK+ +DD+     LL   GK
Sbjct  355  EGEFLEALAQTPLFKSKGEARRSVEQNGISINNVKVTAVDKKLSKDDLASETALLVKKGK  414

Query  161  KNKXVVRI  138
            KN  V++ 
Sbjct  415  KNYCVIKF  422



>ref|WP_039240672.1| tyrosyl-tRNA synthetase [Arthrobacter sp. MWB30]
 gb|KIA73795.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. MWB30]
Length=436

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS +      
Sbjct  310  QKKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATI---NA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I  D++  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIAPDELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_030504916.1| tyrosyl-tRNA synthetase [Microbispora rosea]
Length=421

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 3/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE++T  VHG + L   + A+ AL    +  +LD +T+E   ++VP    P     
Sbjct  296  QRALAEDLTTLVHGSDELARVIAASRALFGQGSLAELDARTLESALAEVPKAVVP---TL  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                ++L   SGL+ESKSAARR +K+GG YLNN ++  E      DD+  G+ L+   GK
Sbjct  353  GAPYVELLAQSGLVESKSAARRAVKEGGAYLNNTKITDEEYVPSADDLLHGRFLVLRRGK  412

Query  161  KNKXVVRIS  135
            K    V ++
Sbjct  413  KTVGGVEVA  421



>ref|WP_010528768.1| tyrosyl-tRNA synthetase [Thermophagus xiamenensis]
Length=430

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 73/133 (55%), Gaps = 5/133 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNA-DT--KLDXKTIEGIASDVPS--CSXP  357
            Q+ LAEEVT+ VHGQ+ L  A+ A++ L   N  DT  KLD +T+  +   VP+   S  
Sbjct  297  QKRLAEEVTQLVHGQDALQMAVDASQILFGKNVTDTLRKLDERTLLSVFEGVPTFNISRK  356

Query  356  FXQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLL  177
              +     +  ++  + +  SK  ARR LK GGL +N  +V SE KK+   D+ + K LL
Sbjct  357  NLEQGIGVIDLVAGETPIFPSKGEARRTLKGGGLGINKEKVQSEDKKVNSSDLLNDKYLL  416

Query  176  XSAGKKNKXVVRI  138
               GKKN  +V +
Sbjct  417  VQKGKKNYYLVIV  429



>ref|WP_018771549.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 162MFSha1.1]
Length=437

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++PS +    QV
Sbjct  310  QRKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPSATV---QV  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  366  DGMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  425

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_030266695.1| tyrosyl-tRNA synthetase [Streptacidiphilus jeojiense]
Length=422

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 4/123 (3%)
 Frame = -1

Query  506  EEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvssisvl  327
            E+VT  VHGQE LD A+ A++AL      T+LD  T++   +++P            S++
Sbjct  300  EDVTTLVHGQEQLDRAIAASKALFGQGDLTELDAATLDAAVAELPQAQV----GELASIV  355

Query  326  dlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGKKNKXV  147
            DL  ++GL+ SKSAARR +K+GG YLNNA+V  E     E D+  G+ LL   GK++   
Sbjct  356  DLLAATGLVPSKSAARRAVKEGGAYLNNAKVTDEEAAPTEADLLHGRWLLLRRGKRSLAA  415

Query  146  VRI  138
            V +
Sbjct  416  VEL  418



>ref|WP_042427072.1| tyrosyl-tRNA synthetase [Streptacidiphilus anmyonensis]
Length=420

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 73/128 (57%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHGQ+ LD A+ A++AL       +LD  T+    +++PS         
Sbjct  295  QRALAEELTVLVHGQDQLDRAVAASKALFGQGDLGELDAPTLAAAVAELPSAQV----GE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D+  G+ L+   GK
Sbjct  351  LGELVDLFVATGLSASRSAARRTINEGGAYVNNTKVEDEAATASPADLLHGRWLVLRRGK  410

Query  161  KNKXVVRI  138
            +N   + +
Sbjct  411  RNLAAIEL  418



>ref|WP_015936720.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus]
 gb|ACL39499.1| tyrosyl-tRNA synthetase [Arthrobacter chlorophenolicus A6]
Length=437

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT-KLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG E  ++ + A+ AL  GN D   LD +T++   S++P+ +    QV
Sbjct  310  QRKLAFEVTSLVHGVEATEKVIAASAALF-GNGDLGALDKQTLQAATSELPTATV---QV  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++ ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  366  DALGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVLDPETVIAESELLHGQYLLLRRG  425

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_003798662.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis]
 dbj|GAB12490.1| tyrosyl-tRNA synthetase [Arthrobacter globiformis NBRC 12137]
Length=437

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 78/130 (60%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG E  ++ + A+ A+  GN D + LD +T+    +++PS S      
Sbjct  310  QRKLAYEVTALVHGAEATEKVIAASAAVF-GNGDLSVLDEQTLAAATAELPSASV---DG  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
            + + ++DL V+SGL +SKSAARR++ +GG Y+NNA+V      I    +  GK LL   G
Sbjct  366  TGLGIIDLLVASGLSDSKSAARRVVGEGGAYVNNAKVTDPDAVIPPSQLLHGKYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   V++S
Sbjct  426  KKNLATVQVS  435



>ref|XP_008868076.1| tyrosine-tRNA ligase [Aphanomyces invadans]
 gb|ETW03847.1| tyrosine-tRNA ligase [Aphanomyces invadans]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 69/130 (53%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGI-ASDVPSCSXPFXQv  345
            Q+ LAE  T+ +HG + L  A  A   L  G+    LD  T   I A D P     + ++
Sbjct  307  QQILAEHATKMIHGSDALKAAQVAANVLFGGS----LDGVTASDILAIDAPRSGLRWSEL  362

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
                 +D+  + G + SK+  RR++K GG+Y+NN RVDS+A  I+   I  G+ +L   G
Sbjct  363  QGKRAVDVLATIGAIPSKAEGRRLIKAGGVYVNNVRVDSDAAVIDASQIVQGRAVLVRVG  422

Query  164  KKNKXVVRIS  135
            K+N  V+ ++
Sbjct  423  KRNYHVIHVT  432



>ref|WP_017614427.1| tyrosyl-tRNA synthetase [Nocardiopsis salina]
Length=434

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 2/123 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LAEE+T  VHG+E   +A+ A+ AL  G AD ++LD +T+E   S+VP         
Sbjct  305  QKALAEELTTLVHGEEECRKAIDASLALF-GRADLSELDGRTLESALSEVPKVETDTPVG  363

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
               SV+DL   SGL  SKSAARR +K+GG Y+NNA+V  E  +++ +D+   + ++   G
Sbjct  364  ELPSVVDLFAESGLTPSKSAARRAIKEGGAYVNNAKVTDEDARLDAEDLLADRFVVLRRG  423

Query  164  KKN  156
            K+N
Sbjct  424  KRN  426



>ref|WP_009199613.1| tyrosyl-tRNA synthetase [Actinomyces sp. oral taxon 848]
 gb|EEZ77493.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 848 str. F0332]
Length=420

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 12/132 (9%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVP----SCSXPF  354
            Q+ LAE+VT +VHG +  +    A+ AL  G     LD +T+    +++P    S   P 
Sbjct  296  QKALAEDVTTWVHGADATERVKAASRALFGGGGLESLDARTLADAVAELPRAEGSVGTPL  355

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
             ++   + L+  +         AARR +  GGLYLNN ++D  AK +   D+  G V+L 
Sbjct  356  IELFVATGLEKGL--------GAARRTVASGGLYLNNVKIDDGAKVLGSSDLLPGGVVLL  407

Query  173  SAGKKNKXVVRI  138
              GKKN  VV +
Sbjct  408  RRGKKNLAVVGV  419



>ref|WP_021277367.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
 gb|EQC51535.1| tyrosine--tRNA ligase domain protein, partial [Bacteriovorax 
sp. DB6_IX]
Length=183

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 69/131 (53%), Gaps = 3/131 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCS--XPFXQ  348
            Q+ LAEEV + VHG+EGL+ AL+AT        +   D + +  I  DVP+ +    F +
Sbjct  54   QKALAEEVVKLVHGEEGLEAALRATSFFFGQKIENVTDAQ-LSSIFEDVPAITLEKSFLE  112

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
                  L++   +   +SK  ARR ++Q G+ +NN +V    KKI  +D+     L+   
Sbjct  113  GEGGDYLEMLAQTPFFKSKGEARRSVQQNGVAINNVKVADVEKKITSEDLASETSLIIKK  172

Query  167  GKKNKXVVRIS  135
            GKKN  VV+ +
Sbjct  173  GKKNYCVVKFN  183



>ref|WP_005987818.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|EHM87143.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii C83]
Length=423

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDXKTIEGIASDVPSCSXPFXQ  348
            Q+ LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS      +
Sbjct  296  QKALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSAQL---E  352

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
            V   +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD+  G V+L   
Sbjct  353  VGKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRK  412

Query  167  GKKNKXVVR  141
            G++   V R
Sbjct  413  GRRKLAVAR  421



>ref|WP_021604636.1| tyrosyl-tRNA synthetase [Actinomyces graevenitzii]
 gb|ERH17231.1| tyrosine--tRNA ligase [Actinomyces graevenitzii F0530]
Length=423

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 5/129 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT--KLDXKTIEGIASDVPSCSXPFXQ  348
            Q+ LA EVT +VHG++       AT AL  G+AD+  K+D  T+ G  +D+PS      +
Sbjct  296  QKALAHEVTTWVHGEQETARVEAATAALWGGDADSLRKIDAFTLAGATADLPSSQL---E  352

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
            V   +++DL V++GL + + AAR+ + QGG YLN  +V  E   I EDD+  G V+L   
Sbjct  353  VGKSTIIDLLVATGLEKGRGAARKTVAQGGAYLNMRKVSDEDAVITEDDLLAGGVVLVRK  412

Query  167  GKKNKXVVR  141
            G++   V R
Sbjct  413  GRRKLAVAR  421



>ref|WP_012892535.1| tyrosyl-tRNA synthetase [Streptosporangium roseum]
 gb|ACZ88800.1| Tyrosine--tRNA ligase [Streptosporangium roseum DSM 43021]
Length=422

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+VT  VHG + L   + A+ AL    +  +LD +T+    ++VP    P     
Sbjct  296  QRTLAEDVTTLVHGADELARVVAASRALFGQGSLEELDARTLGSALAEVPRAEVP---AL  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S +DL   SGL+ESKSAARR +K+GG YLNN ++  EA     DD+  G+ L+   GK
Sbjct  353  GASFVDLLAESGLVESKSAARRAVKEGGAYLNNVKITDEAYVPSADDLLHGRFLVLRRGK  412

Query  161  KNKXVVRIS  135
            ++   V ++
Sbjct  413  RSIGGVEVT  421



>ref|WP_035732891.1| tyrosyl-tRNA synthetase [Gulosibacter molinativorax]
Length=440

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 71/129 (55%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA  VT  VHG+E  D A+ A+EAL        L+ +T++   +++P+         
Sbjct  315  QRALARAVTVLVHGEEATDNAIAASEALFGQGDLLALNAETLQQAIAELPNTE----STV  370

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               +  + V +G +ES SAARR +KQGG+ LNNAR++ E + IE  D+  G V++   GK
Sbjct  371  GAELSQVLVDTGAVESLSAARRAIKQGGVSLNNARIEDEHRVIESGDLLPGSVIVVRRGK  430

Query  161  KNKXVVRIS  135
            K      IS
Sbjct  431  KTLVGATIS  439



>ref|WP_043536564.1| tyrosyl-tRNA synthetase [Actinomyces sp. MS2]
Length=420

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 64/127 (50%), Gaps = 3/127 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHG++ LD  L ATEAL        LD +T+E   +++PS      + +
Sbjct  295  QKELAARVTELVHGRDELDRVLAATEALWGRGELGALDARTLESATAELPSGDIVAGEST  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +  L  +        +SAARR +  GG YLNN +V  E   I   D+  G + L   G+
Sbjct  355  IVDALVATGLEKG---RSAARRTVASGGAYLNNVKVTDEDAPISTGDLLAGGLALVRKGR  411

Query  161  KNKXVVR  141
            +N  VVR
Sbjct  412  RNLAVVR  418



>ref|WP_044496612.1| tyrosyl-tRNA synthetase [Nesterenkonia sp. NP1]
Length=436

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 72/127 (57%), Gaps = 3/127 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA EVT  VHG++ + +A+ A++AL      T++D  T+ GIA++V     P     
Sbjct  311  QRTLAWEVTALVHGEDAVRKAIAASDALFGKGEITEIDEPTLRGIAAEVTVAELP---AE  367

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + + +++  ++ L+ SK  ARR ++QGG Y+NN +VD     +E       + L+   GK
Sbjct  368  AATGINVLTATELVPSKGEARRAIQQGGAYINNTKVDDGDAVVEASAWLHDQYLVVRRGK  427

Query  161  KNKXVVR  141
            KN  V++
Sbjct  428  KNLAVIK  434



>gb|AAP58586.1| putative tyrosyl-tRNA synthetase [uncultured Acidobacteria bacterium]
Length=422

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 68/129 (53%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA EVTR VHG + + +A  A+E L  G+  T++    +  + ++VPS +  F    
Sbjct  294  QRELAREVTRLVHGSQAVLDAEAASEKLFRGDV-TQMSVDELLQVFANVPSSTVAFSDDG  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
                  ++        K  A+R+++ GGLY+N  R+  E  ++  +D   G+V +   GK
Sbjct  353  WALADLVTSVGVTKS-KGEAQRLVRAGGLYVNERRIGEEKARLTAEDAIGGQVFVIRKGK  411

Query  161  KNKXVVRIS  135
            K+  +VRIS
Sbjct  412  KDNFLVRIS  420



>ref|WP_028931561.1| tyrosyl-tRNA synthetase [Pseudonocardia asaccharolytica]
Length=426

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG+    + + A++AL       +LD  T++   ++VP+ +    +  
Sbjct  298  QRRLAEELTTLVHGEHQTRQVVAASQALFGRGELAELDAATLDAAMAEVPTATVRIGERP  357

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L +         + AARR +K+GG Y+NNA+V  EA    E D+  G+ L+   GK
Sbjct  358  TIVDLLVETGLTDS--RGAARRTVKEGGAYVNNAKVADEAWLPGEADLLHGRWLVVRRGK  415

Query  161  KNKXVVRIS  135
            +N   VR++
Sbjct  416  RNMAGVRVA  424



>ref|WP_018763582.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 135MFCol5.1]
Length=437

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ AL  GN D   LD  T++   S++P+ +    QV
Sbjct  310  QRKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLAALDKATLQAATSELPTTTV---QV  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I E ++  G+ LL   G
Sbjct  366  DGMGIVDLLVASGLSESKSAARRTVGEGGAYVNNEKVSDPEAVISESELLHGQYLLLRRG  425

Query  164  KKNKXVVRIS*P  129
            KKN   V +  P
Sbjct  426  KKNLATVEVLVP  437



>ref|WP_018779124.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 161MFSha2.1]
Length=436

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS +      
Sbjct  310  QKKLAYEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATI---NA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL ESKSAARR + +GG Y+NN +V      I  D++  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSESKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + ++
Sbjct  426  KKNLATIEVA  435



>ref|WP_017197962.1| tyrosyl-tRNA synthetase [Arthrobacter sp. M2012083]
Length=436

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS +      
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATV---GA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I  D++  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIARDELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_034277502.1| tyrosyl-tRNA synthetase [Amycolatopsis halophila]
Length=426

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG+E  ++ + A++AL        LD  T++   ++VP+         
Sbjct  300  QRKLAEELTTLVHGKEQTEQVIAASQALFGKGELGALDSSTLDAAMAEVPTGEVALGDGP  359

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L L+        K AARR++K+GG Y+NNA+V  +  +   DD+   + L+   GK
Sbjct  360  TIIDLLLAADLVES--KGAARRVIKEGGAYVNNAKVTDDTWQPSRDDLLHDRWLVVRRGK  417

Query  161  KNKXVVRIS  135
            +N   VRI+
Sbjct  418  RNLGGVRIA  426



>ref|WP_042369585.1| tyrosyl-tRNA synthetase [Streptacidiphilus neutrinimicus]
Length=420

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 74/129 (57%), Gaps = 6/129 (5%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT-KLDXKTIEGIASDVPSCSXPFXQv  345
            QR LAEE+T  VHGQ+ LD A+ A++AL  G  D  +LD  T+    +++P+        
Sbjct  295  QRALAEELTVLVHGQDQLDRAVAASKALF-GQGDLGELDAPTLAAAVAELPNAQV----S  349

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
                 +DL V++GL  S+SAARR + +GG Y+NN +V+ EA      D+  G+ L+   G
Sbjct  350  ELGEFVDLFVATGLSASRSAARRTISEGGAYVNNTKVEDEAAVATPADLLHGRWLVLRRG  409

Query  164  KKNKXVVRI  138
            K+N   V +
Sbjct  410  KRNLAAVEL  418



>gb|EKY16477.1| tyrosine--tRNA ligase [Actinomyces sp. oral taxon 181 str. F0379]
Length=350

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHGQ+ L+    ATEAL      + +D  T+    SD+P    P     
Sbjct  226  QKALAASVTALVHGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG---  282

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++D  V +GL + +SAARR L  GG Y+N  +V+ E   +  DD+  G ++L   G+
Sbjct  283  -ATLVDALVETGLEKGRSAARRTLAGGGAYVNKVKVEDEEAVLSADDLLAGGLVLIRKGR  341

Query  161  KNKXVVRI  138
            +N  VV +
Sbjct  342  RNLAVVAV  349



>ref|WP_007324558.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EGF29422.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica WH47]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 3/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC  P   + 
Sbjct  302  QKRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALE  360

Query  341  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
               +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+   
Sbjct  361  GEGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTADDLDGRSVLVLRR  420

Query  167  GKKNKXVVRI  138
            GK+   +++I
Sbjct  421  GKRKYALLKI  430



>ref|WP_016998371.1| tyrosyl-tRNA synthetase [Kocuria atrinae]
Length=434

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 70/128 (55%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EV   VHG+E   +A+ A+ A+        LD +T+  IA+++P       Q S
Sbjct  309  QKALAYEVNTLVHGEEATRKAIAASAAVFGKGQFADLDEETLAMIAAELPHAEVGADQTS  368

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + +L  +  S     KSAARR+LK+GG+ +NN +V  E   +E +D+  G+ +L   GK
Sbjct  369  IVDLLVATGLSES---KSAARRILKEGGVSVNNHKVSGEDATLEPEDLLHGRFVLLRRGK  425

Query  161  KNKXVVRI  138
            KN   V +
Sbjct  426  KNLAAVTV  433



>ref|WP_018657964.1| tyrosyl-tRNA synthetase [Actinomadura flavalba]
Length=426

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 2/122 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +     + A+ AL    +  +LD +T+    ++VP  + P    +
Sbjct  297  QRALAEEMTTLVHGADETARVIAASRALFGQGSLDELDERTLRSALAEVPRAALP--SGA  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V DL V+SGL +SKS ARR ++QGG YLNNA+V++E      DD+  G+ L+   GK
Sbjct  355  LPPVADLLVASGLCKSKSEARRAIQQGGAYLNNAKVEAEDAVPAADDLLHGRYLVLRRGK  414

Query  161  KN  156
            +N
Sbjct  415  RN  416



>ref|WP_012825381.1| tyrosyl-tRNA synthetase [Haliangium ochraceum]
 ref|YP_003264647.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
 gb|ACY12754.1| tyrosyl-tRNA synthetase [Haliangium ochraceum DSM 14365]
Length=432

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q  LAE++T +VHG+E    AL A++ +  G+ +  L+   ++ + +D+P+ S P  Q+ 
Sbjct  302  QSALAEDLTDWVHGEEAKRNALAASQVMFGGSLE-NLNDAALQPLTADLPTTSLPRQQLE  360

Query  341  s-isvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
            S I +L+L   + L  SK AARR+++ GG+Y+NN RV    K +  +D+    +++  AG
Sbjct  361  SGIPLLELLAQTKLAASKGAARRLVQGGGVYVNNIRVADVNKTLLPEDLGTETIMILRAG  420

Query  164  KKNKXVVRI  138
            KKN  +V+ 
Sbjct  421  KKNYHLVQF  429



>ref|WP_011122161.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 ref|NP_868726.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
 sp|Q7UM14.1|SYY_RHOBA RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Rhodopirellula baltica SH 1]
 emb|CAD76103.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica SH 1]
Length=438

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 3/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC  P   + 
Sbjct  308  QKRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALE  366

Query  341  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
               +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+   
Sbjct  367  GEGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRR  426

Query  167  GKKNKXVVRI  138
            GK+   +++I
Sbjct  427  GKRKYALLKI  436



>ref|WP_008661113.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea]
 gb|EMB13997.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea 6C]
 gb|EMI25131.1| tyrosyl-tRNA synthetase [Rhodopirellula europaea SH398]
Length=432

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 3/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC  P   + 
Sbjct  302  QKRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALE  360

Query  341  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
               +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+   
Sbjct  361  GEGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRR  420

Query  167  GKKNKXVVRI  138
            GK+   +++I
Sbjct  421  GKRKYALLKI  430



>ref|WP_037274388.1| tyrosyl-tRNA synthetase [Rhodococcus rhodnii]
Length=424

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (53%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEE T  VHG++   + + A++AL  G    +LD  T++   ++VP+         
Sbjct  297  QKRLAEEFTNLVHGEKETQQVIAASQALFGGGELRELDAGTLDAAMAEVPTGDVRLADQP  356

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  + ++          AARR + +GG Y+NN R+ ++  +   DD+  GK L+   GK
Sbjct  357  TIVEVLVASGLVAG--NGAARRTVSEGGAYVNNTRIGADDWRPTADDLLHGKWLVVRKGK  414

Query  161  KNKXVVRIS  135
            +N   VR+S
Sbjct  415  RNTAGVRVS  423



>ref|WP_007332625.1| tyrosyl-tRNA synthetase [Rhodopirellula baltica]
 gb|EKK01795.1| Tyrosyl-tRNA synthetase [Rhodopirellula baltica SH28]
Length=432

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 66/130 (51%), Gaps = 3/130 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+ +T  VHG+ G+  A +AT+ L  G      D +  E I +DVPSC  P   + 
Sbjct  302  QKRLAQWLTELVHGEAGVQSAQRATQILFGGELGDTTDSQLRE-IFADVPSCDVPKSALE  360

Query  341  sisvldlsvssglleSKSA--ARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
               +  +          S   ARR L +GG+Y+NN RV+   K++  DD+    VL+   
Sbjct  361  GEGLWIVEALQTAKLCNSGGDARRALSEGGVYVNNTRVEDVQKRLTVDDLDGRSVLVLRR  420

Query  167  GKKNKXVVRI  138
            GK+   +++I
Sbjct  421  GKRKYALLKI  430



>ref|WP_034251080.1| tyrosyl-tRNA synthetase [Actinomyces sp. oral taxon 181]
Length=419

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHGQ+ L+    ATEAL      + +D  T+    SD+P    P     
Sbjct  295  QKALAASVTALVHGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG---  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++D  V +GL + +SAARR L  GG Y+N  +V+ E   +  DD+  G ++L   G+
Sbjct  352  -ATLVDALVETGLEKGRSAARRTLAGGGAYVNKVKVEDEEAVLSADDLLAGGLVLIRKGR  410

Query  161  KNKXVVRI  138
            +N  VV +
Sbjct  411  RNLAVVAV  418



>ref|WP_043622222.1| tyrosyl-tRNA synthetase [Nonomuraea candida]
Length=421

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 3/122 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE++T  +HG++ LD  L A++AL    A  +L   T+    ++VP  + P     
Sbjct  296  QRTLAEDLTEMLHGRQELDAVLAASKALFGQGALEELPAATLGAALAEVPKATVP---AL  352

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              S +DL   SGL+ESKSAARR +K+GG YLNN ++  E+     DD+  G+ ++   GK
Sbjct  353  GASFVDLLADSGLVESKSAARRAVKEGGAYLNNRKITDESYTPTADDLLGGRFMVLRRGK  412

Query  161  KN  156
            K+
Sbjct  413  KS  414



>ref|WP_028851238.1| tyrosyl-tRNA synthetase [Thermocrispum municipale]
Length=424

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +   + + A++AL      + LD  T+E + ++VP+         
Sbjct  297  QRRLAEELTTLVHGADQTAQVVAASQALFGKGEFSALDEPTLESVMAEVPTGEVALSDEP  356

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L ++        K AARR +++GG Y+NN ++  E  + E  D   GK L+   GK
Sbjct  357  TIVDLLVAAGLSES--KGAARRTVREGGAYVNNTKISDEEWRPEPADALHGKWLIVRRGK  414

Query  161  KNKXVVRI  138
            +N   VR+
Sbjct  415  RNVAGVRL  422



>ref|WP_028912082.1| tyrosyl-tRNA synthetase [Prevotella sp. MA2016]
Length=431

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 70/131 (53%), Gaps = 3/131 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT---KLDXKTIEGIASDVPSCSXPFX  351
            Q+ LAEEVT  VH QE LD A++A+  L   +      KLD +T+  +   VP       
Sbjct  300  QKRLAEEVTVMVHSQEALDTAIEASNILFGKSTKEGLEKLDEQTLLDVFDGVPQFEISKD  359

Query  350  QvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXS  171
            Q+   ++  L+  + +  SK   R+M++ GG+ LN  ++  + + I  DD+ DGK LL  
Sbjct  360  QLGQPAIELLTTVAPVFPSKGEMRKMVQGGGVSLNKEKITDQNRAITADDLIDGKYLLAQ  419

Query  170  AGKKNKXVVRI  138
             GKKN  ++ +
Sbjct  420  KGKKNYYLLIV  430



>emb|CCA26043.1| unnamed protein product [Albugo laibachii Nc14]
Length=421

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+ VTR +HG++GL +A +AT AL   N  ++L+   IE +    P     + ++ 
Sbjct  291  QKMLADSVTRMIHGEDGLKKAKRATTALFSENI-SQLESSDIEELVRHAPVHMKRYEEIV  349

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               ++D+ V++G+ +SK+ ARR++  GG+Y+NN R+      I+ D +     +L   GK
Sbjct  350  QQHLVDVMVATGICKSKAEARRLILGGGVYVNNTRIRDGNHMIQSDQVIGTGFVLIRTGK  409

Query  161  KNKXVVRIS  135
            +N  +++I+
Sbjct  410  RNSHLLKIA  418



>ref|WP_019127035.1| tyrosyl-tRNA synthetase [Actinomyces sp. ph3]
Length=419

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHGQ+ L+    ATEAL      + +D  T+    SD+P    P     
Sbjct  295  QKALAASVTALVHGQDELERVQAATEALWGTGDLSSIDEATLAAATSDLPRAELPLG---  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++D  V +GL + +SAARR L  GG Y+N  +V+ E   +  DD+  G ++L   G+
Sbjct  352  -ATLVDALVETGLEKGRSAARRTLAGGGAYVNKIKVEDEEAVLSADDLLAGGLVLIRKGR  410

Query  161  KNKXVVRI  138
            +N  VV +
Sbjct  411  RNLAVVAV  418



>ref|WP_041818421.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
Length=420

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAE---ATHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_023589348.1| tyrosyl-tRNA synthetase [Streptomyces thermolilacinus]
Length=422

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG E     + A++AL      T+LD  T+    S++P          
Sbjct  296  QRALAEELTTLVHGAEQCAAVIAASKALFGQGELTELDEATLAAALSELPKAEV----AE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+DL    GL+ SKSAARR +K+GG Y+NN +V +E   +   D+  G+ L+   GK
Sbjct  352  PGLVVDLFAEVGLVPSKSAARRTVKEGGAYVNNVKVTAEDATVSAGDLLHGRWLVLRRGK  411

Query  161  KNKXVVRI  138
            KN   V +
Sbjct  412  KNLAAVEV  419



>gb|AHA96684.1| tyrosyl-tRNA synthase [Lactobacillus johnsonii N6.2]
Length=426

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  357

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  417

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_029722869.1| tyrosyl-tRNA synthetase [Saccharopolyspora rectivirgula]
 gb|KEI43772.1| tyrosyl-tRNA synthetase [Saccharopolyspora rectivirgula]
Length=424

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG++   + + A++AL    A  +LD +T+    ++VP+         
Sbjct  297  QRKLAEEMTTLVHGEQQTRQVVAASQALFGRGALQELDARTLNSAMAEVPTAE--VRMAD  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL V++GL+  KSAARR +K+GG Y+NN+++  E+    ++D+  G  L+   GK
Sbjct  355  QPTIVDLLVATGLVAGKSAARRTIKEGGAYVNNSKIADESWSPSKEDLLHGTWLVVRRGK  414

Query  161  KNKXVVRI  138
            ++   V++
Sbjct  415  RHTAGVKV  422



>ref|WP_004898658.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|EGP13423.1| tyrosyl-tRNA synthetase cluster 1 [Lactobacillus johnsonii pf01]
Length=420

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLVETKIESSKRQAREDVKNGAIYVNGERQDDIDFIIELDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_006256112.1| tyrosyl-tRNA synthetase [Alloprevotella tannerae]
 gb|EEX70745.1| tyrosine--tRNA ligase [Prevotella tannerae ATCC 51259]
Length=431

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 69/133 (52%), Gaps = 6/133 (5%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD----TKLDXKTIEGIASDVPSCSXPF  354
            QR L EEVT  VHG+E  ++AL ATE L  G A      KLD KT+  + S VP      
Sbjct  299  QRRLGEEVTVMVHGREEYEKALAATEILF-GKATKESLLKLDEKTLLAVFSGVPHFEVAR  357

Query  353  XQvssisvl-dlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLL  177
             +      +   +  +    SK   R++++ GG+ LN  ++ +  K I E+D+ DGK LL
Sbjct  358  AEAVGAKAVDLFAEKTQCFASKGEMRKLVQGGGVSLNKEKLSAFDKTITEEDLLDGKYLL  417

Query  176  XSAGKKNKXVVRI  138
               GKKN  ++ +
Sbjct  418  VQRGKKNYYLITV  430



>ref|WP_020871768.1| tyrosyl-tRNA synthetase [Streptomyces rapamycinicus]
 ref|YP_008793244.1| tyrosyl-tRNA synthetase [Streptomyces rapamycinicus NRRL 5491]
 gb|AGP58290.1| tyrosyl-tRNA synthetase [Streptomyces rapamycinicus NRRL 5491]
Length=422

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 69/129 (53%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +     + A++AL      T+LD  T+    S++P+         
Sbjct  296  QRALAEELTTLVHGADECAAVIAASKALFGQGELTELDEATLAAAISELPNAKV----SE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V D+    GL  SKSAARR +K+GG Y+NN +V +E   +  D++  G+ L+   GK
Sbjct  352  LGQVTDMFAEVGLAPSKSAARRTVKEGGAYVNNVKVTAEDAVVAADELLHGRWLVLRRGK  411

Query  161  KNKXVVRIS  135
            KN   + ++
Sbjct  412  KNLAAIEVT  420



>ref|WP_028274405.1| tyrosyl-tRNA synthetase [Atopococcus tabaci]
Length=422

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 65/128 (51%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA+E+TRFVH QE L+EA K +EAL  GN    L  + IE     VPS + P  +  
Sbjct  295  QRTLAQEMTRFVHSQEDLEEAEKISEALFSGNIQ-DLTARQIEQGFQHVPSSTAP--KQD  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V  L   + +  S+  AR  +K G +Y+   RV      + E D  DG+ ++   GK
Sbjct  352  IGLVEFLVDVTNIEPSRRQAREDIKNGAIYIKGERVQDTDYTVTEKDSFDGQYIIVRRGK  411

Query  161  KNKXVVRI  138
            K   +V +
Sbjct  412  KKYFLVHL  419



>ref|WP_005507143.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EHB87738.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa M508]
Length=434

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS         
Sbjct  309  QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLS---ED  365

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + ++ +    G  +S S ARR+LK+GG  +N  +V  E   I +DD+  G+  +   GK
Sbjct  366  RLDMISVLTELGFAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  425

Query  161  KNKXVVRI  138
            KN+  V +
Sbjct  426  KNQGAVEL  433



>ref|WP_014567013.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|AEB92520.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii DPC 6026]
Length=420

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKKLAEEVTKFVHGEEGLKEAQMITEALFSGNIKS-LSVPQIEQALKNAPSAE---ATHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  + + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLIETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_024936535.1| tyrosyl-tRNA synthetase [Actinomadura madurae]
Length=425

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 2/129 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +     + A+ AL    A  +LD +T++   ++VP    P     
Sbjct  297  QRALAEEMTTLVHGADETARVIAASRALFGQGALEELDERTLKAALAEVPRTEAP--PGE  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +V+DL  +SGL +SKS ARR + QGG YLNNA+V SE       D+  G+ L+   GK
Sbjct  355  LPTVVDLLAASGLCKSKSEARRAIAQGGAYLNNAKVQSEDAVPAAADLLHGRFLVLRRGK  414

Query  161  KNKXVVRIS  135
            +N   V ++
Sbjct  415  RNVGGVEVT  423



>ref|WP_037233127.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGI99536.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
 gb|KGJ35093.1| tyrosyl-tRNA synthetase [Rothia dentocariosa]
Length=434

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS      Q+ 
Sbjct  309  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQAVMSELPSVELSSDQLD  368

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             I+VL     +     KS ARR+LK+GG  +N A+V  E   I  + +  GK  +   GK
Sbjct  369  LITVLTELGFASS---KSEARRILKEGGASVNGAKVQGEDAVITPEQLLHGKYAIVRRGK  425

Query  161  KNKXVVRI  138
            KN+  + +
Sbjct  426  KNQGAITV  433



>ref|WP_005507861.1| tyrosyl-tRNA synthetase [Rothia mucilaginosa]
 gb|EET75880.1| tyrosine--tRNA ligase [Rothia mucilaginosa ATCC 25296]
Length=434

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA  VT  VHG E  D+A+ A+EAL        LD  T+E + +++PS         
Sbjct  309  QKTLAYLVTSLVHGTEATDQAVAASEALFGKGDFAALDEATLESVVAELPSAKLS---ED  365

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             + ++ +    G  +S S ARR+LK+GG  +N  +V  E   I +DD+  G+  +   GK
Sbjct  366  RLDMISVLTELGFAKSNSEARRILKEGGASVNGVKVQGEDAAISKDDLLHGRFAMVRRGK  425

Query  161  KNKXVVRI  138
            KN+  V +
Sbjct  426  KNQGAVEL  433



>ref|WP_031072446.1| tyrosyl-tRNA synthetase [Streptomyces sp. NRRL S-118]
Length=422

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 70/129 (54%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG E     + A++AL       +LD  T+    +++P          
Sbjct  296  QRALAEELTTLVHGAEQCAAVIAASKALFGQGELAELDEATLTAALAELPHARV----AE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+DL V  GL  SKSAARR +K+GG Y+NNA+V SE   +  D++  G+ L+   GK
Sbjct  352  PGPVVDLFVEVGLAPSKSAARRTVKEGGAYVNNAKVTSEDAVVAADELLHGRWLVLRRGK  411

Query  161  KNKXVVRIS  135
            KN   + ++
Sbjct  412  KNLAAIEVA  420



>ref|WP_026541624.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS +      
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVA---A  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I +D +  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_014243863.1| tyrosyl-tRNA synthetase [Bacteriovorax marinus]
 emb|CBW26079.1| putative tyrosyl-tRNA synthetase [Bacteriovorax marinus SJ]
Length=423

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 67/128 (52%), Gaps = 1/128 (1%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA+EVT+ VHGQEGLD AL+AT+    G     +    +  I  D PS       ++
Sbjct  296  QKSLAQEVTKLVHGQEGLDAALRATQFFF-GEKIENVSDADVASIFEDTPSVELSSEMLN  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+D+   + L +SK   RR + Q G+Y+NN  ++   + + + D+     L+   GK
Sbjct  355  EGGVIDMLSETPLFKSKKEVRRAIDQKGIYINNVAIEGPTQTLSKADLASETALVLRKGK  414

Query  161  KNKXVVRI  138
            KN  VV+ 
Sbjct  415  KNYCVVKF  422



>ref|WP_026547366.1| tyrosyl-tRNA synthetase [Arthrobacter nicotinovorans]
Length=436

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D   LD +T+E   +++PS +      
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLGVLDEQTLEAATAELPSATVA---A  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I +D +  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPEAVIGQDQLLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>ref|WP_021842733.1| tyrosyl-tRNA synthetase [Bacteroides sp. CAG:1060]
 emb|CCX54131.1| tyrosine--tRNA ligase [Bacteroides sp. CAG:1060]
Length=430

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 77/133 (58%), Gaps = 5/133 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK----LDXKTIEGIASDVPSCSXPF  354
            Q+ LA+EVT  VHG++  + A+KA++ L  G A T+    LD KT   +   VP+ +   
Sbjct  298  QKLLAKEVTVMVHGEKEYETAVKASQMLF-GKATTEDLRALDEKTFLAVFDGVPTHAIDR  356

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
             ++    +  L+V + +  SK  AR+M++Q G  LN  +++  A+ + E+DI DGK +L 
Sbjct  357  SKLPLGILDALAVETDIFPSKGEARKMIQQNGFSLNKEKMNDIARNLTEEDIIDGKYILV  416

Query  173  SAGKKNKXVVRIS  135
              GKK+  ++ ++
Sbjct  417  QKGKKDYHIIIVN  429



>ref|WP_014921325.1| tyrosyl-tRNA synthetase [Arthrobacter sp. Rue61a]
 gb|AFR28470.1| tyrosyl-tRNA synthetase TyrS [Arthrobacter sp. Rue61a]
Length=436

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            Q+ LA EVT  VHG +  ++ + A+ AL  GN D T LD +T+E   +++PS +      
Sbjct  310  QKKLAFEVTSLVHGVDATEKVIAASAALF-GNGDLTVLDERTLEAATAELPSATI---GA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
              + ++DL V+SGL +SKSAARR + +GG Y+NN +V      I  +++  G+ LL   G
Sbjct  366  DGLGIIDLLVASGLSDSKSAARRTVGEGGAYVNNTKVSDPDAVIAREELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   + +S
Sbjct  426  KKNLATIEVS  435



>gb|AAS08157.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii NCC 533]
Length=426

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  357

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  417

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_004806341.1| tyrosyl-tRNA synthetase [Actinomyces neuii]
 gb|EJZ87547.1| tyrosine-tRNA ligase [Actinomyces neuii BVS029A5]
Length=420

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 68/125 (54%), Gaps = 3/125 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAE VTR VHG E  D+ L ATEAL        +D  T+      +P+      +V 
Sbjct  295  QKELAESVTRLVHGDEVTDQVLAATEALWGKGDLASIDASTLASATESLPATEL---EVG  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + +++DL V +GL + K AARR +K GG YLNN +V+     I E D+  G  +L   GK
Sbjct  352  TSTIVDLLVGTGLEKGKGAARRTIKSGGAYLNNQKVEDVDYVIAETDLLSGGKVLVRKGK  411

Query  161  KNKXV  147
            +N  V
Sbjct  412  RNLAV  416



>ref|WP_044496576.1| tyrosine--tRNA ligase [Lactobacillus johnsonii]
 sp|Q74LL0.2|SYY_LACJO RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Lactobacillus johnsonii NCC 533]
Length=420

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQIITEALFSGNVKS-LSVPQIEQALKNAPSAE---ATHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R D     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQDDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_006823030.1| tyrosyl-tRNA synthetase [Corynebacterium casei]
 emb|CCE55574.1| tyrosine--tRNA ligase [Corynebacterium casei UCMA 3821]
 gb|AHI20118.1| tyrosyl-tRNA ligase [Corynebacterium casei LMG S-19264]
Length=421

 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA+E+T  VHG++       A +AL      T+LD KT+EG  S+            
Sbjct  293  QRRLAQEMTNLVHGEDATKAVELAAQALFGRAELTELDEKTLEGALSETNVAE--LGAEE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            S +++DL V+SGL +SK AARR +K+GG Y+NN R++SE     ED+   G  L+   GK
Sbjct  351  SFNIVDLLVASGLADSKGAARRTIKEGGAYVNNERIESEDWAPSEDNFLHGAWLVMRRGK  410

Query  161  KNKXVVR  141
            KN   +R
Sbjct  411  KNFAAIR  417



>gb|ERT67692.1| tyrosine--tRNA ligase [Rothia aeria F0184]
Length=439

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS      Q+ 
Sbjct  314  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQLD  373

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             I+VL     +     KS ARR+LK+GG  +N A+V  E   I  + +  GK  +   GK
Sbjct  374  LITVLTELGFASS---KSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGK  430

Query  161  KNKXVVRI  138
            KN+  + +
Sbjct  431  KNQGAITV  438



>ref|WP_006889016.1| tyrosyl-tRNA synthetase [Rothia aeria]
 gb|EID50266.1| tyrosine--tRNA ligase [Rothia aeria F0474]
Length=434

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LA EVT  VHG E   +A+ A+EAL        LD  T++ + S++PS      Q+ 
Sbjct  309  QKRLAYEVTALVHGVEATHQAIAASEALFGKGDFAALDESTLQTVMSELPSVELSSDQLD  368

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             I+VL     +     KS ARR+LK+GG  +N A+V  E   I  + +  GK  +   GK
Sbjct  369  LITVLTELGFASS---KSEARRILKEGGASVNGAKVQGEDAVITAEQLLHGKYAIVRRGK  425

Query  161  KNKXVVRI  138
            KN+  + +
Sbjct  426  KNQGAITV  433



>ref|WP_026538365.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 9MFCol3.1]
Length=437

 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ A+  GN D + LD  T++   S++PS +      
Sbjct  310  QRKLAYEVTSLVHGVDATEKVIAASAAVF-GNGDLSVLDEATLKAATSELPSATV---DA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++ +++L V+SGL ESKSAARR + +GG Y+NNA+V      I   ++  G+ LL   G
Sbjct  366  GALGIIELLVASGLSESKSAARRTVGEGGAYVNNAKVSDPDAVIAASELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   V I+
Sbjct  426  KKNLATVEIA  435



>ref|WP_028927384.1| tyrosyl-tRNA synthetase [Pseudonocardia acaciae]
Length=425

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 76/129 (59%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDXKTIEGIASDVPSCSXPFXQv  345
            QR LAEE+T  VHG +  D  ++A++AL  G A+ + LD  T+    ++VPS +      
Sbjct  297  QRRLAEELTTLVHGADETDRVIRASQALF-GRAELRELDPGTLRAALAEVPSSTTSLA--  353

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
            +  ++++L V +GL  SK AARR + +GG Y+NNA+V  E  +   DD+  G+ L+   G
Sbjct  354  AGPTIVELLVDTGLAASKGAARRTVAEGGAYVNNAKVVDEEWRPSGDDLLHGRWLVVRRG  413

Query  164  KKNKXVVRI  138
            K++   V I
Sbjct  414  KRHTAGVEI  422



>ref|WP_035794877.1| tyrosyl-tRNA synthetase [Kitasatospora mediocidica]
Length=421

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +  + A+ A++AL       +LD  T+    ++VP+ +       
Sbjct  295  QRALAEELTTLVHGADQYERAVAASKALFGQGDLGELDAATLASALAEVPTATV----GE  350

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               + DL V+ GL  S+SAARR LK+GG YLNNA+V  E     + D+  G+ L+   GK
Sbjct  351  LAPIADLLVAVGLAASRSAARRTLKEGGAYLNNAKVADEDAVPAQADLLHGRWLVLRRGK  410

Query  161  KNKXVVRI  138
            +N   V +
Sbjct  411  RNLAAVEL  418



>ref|WP_021949404.1| tyrosyl-tRNA synthetase [Prevotella sp. CAG:1124]
 emb|CCY65731.1| tyrosine--tRNA ligase [Prevotella sp. CAG:1124]
Length=486

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 71/131 (54%), Gaps = 3/131 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD---TKLDXKTIEGIASDVPSCSXPFX  351
            QR LAEEVT  VH +E LD A++A+  L   +      KLD +T+  I   VP       
Sbjct  354  QRRLAEEVTVMVHSREALDAAIEASNILFGKSTKESLLKLDEQTLLDIFEGVPQYEIGRD  413

Query  350  QvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXS  171
            Q+   +V   + ++ +  SK   R++++ GG+ LN  ++ +  ++I  DD+ DGK LL  
Sbjct  414  QLGQPAVEIFTQAAAVFASKGEMRKLVQGGGVSLNKEKLTAFDRQITADDLIDGKYLLVQ  473

Query  170  AGKKNKXVVRI  138
             GKKN  +V +
Sbjct  474  RGKKNYYLVIV  484



>gb|ABJ59589.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri ATCC 33323 = JCM 
1131]
Length=426

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  357

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK ++   GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  417

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_021314877.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EQB84886.1| tyrosyl-tRNA synthase [Lactobacillus gasseri 2016]
 gb|KFL95101.1| tyrosine--tRNA ligase [Lactobacillus gasseri SJ-9E-US]
Length=420

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_003650704.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
 gb|EEQ26747.1| tyrosine--tRNA ligase [Lactobacillus gasseri 202-4]
Length=420

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAEAT---HE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D+  DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDNDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  REYTLVKI  419



>ref|WP_005448890.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea]
 gb|EHK87025.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea SZMC 14600]
Length=424

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA+E+T  VHG E   + + A++AL        LD  T++   ++VP+      Q  
Sbjct  297  QRRLAQELTDLVHGPEQTQQVVAASQALFGRGELRDLDAATLDAAMAEVPTGEVSSAQGP  356

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L ++        K AARR +K+GG Y+NN ++  E  K E  D   G+ L+   GK
Sbjct  357  TIIDLLVAAGLVDS--KGAARRTVKEGGAYVNNIKITDEGWKPEPADALHGRWLVVRRGK  414

Query  161  KNKXVVRI  138
            KN   VR+
Sbjct  415  KNMAGVRV  422



>ref|WP_022513249.1| tyrosyl-tRNA synthetase [Dialister sp. CAG:588]
 emb|CDF27526.1| tyrosine--tRNA ligase [Dialister sp. CAG:588]
Length=420

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 71/129 (55%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVTRFVHGQEGL+EAL+ TEAL  GN   +L    IEG   +    +       
Sbjct  293  QRKLAEEVTRFVHGQEGLNEALRVTEALFSGNVQ-ELSAAEIEGAFRNTKGGT---LHSV  348

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
             +++++  VS  +++SK  AR  +  G + +N  ++      I      +GK ++   GK
Sbjct  349  PMNIVEALVSGEVIKSKRQAREDVSNGAIRINGEKITDIEATITAHPNTNGKHIIVKKGK  408

Query  161  KNKXVVRIS  135
            KN  ++++S
Sbjct  409  KNYFLLKVS  417



>ref|WP_005439705.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea]
 gb|EHY88204.1| tyrosyl-tRNA synthetase [Saccharomonospora azurea NA-128]
Length=424

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LA+E+T  VHG E   + + A++AL        LD  T++   ++VP+      Q  
Sbjct  297  QRRLAQELTDLVHGPEQTQQVVAASQALFGRGELRDLDAATLDAAMAEVPTGEVSSAQGP  356

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L ++        K AARR +K+GG Y+NN ++  E  K E  D   G+ L+   GK
Sbjct  357  TIIDLLVAAGLVDS--KGAARRTVKEGGAYVNNIKITDEGWKPEPADALHGRWLVVRRGK  414

Query  161  KNKXVVRI  138
            KN   VR+
Sbjct  415  KNMAGVRV  422



>ref|WP_016335378.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis]
 gb|AGM07632.1| tyrosyl-tRNA synthetase [Amycolatopsis orientalis HCCB10007]
Length=424

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 73/128 (57%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE T  VHG E   + + A++AL       +LD  T++   ++VP+         
Sbjct  297  QRKLAEEFTTLVHGAEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGK--VDPNG  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD   G+ L+   GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGK  414

Query  161  KNKXVVRI  138
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_012852510.1| tyrosyl-tRNA synthetase [Thermomonospora curvata]
 gb|ACY97726.1| tyrosyl-tRNA synthetase [Thermomonospora curvata DSM 43183]
Length=425

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 67/122 (55%), Gaps = 2/122 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEEVT  VHG +   + + A+ AL    A  +LD +T+    ++VP    P     
Sbjct  296  QRALAEEVTTLVHGADECAKVVAASRALFGQGALEELDERTLGAALAEVPRMEIP--PGD  353

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
               V+DL   SGL +SKS ARR + QGG YLNN +V SE      +D+  G+ L+   GK
Sbjct  354  LPPVVDLLAGSGLCKSKSEARRTIAQGGAYLNNTKVTSEEAVPTTEDLLHGRFLVLRRGK  413

Query  161  KN  156
            +N
Sbjct  414  RN  415



>ref|WP_022286111.1| tyrosyl-tRNA synthetase [Bacteroides sp. CAG:770]
 emb|CDC63993.1| tyrosine--tRNA ligase [Bacteroides sp. CAG:770]
Length=430

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 72/132 (55%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDXKTIEGIASDVPSCSXPF  354
            Q+ LA+EVT  VHG+   + AL A++ L  GN+ +    KLD +T   + S VP+     
Sbjct  299  QKLLAKEVTILVHGEAEYENALSASKMLF-GNSTSEELRKLDERTFLAVFSGVPTFDIKK  357

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
              +    +  L+V + +  SK   R+M++ GG+ LN  +V     ++ E DI DGK +L 
Sbjct  358  EDLPCNIIELLAVKTQVFPSKGECRKMIQGGGVSLNKDKVADIEYEVSEKDIVDGKYILA  417

Query  173  SAGKKNKXVVRI  138
              GKKN  ++RI
Sbjct  418  QRGKKNYNLIRI  429



>ref|WP_038511529.1| tyrosyl-tRNA synthetase [Amycolatopsis japonica]
 gb|AIG75731.1| Tyrosine-tRNA ligase [Amycolatopsis japonica]
Length=424

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+         
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGK--IDPNG  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL +++GL++SK AARR +K+GG Y+NN ++  E  K   DD   G+ L+   GK
Sbjct  355  EATIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEEWKPSSDDALHGRWLVVRKGK  414

Query  161  KNKXVVRI  138
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_020629629.1| tyrosyl-tRNA synthetase [Amycolatopsis alba]
Length=424

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 74/128 (58%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAE+ T  VHG+E   + + A++AL       +LD  T++   ++VP+         
Sbjct  297  QRKLAEDFTTLVHGEEATRQVIAASQALFGRGELRELDSSTLDAAMAEVPNGK--VDPNG  354

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              +++DL +++GL++SK AARR +K+GG Y+NN ++  EA     DD   G+ L+   GK
Sbjct  355  ESTIVDLLIAAGLVDSKGAARRTVKEGGAYVNNTKIADEAWTPSSDDALHGRWLVVRKGK  414

Query  161  KNKXVVRI  138
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_012845555.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 emb|CAX66137.1| tyrS [Lactobacillus johnsonii FI9785]
Length=420

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 68/129 (53%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKKLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAE---ATHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
              ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK ++   GK
Sbjct  352  PKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRIS  135
            +   +V+I+
Sbjct  412  RKYTLVKIN  420



>ref|WP_028277280.1| tyrosyl-tRNA synthetase [Arthrobacter sp. I3]
Length=437

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ A+  GN D + LD  T++   S++PS +      
Sbjct  310  QRKLAYEVTSLVHGVDATEKVIAASAAVF-GNGDLSVLDEATLKAATSELPSATV---DA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++ +++L V+SGL ESKSAARR + +GG Y+NNA+V      I   ++  G+ LL   G
Sbjct  366  GALGIIELLVASGLSESKSAARRTVGEGGAYVNNAKVSDPDAVIAASELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   V ++
Sbjct  426  KKNLATVEVA  435



>ref|WP_020502358.1| tyrosyl-tRNA synthetase [Sciscionella marina]
Length=422

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 69/131 (53%), Gaps = 8/131 (6%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPS--CSXPFXQ  348
            Q  LAEE+T  VHG +  D A+ A++AL        LD  T+    +++P    S P   
Sbjct  296  QHALAEELTTLVHGADQCDAAIAASQALFGQGELGDLDETTLTAAVAELPKARVSEP---  352

Query  347  vssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
                 V+DL    GL+ SKSAARR +K+GG Y+NN +V +E   +  D +  G+ L+   
Sbjct  353  ---GQVVDLFAEVGLVGSKSAARRTVKEGGAYVNNVKVTAEDAAVTVDQLLHGRWLILRK  409

Query  167  GKKNKXVVRIS  135
            GKKN   V  +
Sbjct  410  GKKNLAAVEFT  420



>ref|WP_022146920.1| tyrosyl-tRNA synthetase [Bacteroides sp. CAG:709]
 emb|CDA94782.1| tyrosine--tRNA ligase [Bacteroides sp. CAG:709]
Length=430

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDXKTIEGIASDVPSCSXPF  354
            Q+ LA+E+T  VHG++  + AL A++ L  GNA +    KLD +T   + S VP+     
Sbjct  299  QKLLAKEITIMVHGEQEYENALSASKMLF-GNATSDELRKLDERTFLAVFSGVPTFEIQK  357

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
              +    +  L+V + +  SK   R+M++ GG+ +N  +V     ++ E DI DGK +L 
Sbjct  358  SDLPCNIIDLLAVKTQVFPSKGECRKMIQGGGVSINKDKVADVEYEVSEKDIVDGKYILA  417

Query  173  SAGKKNKXVVRI  138
              GKKN  +++I
Sbjct  418  QRGKKNYNLIKI  429



>ref|WP_005989039.1| tyrosyl-tRNA synthetase [Desulfovibrio africanus]
 gb|EMG36021.1| tyrosyl-tRNA synthetase [Desulfovibrio africanus PCS]
Length=418

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTK-LDXKTIEGIASDVPSCSXPFXQv  345
            QR LA E+TR VHG+E L +   AT AL  G  D + +D   +  + ++ PS S P  + 
Sbjct  292  QRRLAAEMTRLVHGEEELLKVEAATAALF-GTGDLREVDPAMLRTVFNEAPSVSYPGLE-  349

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
                +  + V  GL +SK  AR+ L+QGG+Y+NN R+D  A K    D+  G+ LL   G
Sbjct  350  GLPDLPQILVDLGLSKSKGQARKDLEQGGVYVNNCRIDL-AWKPTAGDLLHGQALLVRKG  408

Query  164  KKNKXVVRI  138
            KKN  +V++
Sbjct  409  KKNYGLVQV  417



>ref|WP_039775270.1| tyrosyl-tRNA synthetase [Bifidobacterium adolescentis]
 gb|AJE06025.1| tyrosyl-tRNA synthetase [Bifidobacterium adolescentis]
Length=435

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT FVHG+E   +A++A  AL     D   +D  T+E  A D       F +V
Sbjct  306  QRTLAWEVTSFVHGEEATRQAIEAAGALFGRGGDLADIDESTLEA-AIDGMKVDGEFAKV  364

Query  344  ssisvldlsvssglleSK-SAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
            ++   +  +     L    S AR+ +K GG+YLNN RV+ E + ++E D   G+ +L   
Sbjct  365  AAGDRVAEAGMKAGLFKSISEARKTIKSGGVYLNNTRVEDEEQTLQEGDFLHGRFVLIRR  424

Query  167  GKKNKXVV  144
            GKK   VV
Sbjct  425  GKKALGVV  432



>ref|WP_004896025.1| tyrosyl-tRNA synthetase [Lactobacillus johnsonii]
 gb|EEJ60647.1| tyrosine--tRNA ligase [Lactobacillus johnsonii ATCC 33200]
Length=420

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKKLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAE---VTHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



>ref|WP_011743273.1| tyrosyl-tRNA synthetase [Bifidobacterium adolescentis]
 sp|A1A1W2.1|SYY_BIFAA RecName: Full=Tyrosine--tRNA ligase; AltName: Full=Tyrosyl-tRNA 
synthetase; Short=TyrRS [Bifidobacterium adolescentis ATCC 
15703]
 dbj|BAF39695.1| tyrosyl-tRNA synthetase [Bifidobacterium adolescentis ATCC 15703]
 gb|AII76396.1| tyrosyl-tRNA synthetase [Bifidobacterium adolescentis]
 gb|KIM01237.1| tyrosine--tRNA ligase [Bifidobacterium adolescentis]
Length=435

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 67/128 (52%), Gaps = 3/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT FVHG+E   +A++A  AL     D   +D  T+E  A D       F +V
Sbjct  306  QRTLAWEVTSFVHGEEATRQAIEAAGALFGRGGDLADIDESTLEA-AIDGMKVDGEFAKV  364

Query  344  ssisvldlsvssglleSK-SAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSA  168
            ++   +  +     L    S AR+ +K GG+YLNN RV+ E + ++E D   G+ +L   
Sbjct  365  AAGDRVAEAGMKAGLFKSISEARKTIKSGGVYLNNTRVEDEEQTLQEGDFLHGRFVLIRR  424

Query  167  GKKNKXVV  144
            GKK   VV
Sbjct  425  GKKALGVV  432



>ref|WP_028846608.1| tyrosyl-tRNA synthetase [Thermocrispum agreste]
Length=424

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 2/128 (2%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            QR LAEE+T  VHG +   + + A++AL        LD  T++ + ++VP+         
Sbjct  297  QRRLAEELTTLVHGPDQTAQVIAASQALFGKGEFAALDEATLDAVMAEVPTGEVALADDP  356

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            +I  L +         K AARR +++GG Y+NN ++  E  + +  D   GK L+   GK
Sbjct  357  TIVDLLVVSGLVDS--KGAARRTIREGGAYVNNTKISDEEWRPQASDALHGKWLIVRRGK  414

Query  161  KNKXVVRI  138
            +N   VR+
Sbjct  415  RNVAGVRV  422



>ref|WP_022016119.1| tyrosyl-tRNA synthetase [Bacteroides sp. CAG:545]
 emb|CCZ44422.1| tyrosine--tRNA ligase [Bacteroides sp. CAG:545]
Length=430

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 5/132 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDXKTIEGIASDVPSCSXPF  354
            Q+ LA+EVT  VHG +  + A+ A++ L  GN+ +    KLD +T   + S VP+     
Sbjct  299  QKLLAKEVTTMVHGAQEYENAVSASKMLF-GNSTSEELRKLDERTFLAVFSGVPTFDIKK  357

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
             ++    +  L+V + +  SK   R+M++ GG+ +N  +V S   ++ E DI DGK +L 
Sbjct  358  EELPCPVIDLLAVKTQVFPSKGECRKMIQGGGVSINKDKVASIDYEVSEKDIIDGKYILV  417

Query  173  SAGKKNKXVVRI  138
              GKKN  ++R+
Sbjct  418  QKGKKNYYLLRV  429



>ref|WP_018774401.1| tyrosyl-tRNA synthetase [Arthrobacter sp. 131MFCol6.1]
Length=437

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 5/130 (4%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNAD-TKLDXKTIEGIASDVPSCSXPFXQv  345
            QR LA EVT  VHG +  ++ + A+ A+  GN D + LD  T++   S++PS +      
Sbjct  310  QRKLAYEVTSLVHGVDATEKVIAASAAVF-GNGDLSVLDEGTLKAATSELPSATV---DA  365

Query  344  ssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAG  165
             ++ +++L V+SGL ESKSAARR + +GG Y+NNA+V      I   ++  G+ LL   G
Sbjct  366  GALGIIELLVASGLSESKSAARRTVGEGGAYVNNAKVSDPDAVIAASELLHGRYLLLRRG  425

Query  164  KKNKXVVRIS  135
            KKN   V ++
Sbjct  426  KKNLATVEVA  435



>gb|AJC07291.1| tyrosyl-tRNA synthase [Lactobacillus gasseri 130918]
Length=426

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  302  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAE---ATHE  357

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK ++   GK
Sbjct  358  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  417

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  418  RKYTLVKI  425



>ref|WP_014790868.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale]
 gb|AFL97273.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale DSM 
15997]
 gb|AIP99335.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale ORT-UMN 
88]
 gb|KGB66443.1| tyrosyl-tRNA synthetase [Ornithobacterium rhinotracheale H06-030791]
Length=429

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 72/132 (55%), Gaps = 6/132 (5%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADT----KLDXKTIEGIASDVPSCSXPF  354
            QR LAEEVT  VH +E LD+A++A+E L  G A +    KLD KT   I   VP      
Sbjct  299  QRKLAEEVTTMVHSKEELDKAVQASEILF-GKATSENLRKLDEKTFLDIFDGVPQAEITQ  357

Query  353  XQvssisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLX  174
              ++   +  LS  +  ++SK  ARR L+Q  + +N  ++  E  K+ E+D+  GK +L 
Sbjct  358  ADLNEDLLEILSTKTEFMKSKGEARRALQQNSIAVNKDKI-GEDYKLSENDLISGKYILL  416

Query  173  SAGKKNKXVVRI  138
              GKKN  VV +
Sbjct  417  QKGKKNYFVVIV  428



>ref|WP_039155571.1| tyrosyl-tRNA synthetase [Lactobacillus gasseri]
Length=420

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -1

Query  521  QRXLAEEVTRFVHGQEGLDEALKATEALRPGNADTKLDXKTIEGIASDVPSCSXPFXQvs  342
            Q+ LAEEVT+FVHG+EGL EA   TEAL  GN  + L    IE    + PS         
Sbjct  296  QKRLAEEVTKFVHGEEGLKEAQMITEALFSGNVKS-LSVPQIEQALKNAPSAE---ATHE  351

Query  341  sisvldlsvssglleSKSAARRMLKQGGLYLNNARVDSEAKKIEEDDIXDGKVLLXSAGK  162
            + ++++  V + +  SK  AR  +K G +Y+N  R +     IE D   DGK ++   GK
Sbjct  352  AKNIVEFLVETKIEPSKRQAREDVKNGAIYVNGERQNDIDFIIEPDSDFDGKYVIIRKGK  411

Query  161  KNKXVVRI  138
            +   +V+I
Sbjct  412  RKYTLVKI  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000