BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030H23

Length=693
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794988.1|  PREDICTED: F-box protein At2g26850-like            263   3e-82   Nicotiana sylvestris
ref|XP_011090175.1|  PREDICTED: F-box protein At2g32560-like            263   3e-82   Sesamum indicum [beniseed]
gb|EYU46183.1|  hypothetical protein MIMGU_mgv1a007435mg                260   3e-81   Erythranthe guttata [common monkey flower]
ref|XP_009590639.1|  PREDICTED: F-box protein At2g32560                 260   3e-81   Nicotiana tomentosiformis
ref|XP_008359220.1|  PREDICTED: F-box protein At2g26850-like isof...    257   6e-81   
ref|XP_009350006.1|  PREDICTED: F-box protein At2g26850-like            259   7e-81   Pyrus x bretschneideri [bai li]
gb|KDP43182.1|  hypothetical protein JCGZ_22734                         257   1e-80   Jatropha curcas
ref|XP_010088960.1|  F-box protein                                      256   2e-80   
ref|XP_008359219.1|  PREDICTED: F-box protein At2g26850-like isof...    258   3e-80   
emb|CDP09613.1|  unnamed protein product                                256   5e-80   Coffea canephora [robusta coffee]
ref|XP_003519507.1|  PREDICTED: F-box protein At2g26850-like            256   1e-79   Glycine max [soybeans]
ref|XP_011080446.1|  PREDICTED: F-box protein At2g32560-like            255   3e-79   Sesamum indicum [beniseed]
ref|XP_004250900.1|  PREDICTED: F-box protein At2g32560 isoform X2      254   3e-79   Solanum lycopersicum
ref|XP_002314008.1|  F-box family protein                               254   6e-79   Populus trichocarpa [western balsam poplar]
ref|XP_008798380.1|  PREDICTED: F-box protein At2g32560-like            254   7e-79   Phoenix dactylifera
gb|AHB08886.1|  F-box family protein                                    254   8e-79   Suaeda glauca
gb|KHN11010.1|  F-box protein                                           251   2e-78   Glycine soja [wild soybean]
ref|XP_010673781.1|  PREDICTED: F-box protein At2g32560                 253   2e-78   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002533285.1|  conserved hypothetical protein                     253   3e-78   Ricinus communis
ref|XP_008794228.1|  PREDICTED: F-box protein At2g32560-like            252   3e-78   Phoenix dactylifera
ref|XP_010910138.1|  PREDICTED: F-box protein At2g32560-like isof...    252   4e-78   Elaeis guineensis
ref|XP_007212266.1|  hypothetical protein PRUPE_ppa006669mg             252   4e-78   Prunus persica
ref|XP_008227257.1|  PREDICTED: F-box protein At2g26850-like            251   6e-78   Prunus mume [ume]
ref|XP_003545428.1|  PREDICTED: F-box protein At2g26850-like            251   9e-78   Glycine max [soybeans]
gb|EYU35951.1|  hypothetical protein MIMGU_mgv1a008147mg                249   1e-77   Erythranthe guttata [common monkey flower]
ref|XP_006356347.1|  PREDICTED: F-box protein At2g32560-like            250   1e-77   Solanum tuberosum [potatoes]
ref|XP_007015246.1|  F-box family protein isoform 2                     249   2e-77   
ref|XP_007141515.1|  hypothetical protein PHAVU_008G202600g             250   2e-77   Phaseolus vulgaris [French bean]
emb|CBI24276.3|  unnamed protein product                                249   3e-77   Vitis vinifera
gb|EYU35950.1|  hypothetical protein MIMGU_mgv1a008147mg                249   3e-77   Erythranthe guttata [common monkey flower]
ref|XP_010313246.1|  PREDICTED: F-box protein At2g32560 isoform X1      249   4e-77   Solanum lycopersicum
ref|XP_002263423.1|  PREDICTED: F-box protein At2g32560 isoform X2      249   5e-77   Vitis vinifera
gb|KEH28371.1|  F-box plant-like protein                                247   7e-77   Medicago truncatula
ref|XP_002298461.1|  hypothetical protein POPTR_0001s28050g             247   2e-76   
ref|XP_010246180.1|  PREDICTED: F-box protein At2g32560-like            248   2e-76   Nelumbo nucifera [Indian lotus]
ref|XP_003617213.1|  F-box family protein                               248   2e-76   Medicago truncatula
ref|XP_007015245.1|  F-box family protein isoform 1                     247   2e-76   
gb|KHG08627.1|  hypothetical protein F383_10185                         247   3e-76   Gossypium arboreum [tree cotton]
ref|XP_009403834.1|  PREDICTED: F-box protein At2g32560-like            245   3e-76   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW51070.1|  hypothetical protein EUGRSUZ_J00678                     245   3e-76   Eucalyptus grandis [rose gum]
ref|XP_004491223.1|  PREDICTED: F-box protein At2g26850-like            246   6e-76   Cicer arietinum [garbanzo]
ref|XP_010031705.1|  PREDICTED: F-box protein At2g26850                 246   1e-75   Eucalyptus grandis [rose gum]
gb|EMT11595.1|  hypothetical protein F775_27187                         246   1e-75   
ref|XP_006836283.1|  hypothetical protein AMTR_s00101p00163380          243   1e-75   
ref|XP_010271792.1|  PREDICTED: F-box protein At2g32560-like            245   2e-75   Nelumbo nucifera [Indian lotus]
ref|XP_011009173.1|  PREDICTED: F-box protein At2g32560-like            245   2e-75   Populus euphratica
ref|XP_004173270.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    244   3e-75   
ref|XP_010651536.1|  PREDICTED: F-box protein At2g32560 isoform X1      244   3e-75   Vitis vinifera
ref|XP_003556934.1|  PREDICTED: F-box protein At2g26850-like            244   3e-75   Glycine max [soybeans]
ref|XP_008449641.1|  PREDICTED: F-box protein At2g32560                 244   3e-75   Cucumis melo [Oriental melon]
gb|KJB55451.1|  hypothetical protein B456_009G077900                    244   3e-75   Gossypium raimondii
ref|XP_010922076.1|  PREDICTED: F-box protein At2g32560-like            244   5e-75   Elaeis guineensis
gb|KHN27365.1|  F-box protein                                           243   8e-75   Glycine soja [wild soybean]
ref|XP_011024991.1|  PREDICTED: F-box protein At2g32560-like            243   9e-75   Populus euphratica
gb|KJB35714.1|  hypothetical protein B456_006G125100                    243   9e-75   Gossypium raimondii
ref|XP_004140188.1|  PREDICTED: F-box protein At2g32560-like isof...    243   1e-74   Cucumis sativus [cucumbers]
gb|KJB55450.1|  hypothetical protein B456_009G077900                    243   1e-74   Gossypium raimondii
ref|XP_004140189.1|  PREDICTED: F-box protein At2g32560-like isof...    242   1e-74   
ref|XP_002455470.1|  hypothetical protein SORBIDRAFT_03g011420          243   1e-74   
ref|XP_004967668.1|  PREDICTED: F-box protein At2g32560-like            243   1e-74   Setaria italica
ref|XP_009404696.1|  PREDICTED: F-box protein At2g32560-like            243   1e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB55449.1|  hypothetical protein B456_009G077900                    243   2e-74   Gossypium raimondii
ref|XP_004513967.1|  PREDICTED: F-box protein At2g26850-like            242   4e-74   Cicer arietinum [garbanzo]
gb|KJB35713.1|  hypothetical protein B456_006G125100                    241   5e-74   Gossypium raimondii
ref|XP_010557458.1|  PREDICTED: F-box protein At2g32560                 241   6e-74   Tarenaya hassleriana [spider flower]
ref|XP_004291727.1|  PREDICTED: F-box protein At2g32560 isoform X1      239   9e-74   Fragaria vesca subsp. vesca
gb|KDO54747.1|  hypothetical protein CISIN_1g015516mg                   239   1e-73   Citrus sinensis [apfelsine]
ref|XP_003567352.1|  PREDICTED: F-box protein At2g32560-like            241   1e-73   Brachypodium distachyon [annual false brome]
ref|XP_010045084.1|  PREDICTED: F-box protein At2g32560-like            240   2e-73   Eucalyptus grandis [rose gum]
ref|XP_006446322.1|  hypothetical protein CICLE_v10015455mg             239   2e-73   
tpg|DAA54206.1|  TPA: cyclin-like F-box                                 240   2e-73   
gb|KDO54746.1|  hypothetical protein CISIN_1g015516mg                   238   2e-73   Citrus sinensis [apfelsine]
gb|KHN28192.1|  F-box protein                                           239   5e-73   Glycine soja [wild soybean]
ref|XP_003529497.1|  PREDICTED: F-box protein At2g26850-like            239   6e-73   Glycine max [soybeans]
gb|KDO54745.1|  hypothetical protein CISIN_1g015516mg                   239   6e-73   Citrus sinensis [apfelsine]
ref|XP_006446321.1|  hypothetical protein CICLE_v10015455mg             239   6e-73   Citrus clementina [clementine]
ref|XP_009393902.1|  PREDICTED: F-box protein At2g32560-like            238   8e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009420968.1|  PREDICTED: F-box protein At2g32560-like            239   1e-72   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88045.1|  predicted protein                                      238   2e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007146143.1|  hypothetical protein PHAVU_006G015900g             237   2e-72   Phaseolus vulgaris [French bean]
ref|NP_001042756.1|  Os01g0281000                                       238   2e-72   
ref|NP_001151624.1|  cyclin-like F-box                                  237   3e-72   
ref|XP_001785923.1|  predicted protein                                  234   3e-72   
emb|CDM82916.1|  unnamed protein product                                237   4e-72   Triticum aestivum [Canadian hard winter wheat]
gb|KDO53603.1|  hypothetical protein CISIN_1g040396mg                   229   2e-71   Citrus sinensis [apfelsine]
ref|XP_006644069.1|  PREDICTED: F-box protein At2g32560-like            227   4e-71   
ref|XP_006470522.1|  PREDICTED: F-box protein At2g32560-like            234   5e-71   Citrus sinensis [apfelsine]
gb|ABR18151.1|  unknown                                                 233   5e-71   Picea sitchensis
ref|XP_009148635.1|  PREDICTED: F-box protein At2g32560-like            233   6e-71   Brassica rapa
ref|XP_006482074.1|  PREDICTED: F-box protein At2g32560-like            232   2e-70   Citrus sinensis [apfelsine]
emb|CAN78683.1|  hypothetical protein VITISV_043889                     231   2e-70   Vitis vinifera
emb|CDY30036.1|  BnaC05g09840D                                          231   3e-70   Brassica napus [oilseed rape]
ref|XP_006430547.1|  hypothetical protein CICLE_v10011910mg             231   5e-70   Citrus clementina [clementine]
ref|XP_001775579.1|  predicted protein                                  228   5e-70   
ref|XP_006430546.1|  hypothetical protein CICLE_v10011910mg             231   6e-70   Citrus clementina [clementine]
ref|XP_001777099.1|  predicted protein                                  228   9e-70   
ref|XP_010469573.1|  PREDICTED: F-box protein At2g32560-like            229   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006294453.1|  hypothetical protein CARUB_v10023466mg             229   1e-69   Capsella rubella
ref|XP_010509997.1|  PREDICTED: F-box protein At2g32560                 229   2e-69   
ref|XP_010112861.1|  F-box protein                                      228   2e-69   
emb|CDY34614.1|  BnaC08g41730D                                          228   3e-69   Brassica napus [oilseed rape]
ref|XP_006417291.1|  hypothetical protein EUTSA_v10007953mg             228   3e-69   Eutrema salsugineum [saltwater cress]
emb|CDY34820.1|  BnaA09g47460D                                          228   3e-69   Brassica napus [oilseed rape]
ref|XP_009118163.1|  PREDICTED: F-box protein At2g32560-like            228   6e-69   Brassica rapa
ref|XP_010413981.1|  PREDICTED: F-box protein At2g32560-like isof...    226   1e-68   Camelina sativa [gold-of-pleasure]
ref|XP_007028345.1|  F-box family protein isoform 4                     227   1e-68   
ref|XP_007028342.1|  F-box family protein isoform 1                     226   4e-68   
ref|XP_002880840.1|  F-box family protein                               225   5e-68   Arabidopsis lyrata subsp. lyrata
gb|EEC70414.1|  hypothetical protein OsI_01411                          225   6e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_008240697.1|  PREDICTED: F-box protein At2g26850-like isof...    226   7e-68   Prunus mume [ume]
ref|XP_010413980.1|  PREDICTED: F-box protein At2g32560-like isof...    226   7e-68   Camelina sativa [gold-of-pleasure]
gb|EEE54342.1|  hypothetical protein OsJ_01321                          225   9e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202057.1|  hypothetical protein PRUPE_ppa006765mg             225   1e-67   Prunus persica
ref|NP_850191.1|  F-box protein                                         224   1e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98095.1|  BnaA06g08460D                                          224   2e-67   
ref|NP_180253.2|  F-box protein                                         223   4e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879398.1|  F-box family protein                               223   4e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_002522176.1|  conserved hypothetical protein                     220   3e-66   
ref|XP_002307980.2|  hypothetical protein POPTR_0006s03840g             221   3e-66   Populus trichocarpa [western balsam poplar]
gb|KEH33371.1|  F-box plant-like protein                                219   5e-66   Medicago truncatula
gb|KEH33372.1|  F-box plant-like protein                                219   9e-66   Medicago truncatula
gb|KHG29237.1|  hypothetical protein F383_00101                         220   1e-65   Gossypium arboreum [tree cotton]
ref|XP_010521562.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    227   2e-65   
ref|XP_006646414.1|  PREDICTED: F-box protein At2g26850-like            216   2e-65   Oryza brachyantha
gb|KDP29248.1|  hypothetical protein JCGZ_16637                         217   3e-65   Jatropha curcas
emb|CDP09596.1|  unnamed protein product                                218   4e-65   Coffea canephora [robusta coffee]
gb|KJB46204.1|  hypothetical protein B456_007G352500                    218   4e-65   Gossypium raimondii
ref|XP_006296486.1|  hypothetical protein CARUB_v10025671mg             218   5e-65   Capsella rubella
gb|ACL53470.1|  unknown                                                 219   7e-65   Zea mays [maize]
ref|XP_010055882.1|  PREDICTED: F-box protein At2g26850-like            218   7e-65   Eucalyptus grandis [rose gum]
ref|NP_001147974.1|  cyclin-like F-box precursor                        218   7e-65   
ref|XP_010417831.1|  PREDICTED: F-box protein At2g26850-like            216   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010510850.1|  PREDICTED: F-box protein At2g26850-like            216   2e-64   Camelina sativa [gold-of-pleasure]
ref|NP_001044567.1|  Os01g0806200                                       218   2e-64   
ref|XP_010473070.1|  PREDICTED: F-box protein At2g26850-like            216   3e-64   Camelina sativa [gold-of-pleasure]
gb|ACN33240.1|  unknown                                                 217   3e-64   Zea mays [maize]
ref|XP_011000416.1|  PREDICTED: F-box protein At2g26850-like            216   4e-64   Populus euphratica
ref|XP_011027255.1|  PREDICTED: F-box protein At2g32560-like isof...    214   5e-64   Populus euphratica
ref|XP_002323241.2|  hypothetical protein POPTR_0016s03510g             214   6e-64   
ref|XP_008387444.1|  PREDICTED: F-box protein At2g26850-like            214   1e-63   Malus domestica [apple tree]
ref|XP_011027254.1|  PREDICTED: F-box protein At2g26850-like isof...    214   1e-63   Populus euphratica
dbj|BAK00229.1|  predicted protein                                      214   2e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008672833.1|  PREDICTED: cyclin-like F-box isoform X1            214   4e-63   Zea mays [maize]
ref|XP_003624978.1|  F-box protein                                      213   5e-63   
gb|KHN30351.1|  F-box protein                                           209   5e-63   Glycine soja [wild soybean]
gb|ABD33039.1|  Cyclin-like F-box                                       213   5e-63   Medicago truncatula
gb|AFK37960.1|  unknown                                                 213   6e-63   Medicago truncatula
ref|XP_006411383.1|  hypothetical protein EUTSA_v10016802mg             212   7e-63   Eutrema salsugineum [saltwater cress]
gb|KHN08884.1|  F-box protein                                           211   8e-63   Glycine soja [wild soybean]
gb|EPS60658.1|  hypothetical protein M569_14143                         212   1e-62   Genlisea aurea
ref|XP_008392525.1|  PREDICTED: F-box protein At2g26850-like            212   1e-62   
ref|XP_003554122.1|  PREDICTED: F-box protein At2g32560-like            212   1e-62   Glycine max [soybeans]
ref|XP_002881759.1|  F-box family protein                               211   2e-62   Arabidopsis lyrata subsp. lyrata
emb|CAN79391.1|  hypothetical protein VITISV_034661                     208   3e-62   Vitis vinifera
ref|XP_003521127.1|  PREDICTED: F-box protein At2g32560-like            211   4e-62   Glycine max [soybeans]
emb|CBI32779.3|  unnamed protein product                                207   6e-62   Vitis vinifera
gb|AAD11995.1|  unknown protein                                         209   8e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007162078.1|  hypothetical protein PHAVU_001G121900g             209   1e-61   Phaseolus vulgaris [French bean]
ref|XP_004290535.1|  PREDICTED: F-box protein At2g32560-like            209   1e-61   Fragaria vesca subsp. vesca
ref|XP_006294441.1|  hypothetical protein CARUB_v10023454mg             207   1e-61   
ref|XP_004141125.1|  PREDICTED: F-box protein At2g32560-like            209   1e-61   Cucumis sativus [cucumbers]
ref|XP_004158332.1|  PREDICTED: F-box protein At2g32560-like            209   2e-61   
dbj|BAD94811.1|  hypothetical protein                                   208   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850347.1|  F-box protein                                         208   2e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294440.1|  hypothetical protein CARUB_v10023454mg             207   3e-61   Capsella rubella
emb|CDY23870.1|  BnaC04g01670D                                          207   4e-61   Brassica napus [oilseed rape]
ref|XP_009618519.1|  PREDICTED: F-box protein At2g26850-like isof...    207   5e-61   Nicotiana tomentosiformis
emb|CDM84605.1|  unnamed protein product                                207   6e-61   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010653619.1|  PREDICTED: F-box protein At2g32560-like isof...    208   6e-61   Vitis vinifera
ref|XP_004970296.1|  PREDICTED: F-box protein At2g41170-like isof...    209   7e-61   
ref|XP_004970298.1|  PREDICTED: F-box protein At2g41170-like isof...    207   8e-61   Setaria italica
ref|XP_010673039.1|  PREDICTED: F-box protein At2g32560-like isof...    206   8e-61   
ref|XP_002277192.2|  PREDICTED: F-box protein At2g32560-like isof...    209   9e-61   Vitis vinifera
ref|XP_003564433.1|  PREDICTED: F-box protein At2g32560-like isof...    207   1e-60   Brachypodium distachyon [annual false brome]
ref|XP_009345151.1|  PREDICTED: F-box protein At2g26850-like            207   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_010327750.1|  PREDICTED: F-box protein At2g26850-like isof...    206   1e-60   Solanum lycopersicum
ref|XP_010508750.1|  PREDICTED: F-box protein At2g41170-like isof...    206   1e-60   Camelina sativa [gold-of-pleasure]
emb|CDX79953.1|  BnaA05g02030D                                          206   2e-60   
ref|XP_008464952.1|  PREDICTED: F-box protein At2g26850-like            206   2e-60   Cucumis melo [Oriental melon]
ref|XP_010517604.1|  PREDICTED: F-box protein At2g41170-like            206   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_011075626.1|  PREDICTED: F-box protein At2g32560-like            205   2e-60   
ref|XP_010673037.1|  PREDICTED: F-box protein At2g26850-like isof...    206   3e-60   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010910139.1|  PREDICTED: F-box protein At2g32560-like isof...    205   3e-60   Elaeis guineensis
ref|XP_009142728.1|  PREDICTED: F-box protein At2g41170                 206   3e-60   Brassica rapa
ref|XP_010505881.1|  PREDICTED: F-box protein At2g41170-like            204   4e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004493395.1|  PREDICTED: F-box protein At2g26850-like            205   5e-60   Cicer arietinum [garbanzo]
gb|KFK36964.1|  hypothetical protein AALP_AA4G195400                    202   1e-59   Arabis alpina [alpine rockcress]
ref|XP_006362270.1|  PREDICTED: F-box protein At2g26850-like isof...    204   1e-59   Solanum tuberosum [potatoes]
ref|XP_002458655.1|  hypothetical protein SORBIDRAFT_03g037510          204   3e-59   Sorghum bicolor [broomcorn]
ref|XP_009618518.1|  PREDICTED: F-box protein At2g26850-like isof...    202   4e-59   Nicotiana tomentosiformis
ref|XP_010232469.1|  PREDICTED: F-box protein At2g32560-like isof...    202   6e-59   Brachypodium distachyon [annual false brome]
ref|XP_004249133.1|  PREDICTED: F-box protein At2g26850-like isof...    201   1e-58   Solanum lycopersicum
ref|XP_009768151.1|  PREDICTED: F-box protein At2g26850-like isof...    201   2e-58   Nicotiana sylvestris
gb|EMS62261.1|  hypothetical protein TRIUR3_33055                       193   4e-58   Triticum urartu
ref|XP_006446320.1|  hypothetical protein CICLE_v10015455mg             198   4e-58   
ref|XP_006362269.1|  PREDICTED: F-box protein At2g26850-like isof...    199   9e-58   Solanum tuberosum [potatoes]
gb|KJB55452.1|  hypothetical protein B456_009G077900                    196   2e-57   Gossypium raimondii
ref|XP_002967788.1|  hypothetical protein SELMODRAFT_88058              196   4e-57   
ref|XP_002992630.1|  hypothetical protein SELMODRAFT_135657             196   5e-57   
ref|XP_011459459.1|  PREDICTED: F-box protein At2g32560 isoform X2      196   5e-57   Fragaria vesca subsp. vesca
ref|XP_009421118.1|  PREDICTED: F-box protein At2g32560-like isof...    197   5e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421126.1|  PREDICTED: F-box protein At2g32560-like isof...    197   5e-57   
ref|XP_010554766.1|  PREDICTED: F-box protein At2g41170 isoform X2      194   1e-56   Tarenaya hassleriana [spider flower]
ref|XP_009768150.1|  PREDICTED: F-box protein At2g26850-like isof...    196   2e-56   Nicotiana sylvestris
ref|XP_002968595.1|  hypothetical protein SELMODRAFT_409561             194   2e-56   
ref|XP_002975888.1|  hypothetical protein SELMODRAFT_104188             194   3e-56   
ref|XP_010554764.1|  PREDICTED: F-box protein At2g41170 isoform X1      194   5e-56   
gb|KDO54744.1|  hypothetical protein CISIN_1g015516mg                   194   6e-56   Citrus sinensis [apfelsine]
gb|AAC25938.1|  unknown protein                                         189   7e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970295.1|  PREDICTED: F-box protein At2g41170-like isof...    191   1e-53   
ref|XP_007028346.1|  F-box family protein isoform 5                     186   1e-53   
ref|XP_004970297.1|  PREDICTED: F-box protein At2g41170-like isof...    189   2e-53   
ref|XP_007028343.1|  F-box family protein isoform 2                     184   6e-53   
ref|XP_008240698.1|  PREDICTED: F-box protein At2g26850-like isof...    183   1e-51   Prunus mume [ume]
gb|AAC32240.1|  unknown protein                                         181   2e-51   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66079.1|  hypothetical protein M569_08700                         181   6e-51   Genlisea aurea
gb|EEE55551.1|  hypothetical protein OsJ_03804                          180   2e-50   Oryza sativa Japonica Group [Japonica rice]
gb|EMT27387.1|  hypothetical protein F775_17219                         173   4e-50   
ref|XP_010112853.1|  F-box protein                                      177   6e-50   
ref|XP_010112851.1|  F-box protein                                      177   6e-50   Morus notabilis
ref|XP_010508751.1|  PREDICTED: F-box protein At2g41170-like isof...    166   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010112859.1|  F-box protein                                      166   2e-45   
ref|XP_010112850.1|  F-box protein                                      163   2e-44   
gb|ADE76919.1|  unknown                                                 160   2e-43   Picea sitchensis
gb|ACI23490.1|  putative cyclin-like F-box                              144   3e-40   Triticum monococcum [einkorn wheat]
gb|ACI23489.1|  putative cyclin-like F-box                              140   2e-38   Secale cereale
ref|XP_003520488.1|  PREDICTED: F-box protein At2g26850-like isof...    130   2e-32   Glycine max [soybeans]
ref|XP_003537295.1|  PREDICTED: F-box protein At2g26850-like            130   2e-32   Glycine max [soybeans]
ref|XP_003624987.1|  F-box protein                                      128   1e-31   Medicago truncatula
ref|XP_003520491.1|  PREDICTED: F-box protein At2g26850-like            127   2e-31   Glycine max [soybeans]
ref|XP_003520490.1|  PREDICTED: F-box protein At2g32560-like            127   4e-31   
ref|XP_004499916.1|  PREDICTED: F-box protein At2g26850-like isof...    125   3e-30   Cicer arietinum [garbanzo]
ref|XP_007162085.1|  hypothetical protein PHAVU_001G122600g             124   7e-30   Phaseolus vulgaris [French bean]
gb|EYU18616.1|  hypothetical protein MIMGU_mgv1a0077792mg               118   2e-29   Erythranthe guttata [common monkey flower]
ref|XP_003624981.1|  F-box protein                                      122   2e-29   Medicago truncatula
ref|XP_007162082.1|  hypothetical protein PHAVU_001G122300g             121   7e-29   Phaseolus vulgaris [French bean]
ref|XP_007162081.1|  hypothetical protein PHAVU_001G122200g             120   1e-28   Phaseolus vulgaris [French bean]
ref|XP_007145512.1|  hypothetical protein PHAVU_007G244800g             119   2e-28   Phaseolus vulgaris [French bean]
ref|XP_007145513.1|  hypothetical protein PHAVU_007G244800g             119   4e-28   Phaseolus vulgaris [French bean]
gb|AFK35889.1|  unknown                                                 115   6e-27   Lotus japonicus
ref|XP_006576778.1|  PREDICTED: F-box protein At2g26850-like isof...    109   1e-25   
gb|AES81202.2|  F-box plant-like protein                                111   2e-25   Medicago truncatula
gb|ABD33044.1|  Cyclin-like F-box                                       111   3e-25   Medicago truncatula
ref|XP_003624984.1|  F-box protein                                      111   3e-25   
ref|XP_003624986.1|  F-box protein                                      108   4e-24   
gb|KDO54749.1|  hypothetical protein CISIN_1g015516mg                   100   7e-22   Citrus sinensis [apfelsine]
ref|XP_007162079.1|  hypothetical protein PHAVU_001G122000g             100   8e-22   Phaseolus vulgaris [French bean]
gb|KEH26010.1|  F-box plant-like protein                                100   2e-21   Medicago truncatula
gb|KHN30352.1|  F-box protein                                         96.3    4e-20   Glycine soja [wild soybean]
ref|XP_007145514.1|  hypothetical protein PHAVU_007G244800g           94.0    3e-19   Phaseolus vulgaris [French bean]
gb|KHN30354.1|  F-box protein                                         92.0    1e-18   Glycine soja [wild soybean]
gb|EYU18617.1|  hypothetical protein MIMGU_mgv1a0077791mg             89.0    1e-17   Erythranthe guttata [common monkey flower]
gb|KHN32241.1|  F-box protein                                         89.0    2e-17   Glycine soja [wild soybean]
gb|AFW62003.1|  hypothetical protein ZEAMMB73_746738                  89.0    8e-17   
ref|XP_005847662.1|  hypothetical protein CHLNCDRAFT_134034           65.1    6e-09   Chlorella variabilis
gb|KDO54748.1|  hypothetical protein CISIN_1g015516mg                 52.8    8e-05   Citrus sinensis [apfelsine]
emb|CDY67830.1|  BnaCnng56600D                                        49.3    4e-04   Brassica napus [oilseed rape]



>ref|XP_009794988.1| PREDICTED: F-box protein At2g26850-like [Nicotiana sylvestris]
Length=397

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/149 (81%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
            N     K+ +   +DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT
Sbjct  186  NFSISIKKKHTASVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  245

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A+AIETGVTWDRLRAP +D   HDL+ISDCL +L PGDHIEIQWRRN
Sbjct  246  DTFQARYPPHGRRAIAIETGVTWDRLRAPPLDTSPHDLYISDCLTELCPGDHIEIQWRRN  305

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHLETCDGN+ YCRCH+
Sbjct  306  KEFPYGWWYGVVGHLETCDGNEIYCRCHD  334



>ref|XP_011090175.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=405

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
             K+ + PP+DS+M WYLALESGKFWFPAQVYNRENGH+GFMLSCYDAELSYD RTDTF A
Sbjct  199  SKKQSFPPVDSIMSWYLALESGKFWFPAQVYNRENGHIGFMLSCYDAELSYDQRTDTFQA  258

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR A AIETGVTWDRLRAP VD   H+LHISDCL +L+PGD IEIQWRRNK+FPY
Sbjct  259  RYPPHGRRASAIETGVTWDRLRAPPVDTSPHNLHISDCLNELKPGDQIEIQWRRNKEFPY  318

Query  312  GWWYGVVGHLETCDGNQHYCRCHE  241
            GWWYGVVGHLETCDGN  YCRCH+
Sbjct  319  GWWYGVVGHLETCDGNADYCRCHD  342



>gb|EYU46183.1| hypothetical protein MIMGU_mgv1a007435mg [Erythranthe guttata]
Length=407

 Score =   260 bits (665),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -1

Query  666  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  487
            + N PP+DS+M WY ALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD +TDTF ARY
Sbjct  203  KKNFPPLDSIMSWYFALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDLQTDTFKARY  262

Query  486  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  307
            PPHGR   A ETGVTWDRLRAP +D   HDLH SDCL +L+PGDHIEIQWRRNK+FPYGW
Sbjct  263  PPHGRRISATETGVTWDRLRAPPIDTSPHDLHTSDCLNELQPGDHIEIQWRRNKEFPYGW  322

Query  306  WYGVVGHLETCDGNQHYCRCHEC  238
            WYGVVGHLETCDGN +YCRCHEC
Sbjct  323  WYGVVGHLETCDGNPNYCRCHEC  345



>ref|XP_009590639.1| PREDICTED: F-box protein At2g32560 [Nicotiana tomentosiformis]
Length=398

 Score =   260 bits (664),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -1

Query  654  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  475
            PP+DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD RTDTF ARYPPHG
Sbjct  198  PPVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDLRTDTFQARYPPHG  257

Query  474  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  295
            R A+AIETGVTWDRLRAP +D   HDL+ISDCL +L PGDHIEIQWRRNK+FPYGWWYG+
Sbjct  258  RRAIAIETGVTWDRLRAPPLDTSPHDLYISDCLTELCPGDHIEIQWRRNKEFPYGWWYGI  317

Query  294  VGHLETCDGNQHYCRCHE  241
            VGHLETCDGN+ YCRCH+
Sbjct  318  VGHLETCDGNEFYCRCHD  335



>ref|XP_008359220.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Malus domestica]
Length=335

 Score =   257 bits (657),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYDPRTDTF 
Sbjct  128  GTKQRSSLPADSIMSWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYDPRTDTFQ  187

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AVAIE GV W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQWRRNK+FP
Sbjct  188  ARYPPHGRRAVAIEKGVPWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQWRRNKEFP  247

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+CDGN++YC CH
Sbjct  248  YGWWYGVVGHLESCDGNENYCLCH  271



>ref|XP_009350006.1| PREDICTED: F-box protein At2g26850-like [Pyrus x bretschneideri]
Length=400

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYDPRTDTF 
Sbjct  193  GSKQRSSLPADSIMAWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYDPRTDTFQ  252

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AVAIE GV+W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQWRRNK+FP
Sbjct  253  ARYPPHGRRAVAIEKGVSWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQWRRNKEFP  312

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+CDGN++YC CH
Sbjct  313  YGWWYGVVGHLESCDGNENYCLCH  336



>gb|KDP43182.1| hypothetical protein JCGZ_22734 [Jatropha curcas]
Length=338

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K+ +  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRT+TF AR
Sbjct  133  KQKSSLPVDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTNTFQAR  192

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR A+AIETGV W+RLRAP +D   H LHISDCL DLRPGDHIEIQWRRNK+FPYG
Sbjct  193  YPPHGRRAIAIETGVPWERLRAPPIDTSPHHLHISDCLNDLRPGDHIEIQWRRNKEFPYG  252

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE CDGN++YCRCH
Sbjct  253  WWYGVVGHLEPCDGNENYCRCH  274



>ref|XP_010088960.1| F-box protein [Morus notabilis]
 gb|EXB37175.1| F-box protein [Morus notabilis]
Length=338

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
            N  +  K  +  P+DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDA++SYDPRT
Sbjct  127  NNSSSTKPRSPLPVDSIMAWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAQISYDPRT  186

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR AVAIE+GV W+RLRAP VD P HDLHISDCL++LRPGDHIEIQWRRN
Sbjct  187  DTFQARYPPHGRRAVAIESGVPWERLRAPPVDTPPHDLHISDCLHELRPGDHIEIQWRRN  246

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHLE+CD N++YCRCH+
Sbjct  247  KEFPYGWWYGVVGHLESCDRNENYCRCHD  275



>ref|XP_008359219.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Malus domestica]
Length=400

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G K+ +  P DS+M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYDPRTDTF 
Sbjct  193  GTKQRSSLPADSIMSWYLALETGRFWFPAQVYNRENGHVGFVLSCYDAELSYDPRTDTFQ  252

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AVAIE GV W+RLRAP VD P HDLH+SDCL +LRPGDHIEIQWRRNK+FP
Sbjct  253  ARYPPHGRRAVAIEKGVPWERLRAPPVDTPPHDLHVSDCLNELRPGDHIEIQWRRNKEFP  312

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+CDGN++YC CH
Sbjct  313  YGWWYGVVGHLESCDGNENYCLCH  336



>emb|CDP09613.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   256 bits (654),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            KR N PP+DSVM WYLALESGK  FPAQ+YNRE+GHVGFMLSCYDAELSY+PRTDTF AR
Sbjct  169  KRKNSPPVDSVMSWYLALESGKL-FPAQIYNREHGHVGFMLSCYDAELSYNPRTDTFQAR  227

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHG  AVA+ET VTWDR+RAP VD P HDLHISDCL +L PGDHIEIQWRRNK+FPYG
Sbjct  228  YPPHGNRAVAVETDVTWDRIRAPPVDTPPHDLHISDCLSELHPGDHIEIQWRRNKEFPYG  287

Query  309  WWYGVVGHLETCDGNQHYCRCHE  241
            WWYGVVGHLETCDGN +YCRCHE
Sbjct  288  WWYGVVGHLETCDGNSNYCRCHE  310



>ref|XP_003519507.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
 gb|KHN38398.1| F-box protein [Glycine soja]
Length=397

 Score =   256 bits (653),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K+ +  P DS+M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP TDTF AR
Sbjct  192  KQQSYLPPDSLMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHTDTFQAR  251

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR AVA+E G+ W+RLRAP VD P HDLHISDCLYDL PGDH+EIQWRRNK+FPYG
Sbjct  252  YPPHGRRAVAVEHGIPWERLRAPPVDTPPHDLHISDCLYDLHPGDHVEIQWRRNKEFPYG  311

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE CDGN++YCRCH
Sbjct  312  WWYGVVGHLEVCDGNENYCRCH  333



>ref|XP_011080446.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=397

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = -1

Query  654  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  475
            PP DS+M WY ALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYD RTDTF ARYPPHG
Sbjct  197  PPADSLMSWYFALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDLRTDTFQARYPPHG  256

Query  474  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  295
            R A+ IETGVTWDRLRAP VD   HDLHIS+CL +L+PGDHIEIQWRRNK+FPYGWWYGV
Sbjct  257  RRAITIETGVTWDRLRAPPVDTSPHDLHISNCLTELQPGDHIEIQWRRNKEFPYGWWYGV  316

Query  294  VGHLETCDGNQHYCRCHE  241
            VGHLETC GN +YCRCH+
Sbjct  317  VGHLETCVGNANYCRCHD  334



>ref|XP_004250900.1| PREDICTED: F-box protein At2g32560 isoform X2 [Solanum lycopersicum]
Length=393

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
            N     K+ + P IDS+M  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  RT
Sbjct  182  NPSTSFKKKDPPVIDSIMSMYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYSRRT  241

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A+AIETGVTWDRLR P +D   HDL+ISDCL +L PGDHIEIQWRRN
Sbjct  242  DTFQARYPPHGRRAMAIETGVTWDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQWRRN  301

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHLETCDGN++YCRCHE
Sbjct  302  KEFPYGWWYGVVGHLETCDGNEYYCRCHE  330



>ref|XP_002314008.1| F-box family protein [Populus trichocarpa]
 gb|EEE87963.1| F-box family protein [Populus trichocarpa]
Length=405

 Score =   254 bits (649),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 131/142 (92%), Gaps = 1/142 (1%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            +R++LP + S+M WYLALE+GKFWFPAQV+NRENGHVGFMLSCYDAEL+YDPRTDTF AR
Sbjct  201  QRSSLP-VHSIMSWYLALETGKFWFPAQVFNRENGHVGFMLSCYDAELNYDPRTDTFQAR  259

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR A++IE+GV W+RLRAP VD   HDLHISDCL+DL PGDHIEIQWRRNK+FPYG
Sbjct  260  YPPHGRRAISIESGVPWERLRAPSVDTSPHDLHISDCLHDLLPGDHIEIQWRRNKEFPYG  319

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE+CDGN++YCRCH
Sbjct  320  WWYGVVGHLESCDGNENYCRCH  341



>ref|XP_008798380.1| PREDICTED: F-box protein At2g32560-like [Phoenix dactylifera]
Length=398

 Score =   254 bits (649),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 129/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            + +  K +N  P DS+M WYL+LE+GKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TD
Sbjct  188  IESSSKPSNPLPDDSIMSWYLSLENGKFWFPAQVYNREHGHVGFMLSCYDAEISYDCHTD  247

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TFHARYPPHGR A+ IE G+ W+R+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK
Sbjct  248  TFHARYPPHGRRAIVIEEGLQWERIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNK  307

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FPYGWWYGVVGHLETCDGN+H+CRCH
Sbjct  308  EFPYGWWYGVVGHLETCDGNEHFCRCH  334



>gb|AHB08886.1| F-box family protein [Suaeda glauca]
Length=399

 Score =   254 bits (648),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
            +K +  P +DSVM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP++DTF A
Sbjct  193  NKDSTSPLVDSVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPQSDTFKA  252

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR AVAIE+G+ W+RLRA  VD P HDLH SDCL DL PGDHIEIQWRRNK+FPY
Sbjct  253  RYPPHGRRAVAIESGIQWERLRAAPVDTPPHDLHQSDCLNDLHPGDHIEIQWRRNKEFPY  312

Query  312  GWWYGVVGHLETCDGNQHYCRCHE  241
            GWWYGVVGHLE+CDGN +YCRCH 
Sbjct  313  GWWYGVVGHLESCDGNDNYCRCHS  336



>gb|KHN11010.1| F-box protein [Glycine soja]
Length=328

 Score =   251 bits (640),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K+ +  P DS+M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP  DTF AR
Sbjct  123  KQQSYLPPDSLMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHNDTFQAR  182

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR  VA+E G+ W+RLRAP VD P HDLHISDC+YDL PGDHIEIQWRRNK+FPYG
Sbjct  183  YPPHGRRTVAVEHGIPWERLRAPPVDTPPHDLHISDCVYDLHPGDHIEIQWRRNKEFPYG  242

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE CDGN++YCRCH
Sbjct  243  WWYGVVGHLELCDGNENYCRCH  264



>ref|XP_010673781.1| PREDICTED: F-box protein At2g32560 [Beta vulgaris subsp. vulgaris]
Length=397

 Score =   253 bits (645),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = -1

Query  654  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  475
            P +D+VM WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP+TDTF ARYPPHG
Sbjct  197  PLVDTVMSWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPQTDTFQARYPPHG  256

Query  474  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  295
            R AVAIE+G+ W+RLRA  VD P HDLH SDCL DL+PGDHIEIQWRRNK+FPYGWWYGV
Sbjct  257  RRAVAIESGIQWERLRAAPVDTPPHDLHASDCLNDLQPGDHIEIQWRRNKEFPYGWWYGV  316

Query  294  VGHLETCDGNQHYCRCHE  241
            VGHLE+CDG+++YCRCH 
Sbjct  317  VGHLESCDGDENYCRCHS  334



>ref|XP_002533285.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29096.1| conserved hypothetical protein [Ricinus communis]
Length=408

 Score =   253 bits (645),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K+ +  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYDPR DTF AR
Sbjct  203  KQRSSLPVDSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDADLSYDPRKDTFQAR  262

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR A AIE GV W+RLRAP  D   HDLHISDCL +LRPGDHIEIQWRRNK+FPYG
Sbjct  263  YPPHGRRATAIENGVPWERLRAPPADTSPHDLHISDCLNELRPGDHIEIQWRRNKEFPYG  322

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE+CDGN++YCRCH
Sbjct  323  WWYGVVGHLESCDGNENYCRCH  344



>ref|XP_008794228.1| PREDICTED: F-box protein At2g32560-like [Phoenix dactylifera]
Length=394

 Score =   252 bits (644),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L  G++ ++  P+DS+M WYL LESGKFWFPAQVYNRENGHVGF+LSCYDAELSYD  T
Sbjct  183  KLDNGNRPSSPLPMDSIMSWYLVLESGKFWFPAQVYNRENGHVGFLLSCYDAELSYDRHT  242

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF+ARYPPHGR  V IE G+ WDRLRAP VD PAHDLH+SDCL DL PGDHIEIQWRRN
Sbjct  243  DTFYARYPPHGRRPVKIEEGIEWDRLRAPPVDTPAHDLHVSDCLNDLCPGDHIEIQWRRN  302

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHLE+CDGN+H+CRCH+
Sbjct  303  KEFPYGWWYGVVGHLESCDGNEHHCRCHK  331



>ref|XP_010910138.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Elaeis guineensis]
Length=398

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 127/147 (86%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            + +  K +N  P DS+M WYL+LESGKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TD
Sbjct  188  IESSSKPSNPLPDDSIMSWYLSLESGKFWFPAQVYNREHGHVGFMLSCYDAEISYDHHTD  247

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TFHARYPPHGR  + IE GV WDR+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK
Sbjct  248  TFHARYPPHGRRTIVIEEGVQWDRIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNK  307

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FPYGWWYGVVGHLE+CDGN+H+C CH
Sbjct  308  EFPYGWWYGVVGHLESCDGNEHFCHCH  334



>ref|XP_007212266.1| hypothetical protein PRUPE_ppa006669mg [Prunus persica]
 gb|EMJ13465.1| hypothetical protein PRUPE_ppa006669mg [Prunus persica]
Length=400

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 126/136 (93%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DSVM WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF ARYPPHGR
Sbjct  201  PADSVMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVAIE GV W+RLRAP ++ PAHDLH+SDCL +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAIENGVPWERLRAPPIETPAHDLHMSDCLNELQPGDHIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+++YC CH
Sbjct  321  GHLESCDGHENYCLCH  336



>ref|XP_008227257.1| PREDICTED: F-box protein At2g26850-like [Prunus mume]
Length=400

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF ARYPPHGR
Sbjct  201  PADSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVAIE GV W+RLRAP ++ P HDLH+SDCL +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAIENGVPWERLRAPPIETPPHDLHMSDCLNELQPGDHIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN++YC CH
Sbjct  321  GHLESCDGNENYCLCH  336



>ref|XP_003545428.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=397

 Score =   251 bits (641),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K+ +  P DS+M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP  DTF AR
Sbjct  192  KQQSYLPPDSLMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPHNDTFQAR  251

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR  VA+E G+ W+RLRAP VD P HDLHISDC+YDL PGDHIEIQWRRNK+FPYG
Sbjct  252  YPPHGRRTVAVEHGIPWERLRAPPVDTPPHDLHISDCVYDLHPGDHIEIQWRRNKEFPYG  311

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE CDGN++YCRCH
Sbjct  312  WWYGVVGHLELCDGNENYCRCH  333



>gb|EYU35951.1| hypothetical protein MIMGU_mgv1a008147mg [Erythranthe guttata]
Length=348

 Score =   249 bits (637),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K    PP++SVM WY+ALESGK WFPAQVYNRENGHVGFMLSCYDA +SYD RTDTF AR
Sbjct  178  KDKIFPPVNSVMSWYIALESGKLWFPAQVYNRENGHVGFMLSCYDAVVSYDRRTDTFLAR  237

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YP HG    AIE+GVTWDRLRAPLVD   HDLHISDCL +LRPGD IEIQWRRNK+FPYG
Sbjct  238  YPAHGTRTSAIESGVTWDRLRAPLVDTSPHDLHISDCLNELRPGDQIEIQWRRNKEFPYG  297

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLETCDGN +YCRCH
Sbjct  298  WWYGVVGHLETCDGNANYCRCH  319



>ref|XP_006356347.1| PREDICTED: F-box protein At2g32560-like [Solanum tuberosum]
Length=393

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
            N     K+   P IDS+M  YLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSY  RT
Sbjct  182  NPSTSFKKKVPPAIDSIMSMYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYSRRT  241

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A+AIETGVT DRLR P +D   HDL+ISDCL +L PGDHIEIQWRRN
Sbjct  242  DTFQARYPPHGRRAMAIETGVTLDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQWRRN  301

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHLETCDGN++YCRCHE
Sbjct  302  KEFPYGWWYGVVGHLETCDGNEYYCRCHE  330



>ref|XP_007015246.1| F-box family protein isoform 2 [Theobroma cacao]
 gb|EOY32865.1| F-box family protein isoform 2 [Theobroma cacao]
Length=357

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 130/154 (84%), Gaps = 1/154 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
              K+++LP  DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDP T+TF 
Sbjct  192  SSKQSSLPD-DSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPGTETFQ  250

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AVAIE  V W+RLRAP +D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  251  ARYPPHGRRAVAIENCVPWERLRAPPIDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  310

Query  315  YGWWYGVVGHLETCDGNQHYCRCHECVLQKSGLG  214
            YGWWYGVVGHLE+CDGN++YCRCH  V      G
Sbjct  311  YGWWYGVVGHLESCDGNENYCRCHNSVFMVELTG  344



>ref|XP_007141515.1| hypothetical protein PHAVU_008G202600g [Phaseolus vulgaris]
 gb|ESW13509.1| hypothetical protein PHAVU_008G202600g [Phaseolus vulgaris]
Length=399

 Score =   250 bits (638),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 1/145 (1%)
 Frame = -1

Query  678  AGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  499
             G + + LPP DS M WYLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP+TDTF
Sbjct  192  TGKQSSYLPP-DSFMTWYLALETGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPQTDTF  250

Query  498  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  319
             ARYPPHGR A+A+E G+ W+RLRAP VD   HDLH+SDCL+DL PGDH+EIQWRRNK+F
Sbjct  251  QARYPPHGRRAIAVEHGIPWERLRAPPVDTSPHDLHVSDCLHDLHPGDHVEIQWRRNKEF  310

Query  318  PYGWWYGVVGHLETCDGNQHYCRCH  244
            PYGWWYGVVGHLE CDGN+ YCRCH
Sbjct  311  PYGWWYGVVGHLELCDGNESYCRCH  335



>emb|CBI24276.3| unnamed protein product [Vitis vinifera]
Length=375

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  176  PVDSIMSWYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARYPPHGR  235

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  236  RTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYGWWYGIV  295

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN+ YCRCH
Sbjct  296  GHLESCDGNESYCRCH  311



>gb|EYU35950.1| hypothetical protein MIMGU_mgv1a008147mg [Erythranthe guttata]
Length=383

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K    PP++SVM WY+ALESGK WFPAQVYNRENGHVGFMLSCYDA +SYD RTDTF AR
Sbjct  178  KDKIFPPVNSVMSWYIALESGKLWFPAQVYNRENGHVGFMLSCYDAVVSYDRRTDTFLAR  237

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YP HG    AIE+GVTWDRLRAPLVD   HDLHISDCL +LRPGD IEIQWRRNK+FPYG
Sbjct  238  YPAHGTRTSAIESGVTWDRLRAPLVDTSPHDLHISDCLNELRPGDQIEIQWRRNKEFPYG  297

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLETCDGN +YCRCH
Sbjct  298  WWYGVVGHLETCDGNANYCRCH  319



>ref|XP_010313246.1| PREDICTED: F-box protein At2g32560 isoform X1 [Solanum lycopersicum]
Length=396

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE---NGHVGFMLSCYDAELSYD  517
            N     K+ + P IDS+M  YLALESGKFWFPAQVYNRE   NGHVGFMLSCYDAELSY 
Sbjct  182  NPSTSFKKKDPPVIDSIMSMYLALESGKFWFPAQVYNREIVQNGHVGFMLSCYDAELSYS  241

Query  516  PRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQW  337
             RTDTF ARYPPHGR A+AIETGVTWDRLR P +D   HDL+ISDCL +L PGDHIEIQW
Sbjct  242  RRTDTFQARYPPHGRRAMAIETGVTWDRLRVPPLDTSPHDLYISDCLTELCPGDHIEIQW  301

Query  336  RRNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            RRNK+FPYGWWYGVVGHLETCDGN++YCRCHE
Sbjct  302  RRNKEFPYGWWYGVVGHLETCDGNEYYCRCHE  333



>ref|XP_002263423.1| PREDICTED: F-box protein At2g32560 isoform X2 [Vitis vinifera]
Length=396

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  197  PVDSIMSWYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARYPPHGR  256

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  257  RTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYGWWYGIV  316

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN+ YCRCH
Sbjct  317  GHLESCDGNESYCRCH  332



>gb|KEH28371.1| F-box plant-like protein [Medicago truncatula]
Length=347

 Score =   247 bits (631),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
             + +K+N+  P DS M WYLALE+G F FPAQVYNRENGHVGFMLSCYDAELSYDPRTDT
Sbjct  190  NSANKQNSYLPPDSFMTWYLALETGNFSFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  249

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYPPHGR A A+E G+ W+RLRAP VD P HDLHI++CL+DL  GDHIEIQWRRNK 
Sbjct  250  FQARYPPHGRRAAAVEHGIPWERLRAPPVDTPPHDLHITECLHDLHAGDHIEIQWRRNKD  309

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYG+VGHLE+CDGN++YCRCH
Sbjct  310  FPYGWWYGIVGHLESCDGNENYCRCH  335



>ref|XP_002298461.1| hypothetical protein POPTR_0001s28050g [Populus trichocarpa]
 gb|EEE83266.1| hypothetical protein POPTR_0001s28050g [Populus trichocarpa]
Length=368

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
             K+ +  P++S+M WYLALE+GKFWFPAQV+NRENGHVGFMLSCYDA LSYDP TDTF  
Sbjct  162  SKQRSSLPVNSIMSWYLALETGKFWFPAQVFNRENGHVGFMLSCYDANLSYDPGTDTFQV  221

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR A+A E+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPY
Sbjct  222  RYPPHGRRAIATESGVPWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPY  281

Query  312  GWWYGVVGHLETCDGNQHYCRCH  244
            GWWYGVVGHLE CDGN++YCRCH
Sbjct  282  GWWYGVVGHLELCDGNENYCRCH  304



>ref|XP_010246180.1| PREDICTED: F-box protein At2g32560-like [Nelumbo nucifera]
Length=394

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%), Gaps = 0/148 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L   +K  +  P+DSVM WYLALESGKFWFPAQVYNRE+GHVGFMLSCYDAELSYD RT
Sbjct  183  KLDNSNKPRSSLPVDSVMSWYLALESGKFWFPAQVYNREHGHVGFMLSCYDAELSYDSRT  242

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR  V IE GV WDRLRAP VD   HDLH+SDCL+DL PGDHIEIQWRRN
Sbjct  243  DTFQARYPPHGRRTVVIEDGVQWDRLRAPPVDTRPHDLHVSDCLHDLHPGDHIEIQWRRN  302

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            K+FPYGWWYGVVGHLE+CDGN+++C C+
Sbjct  303  KEFPYGWWYGVVGHLESCDGNENHCHCY  330



>ref|XP_003617213.1| F-box family protein [Medicago truncatula]
 gb|AET00172.1| F-box plant-like protein [Medicago truncatula]
Length=399

 Score =   248 bits (632),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
             + +K+N+  P DS M WYLALE+G F FPAQVYNRENGHVGFMLSCYDAELSYDPRTDT
Sbjct  190  NSANKQNSYLPPDSFMTWYLALETGNFSFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  249

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYPPHGR A A+E G+ W+RLRAP VD P HDLHI++CL+DL  GDHIEIQWRRNK 
Sbjct  250  FQARYPPHGRRAAAVEHGIPWERLRAPPVDTPPHDLHITECLHDLHAGDHIEIQWRRNKD  309

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYG+VGHLE+CDGN++YCRCH
Sbjct  310  FPYGWWYGIVGHLESCDGNENYCRCH  335



>ref|XP_007015245.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY32864.1| F-box family protein isoform 1 [Theobroma cacao]
Length=398

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
              K+++LP  DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDP T+TF 
Sbjct  192  SSKQSSLPD-DSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPGTETFQ  250

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AVAIE  V W+RLRAP +D   HDLHISDCL +LRPGD+IEIQWRRNK+FP
Sbjct  251  ARYPPHGRRAVAIENCVPWERLRAPPIDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFP  310

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+CDGN++YCRCH
Sbjct  311  YGWWYGVVGHLESCDGNENYCRCH  334



>gb|KHG08627.1| hypothetical protein F383_10185 [Gossypium arboreum]
Length=400

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 128/151 (85%), Gaps = 3/151 (2%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR
Sbjct  201  PDDSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVAIE  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAIENYVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCHE---CVLQKSGLGAG  208
            GHLE+CDGN +YCRCH     VL+ +   AG
Sbjct  321  GHLESCDGNDNYCRCHNSDTVVLEFNQYTAG  351



>ref|XP_009403834.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=333

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DSVM WY +LESGKFWFP+Q+YNRE+GHVGFMLSCYDAE+ YD  TDTFHARYPPHGR
Sbjct  134  PDDSVMSWYQSLESGKFWFPSQIYNREHGHVGFMLSCYDAEVRYDSHTDTFHARYPPHGR  193

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A+ IE GV WDRLRAP +  PAH+LHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGV+
Sbjct  194  RAIVIEEGVQWDRLRAPPISTPAHELHISDCLSDLRPGDHIEIQWRRNKEFPYGWWYGVI  253

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG++H+C CH
Sbjct  254  GHLESCDGSEHFCHCH  269



>gb|KCW51070.1| hypothetical protein EUGRSUZ_J00678 [Eucalyptus grandis]
Length=336

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L   +K+    P DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDAELSYD +T
Sbjct  184  KLDNSEKQRIPLPTDSIMSWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAELSYDSQT  243

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A AIE+ VTWDRLRA  VD P HDLHISDCL DL+PGDHIEIQWRRN
Sbjct  244  DTFQARYPPHGRRAGAIESNVTWDRLRAQPVDAPPHDLHISDCLNDLQPGDHIEIQWRRN  303

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            ++FPYGWWYG VGHLE+CDGN +YCRCH
Sbjct  304  EEFPYGWWYGAVGHLESCDGNANYCRCH  331



>ref|XP_004491223.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=400

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K++ L P DS M  YLALE+G FWFPAQVYNRENGHVGFMLSCYDAELSYDP TDTF AR
Sbjct  195  KQSYLQPPDSFMTLYLALENGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPNTDTFQAR  254

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR A+A E G+ W+RLRAP VD P HDLHISDCL+DL PGDHIEIQWRRNK FPYG
Sbjct  255  YPPHGRRAIAAEHGIQWERLRAPPVDTPPHDLHISDCLHDLHPGDHIEIQWRRNKDFPYG  314

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYG+VGHLE+CDGN++YC CH
Sbjct  315  WWYGIVGHLESCDGNENYCSCH  336



>ref|XP_010031705.1| PREDICTED: F-box protein At2g26850 [Eucalyptus grandis]
 gb|KCW51069.1| hypothetical protein EUGRSUZ_J00678 [Eucalyptus grandis]
Length=395

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L   +K+    P DS+M WYLALE+GKF FPAQVYNRENGHVGFMLSCYDAELSYD +T
Sbjct  184  KLDNSEKQRIPLPTDSIMSWYLALETGKFCFPAQVYNRENGHVGFMLSCYDAELSYDSQT  243

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A AIE+ VTWDRLRA  VD P HDLHISDCL DL+PGDHIEIQWRRN
Sbjct  244  DTFQARYPPHGRRAGAIESNVTWDRLRAQPVDAPPHDLHISDCLNDLQPGDHIEIQWRRN  303

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            ++FPYGWWYG VGHLE+CDGN +YCRCH
Sbjct  304  EEFPYGWWYGAVGHLESCDGNANYCRCH  331



>gb|EMT11595.1| hypothetical protein F775_27187 [Aegilops tauschii]
Length=403

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL LESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD RTDTFHARYPPHGR  
Sbjct  206  DSIMSWYLHLESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFRTDTFHARYPPHGRRT  265

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP V+  AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGH
Sbjct  266  VVLEDGVQWDRIRAPRVETLAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGH  325

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+H+CRCH
Sbjct  326  LESCDGNEHFCRCH  339



>ref|XP_006836283.1| hypothetical protein AMTR_s00101p00163380 [Amborella trichopoda]
 gb|ERM99136.1| hypothetical protein AMTR_s00101p00163380 [Amborella trichopoda]
Length=330

 Score =   243 bits (621),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 110/147 (75%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L +G K  +  P DS+M WYL+LE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  T
Sbjct  119  KLVSGGKPKSTLPSDSIMAWYLSLENGRFWFPAQVYNREHGHVGFMLSCYDAELSYDSHT  178

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTFHARYPPHGR  + IE GV WDRLRAP VD P HDLH+SDCL DLRPG+HIEIQWRRN
Sbjct  179  DTFHARYPPHGRRTIVIEEGVQWDRLRAPPVDTPPHDLHVSDCLNDLRPGNHIEIQWRRN  238

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRC  247
            K+FPYGWWYGVVGHL++CD N++ CRC
Sbjct  239  KEFPYGWWYGVVGHLDSCDRNKYNCRC  265



>ref|XP_010271792.1| PREDICTED: F-box protein At2g32560-like [Nelumbo nucifera]
Length=392

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
            DK  +  P+DS+M WYLALESGKFWFPAQVYNRE+GHVGFMLSCYDAELSYD RTDTF+A
Sbjct  186  DKPRSSLPVDSIMSWYLALESGKFWFPAQVYNREHGHVGFMLSCYDAELSYDSRTDTFYA  245

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR    IE GV WDR+RAP VD P HDLH+SDCL DL PGDHIEIQWRRNK+FPY
Sbjct  246  RYPPHGRRTAVIEDGVQWDRIRAPPVDTPPHDLHVSDCLNDLHPGDHIEIQWRRNKEFPY  305

Query  312  GWWYGVVGHLETCDGNQHYCRC  247
            GWWYGVVGHLE+CD N+++C C
Sbjct  306  GWWYGVVGHLESCDRNENHCLC  327



>ref|XP_011009173.1| PREDICTED: F-box protein At2g32560-like [Populus euphratica]
Length=405

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
             K+ +  P++S+M WYLALE+GKF FPAQV+NRENGH+GF+LSCYDA LSYDP TDTF  
Sbjct  199  SKQRSSLPVNSIMSWYLALETGKFSFPAQVFNRENGHIGFILSCYDANLSYDPGTDTFQV  258

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR A+AIE+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPY
Sbjct  259  RYPPHGRRAIAIESGVLWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPY  318

Query  312  GWWYGVVGHLETCDGNQHYCRCH  244
            GWWYGVVGHLE+CDGN++YCRCH
Sbjct  319  GWWYGVVGHLESCDGNENYCRCH  341



>ref|XP_004173270.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At2g32560-like 
[Cucumis sativus]
Length=369

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPPHGR
Sbjct  197  PVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPPHGR  256

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWYGVV
Sbjct  257  RAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELWPGDHIEIQWRKNKDFPYGWWYGVV  316

Query  291  GHLETCDGNQHYCRCH  244
            GHLETCDG+ ++C CH
Sbjct  317  GHLETCDGDANHCSCH  332



>ref|XP_010651536.1| PREDICTED: F-box protein At2g32560 isoform X1 [Vitis vinifera]
Length=397

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 123/137 (90%), Gaps = 1/137 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  475
            P+DS+M WYLALE+G+FWFPAQVYNRE +GHVGFMLSCYDAELSYD  TDTF ARYPPHG
Sbjct  197  PVDSIMSWYLALETGRFWFPAQVYNREQSGHVGFMLSCYDAELSYDSHTDTFQARYPPHG  256

Query  474  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  295
            R  VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPYGWWYG+
Sbjct  257  RRTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYGWWYGI  316

Query  294  VGHLETCDGNQHYCRCH  244
            VGHLE+CDGN+ YCRCH
Sbjct  317  VGHLESCDGNESYCRCH  333



>ref|XP_003556934.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=399

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 122/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DSVM WYLALESG FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR
Sbjct  200  PVDSVMNWYLALESGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGR  259

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A E G+ W+RLRAP +D   HDLH+SDCL DL PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  260  RADARECGIPWERLRAPPIDTSPHDLHVSDCLNDLYPGDHIEIQWRRNKEFPYGWWYGVV  319

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+C+G+++YCRCH
Sbjct  320  GHLESCNGSENYCRCH  335



>ref|XP_008449641.1| PREDICTED: F-box protein At2g32560 [Cucumis melo]
Length=396

 Score =   244 bits (624),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -1

Query  660  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  481
            N  P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPP
Sbjct  194  NFLPVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPP  253

Query  480  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  301
            HGR A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWY
Sbjct  254  HGRRAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELCPGDHIEIQWRKNKDFPYGWWY  313

Query  300  GVVGHLETCDGNQHYCRCH  244
            GVVGHLETCDG+ ++C CH
Sbjct  314  GVVGHLETCDGDANHCSCH  332



>gb|KJB55451.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=374

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 125/147 (85%), Gaps = 0/147 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF ARYPPHGR
Sbjct  201  PDDSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFKARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCHECVLQKSGLGA  211
            GHLE+CDGN +YCRCH  V ++  + A
Sbjct  321  GHLESCDGNDNYCRCHNSVHRRLKVEA  347



>ref|XP_010922076.1| PREDICTED: F-box protein At2g32560-like [Elaeis guineensis]
Length=400

 Score =   244 bits (623),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             L  G + ++  P+DS+M WYL LESGKFWFPAQVYNRENGHVGF+LSCYDAELSYD   
Sbjct  189  KLDDGKRPSSPLPMDSMMSWYLVLESGKFWFPAQVYNRENGHVGFLLSCYDAELSYDRHA  248

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF+ARYPPHGR  V IE GV WDRLRAP VD PAHDLH+SDCL DL PGDHIEIQWRRN
Sbjct  249  DTFYARYPPHGRRPVNIEEGVEWDRLRAPPVDTPAHDLHVSDCLNDLCPGDHIEIQWRRN  308

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            K+FPYGWWYGVVGHL+ CDGN+++CRCH+
Sbjct  309  KEFPYGWWYGVVGHLDLCDGNENHCRCHK  337



>gb|KHN27365.1| F-box protein [Glycine soja]
Length=399

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DSVM WYLALESG FWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF ARYPPHGR
Sbjct  200  PVDSVMNWYLALESGNFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFQARYPPHGR  259

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  260  RADARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWRRNKEFPYGWWYGVV  319

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+C+G+++YCRCH
Sbjct  320  GHLESCNGSENYCRCH  335



>ref|XP_011024991.1| PREDICTED: F-box protein At2g32560-like [Populus euphratica]
Length=405

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
             K+ +  P++S+M WYLALE+GKF FPAQV+NRENGH+GF+LSCYDA LSYDP TDTF  
Sbjct  199  SKQRSSLPVNSIMSWYLALETGKFSFPAQVFNRENGHIGFILSCYDANLSYDPGTDTFQV  258

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR A+A E+GV W+RLRAP  D   HDLHISDCL DLRPGDHIEIQWRRNK+FPY
Sbjct  259  RYPPHGRRAIATESGVLWERLRAPPFDTSPHDLHISDCLNDLRPGDHIEIQWRRNKEFPY  318

Query  312  GWWYGVVGHLETCDGNQHYCRCH  244
            GWWYGVVGHLE+CDGN++YCRCH
Sbjct  319  GWWYGVVGHLESCDGNENYCRCH  341



>gb|KJB35714.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
 gb|KJB35715.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
Length=374

 Score =   243 bits (619),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P +    K+++LP  +S+M W+LALE+G+F FPAQVYNRENGHVGFMLSCYDAEL YD R
Sbjct  186  PKVDDCSKQSSLPR-ESIMSWFLALETGRFCFPAQVYNRENGHVGFMLSCYDAELCYDQR  244

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARYPPHGR AVAIE  V W+R+RAP VD   HDLHISDCL +LRPGDHIEIQWRR
Sbjct  245  TDTFQARYPPHGRRAVAIENNVPWERIRAPPVDTSPHDLHISDCLNELRPGDHIEIQWRR  304

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+FPYGWWYGVVGHL +CDGN++YCRCH
Sbjct  305  NKEFPYGWWYGVVGHLASCDGNENYCRCH  333



>ref|XP_004140188.1| PREDICTED: F-box protein At2g32560-like isoform 1 [Cucumis sativus]
 gb|KGN48086.1| hypothetical protein Csa_6G430140 [Cucumis sativus]
Length=396

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPPHGR
Sbjct  197  PVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPPHGR  256

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWYGVV
Sbjct  257  RAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELWPGDHIEIQWRKNKDFPYGWWYGVV  316

Query  291  GHLETCDGNQHYCRCH  244
            GHLETCDG+ ++C CH
Sbjct  317  GHLETCDGDANHCSCH  332



>gb|KJB55450.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=395

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 123/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF ARYPPHGR
Sbjct  201  PDDSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFKARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCHECVLQKSGLGA  211
            GHLE+CDGN +YCRCH     +   G+
Sbjct  321  GHLESCDGNDNYCRCHNSEFNQYTAGS  347



>ref|XP_004140189.1| PREDICTED: F-box protein At2g32560-like isoform 2 [Cucumis sativus]
Length=368

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD RTDTF ARYPPHGR
Sbjct  169  PVDSIMAWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDLRTDTFQARYPPHGR  228

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A+AIE GV W+RLR+P +D P HDLH+SDCL +L PGDHIEIQWR+NK FPYGWWYGVV
Sbjct  229  RAIAIENGVQWERLRSPPIDTPPHDLHVSDCLNELWPGDHIEIQWRKNKDFPYGWWYGVV  288

Query  291  GHLETCDGNQHYCRCH  244
            GHLETCDG+ ++C CH
Sbjct  289  GHLETCDGDANHCSCH  304



>ref|XP_002455470.1| hypothetical protein SORBIDRAFT_03g011420 [Sorghum bicolor]
 gb|EES00590.1| hypothetical protein SORBIDRAFT_03g011420 [Sorghum bicolor]
Length=408

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  
Sbjct  211  DSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRT  270

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  271  VVLEDGVHWDRIRAPPVDTLAHDLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGH  330

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+H+CRCH
Sbjct  331  LESCDGNEHFCRCH  344



>ref|XP_004967668.1| PREDICTED: F-box protein At2g32560-like [Setaria italica]
Length=405

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  
Sbjct  208  DSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRT  267

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  268  VVLEDGVQWDRVRAPPVDTLAHDLHASDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGH  327

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+H+CRCH
Sbjct  328  LESCDGNEHFCRCH  341



>ref|XP_009404696.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 122/148 (82%), Gaps = 0/148 (0%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
             +  G K  N  P DS+M WY +LESGKFWFPAQVYNRE+GHVGFMLSCYDA + YD +T
Sbjct  188  RIDGGSKTKNPLPDDSIMSWYQSLESGKFWFPAQVYNREHGHVGFMLSCYDAAVRYDCQT  247

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTFHARYPPHGR    +E GV WDRLR P V+ PAHDLHISDCL DLRPGDHIEIQWRR+
Sbjct  248  DTFHARYPPHGRRTTVVEEGVQWDRLRPPPVETPAHDLHISDCLDDLRPGDHIEIQWRRS  307

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            K+FPYGWWYGVVGHLE CDGN+H+C CH
Sbjct  308  KEFPYGWWYGVVGHLEPCDGNEHFCWCH  335



>gb|KJB55449.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=400

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 126/151 (83%), Gaps = 3/151 (2%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF ARYPPHGR
Sbjct  201  PDDSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFKARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FPYGWWYGVV
Sbjct  261  RAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPYGWWYGVV  320

Query  291  GHLETCDGNQHYCRCHE---CVLQKSGLGAG  208
            GHLE+CDGN +YCRCH     VL+ +   AG
Sbjct  321  GHLESCDGNDNYCRCHNSDTVVLEFNQYTAG  351



>ref|XP_004513967.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=404

 Score =   242 bits (617),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
             +K+ N  P+DS+M WYLA+E+G FWFPAQVYNRENGHVGFMLSCYDAE+SYD R DTF 
Sbjct  197  SNKQKNSLPVDSLMNWYLAIETGTFWFPAQVYNRENGHVGFMLSCYDAEISYDSRVDTFL  256

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR A A E G+ W+RLRAP VD   HDLHISDCL DL PGDHIEIQWRRNK+FP
Sbjct  257  ARYPPHGRRADARECGIPWERLRAPPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFP  316

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+C+GN+++CRCH
Sbjct  317  YGWWYGVVGHLESCNGNENHCRCH  340



>gb|KJB35713.1| hypothetical protein B456_006G125100 [Gossypium raimondii]
Length=397

 Score =   241 bits (616),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P +    K+++LP  +S+M W+LALE+G+F FPAQVYNRENGHVGFMLSCYDAEL YD R
Sbjct  186  PKVDDCSKQSSLPR-ESIMSWFLALETGRFCFPAQVYNRENGHVGFMLSCYDAELCYDQR  244

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARYPPHGR AVAIE  V W+R+RAP VD   HDLHISDCL +LRPGDHIEIQWRR
Sbjct  245  TDTFQARYPPHGRRAVAIENNVPWERIRAPPVDTSPHDLHISDCLNELRPGDHIEIQWRR  304

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+FPYGWWYGVVGHL +CDGN++YCRCH
Sbjct  305  NKEFPYGWWYGVVGHLASCDGNENYCRCH  333



>ref|XP_010557458.1| PREDICTED: F-box protein At2g32560 [Tarenaya hassleriana]
Length=403

 Score =   241 bits (616),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDP +DTF ARYPPHGR
Sbjct  204  PVDSIMNWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPHSDTFQARYPPHGR  263

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA+E GVTW+RLRA  +D   H LH+SDCL +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  264  RAVAVEKGVTWERLRAQPIDASPHHLHVSDCLNELKPGDHIEIQWRRNKEFPYGWWYGVV  323

Query  291  GHLETCDGNQHYCRCH  244
            GHL++CDGN+++C CH
Sbjct  324  GHLDSCDGNENHCHCH  339



>ref|XP_004291727.1| PREDICTED: F-box protein At2g32560 isoform X1 [Fragaria vesca 
subsp. vesca]
 ref|XP_011459458.1| PREDICTED: F-box protein At2g32560 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=354

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            +SVM WYLAL +G+FWFPAQVYNRENGHVGF+LSCYDAEL YDPR D+F ARYPPHGR A
Sbjct  157  NSVMSWYLALTTGRFWFPAQVYNRENGHVGFVLSCYDAELCYDPRNDSFQARYPPHGRRA  216

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            VAIE  V W+RLRAP VD   HDLHISDCL DLRPGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  217  VAIENCVPWERLRAPPVDTLPHDLHISDCLNDLRPGDHIEIQWRRNKEFPYGWWYGVVGH  276

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+ YC CH
Sbjct  277  LESCDGNETYCICH  290



>gb|KDO54747.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=356

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>ref|XP_003567352.1| PREDICTED: F-box protein At2g32560-like [Brachypodium distachyon]
Length=411

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPID-SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P    G  ++  P +D SVM WYL +ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD 
Sbjct  198  PRADGGAGKSAGPVLDDSVMSWYLHMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDF  257

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
             TDTF ARYPPHGR  V +E GV WDR+RAP VD  AHDLH+SDCL++LRPGD IEIQWR
Sbjct  258  HTDTFRARYPPHGRRTVVLEDGVQWDRVRAPPVDTLAHDLHVSDCLHELRPGDSIEIQWR  317

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGVVGHLE+CDGN+H+CRCH
Sbjct  318  RNKEFPYGWWYGVVGHLESCDGNEHFCRCH  347



>ref|XP_010045084.1| PREDICTED: F-box protein At2g32560-like [Eucalyptus grandis]
 gb|KCW87237.1| hypothetical protein EUGRSUZ_B03749 [Eucalyptus grandis]
Length=389

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 133/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  687  NLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRT  508
            N+G  D+  +LP   SVM WY+ALE+G+FWFPAQVYNRENGH GF+LSCYDAELSYD RT
Sbjct  179  NIGQ-DQTCSLPYDSSVMSWYIALETGRFWFPAQVYNRENGHAGFLLSCYDAELSYDFRT  237

Query  507  DTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRN  328
            DTF ARYPPHGR A+A+ETGVTW+RLR+P VD   HDLH+SDCL DL PGDH+EIQWRRN
Sbjct  238  DTFRARYPPHGRRAMALETGVTWERLRSPQVDTSPHDLHLSDCLKDLCPGDHVEIQWRRN  297

Query  327  KKFPYGWWYGVVGHLETCDGNQHYCRCHE---CVLQKSGLGAG  208
            K+FPYGWWYGVVGHLE+C+ N+ YCRC      VL+ +   AG
Sbjct  298  KEFPYGWWYGVVGHLESCNRNESYCRCSSSGAVVLEFNQYSAG  340



>ref|XP_006446322.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59562.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=356

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>tpg|DAA54206.1| TPA: cyclin-like F-box [Zea mays]
Length=404

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDA LSYD  TDTF ARYPPHGR  
Sbjct  207  DSIMSWYLSVESGKFWFPAQVYNREHGHVGFMMSCYDAALSYDFHTDTFRARYPPHGRRT  266

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP VD  AHDLH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  267  VVLEDGVQWDRVRAPPVDTLAHDLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGH  326

Query  285  LETCDGNQHYCRCH  244
            LE+CDG++H+CRCH
Sbjct  327  LESCDGSEHFCRCH  340



>gb|KDO54746.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=351

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>gb|KHN28192.1| F-box protein [Glycine soja]
Length=399

 Score =   239 bits (609),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 124/150 (83%), Gaps = 6/150 (4%)
 Frame = -1

Query  675  GDKRNNLP------PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
             D  NN P      P+DSVM WYLALESG FWF AQVYNRENGH+GF+LSCYDAELSYDP
Sbjct  186  ADANNNSPKQGSSLPVDSVMNWYLALESGNFWFLAQVYNRENGHIGFLLSCYDAELSYDP  245

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARYPPHGR A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWR
Sbjct  246  QTDTFQARYPPHGRRAGARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWR  305

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGVVGHLE+C+G+++YCRCH
Sbjct  306  RNKEFPYGWWYGVVGHLESCNGSENYCRCH  335



>ref|XP_003529497.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=399

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 124/150 (83%), Gaps = 6/150 (4%)
 Frame = -1

Query  675  GDKRNNLP------PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
             D  NN P      P+DSVM WYLALESG FWF AQVYNRENGH+GF+LSCYDAELSYDP
Sbjct  186  ADANNNSPKQGSSLPVDSVMNWYLALESGNFWFLAQVYNRENGHIGFLLSCYDAELSYDP  245

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARYPPHGR A A E G+ W+RLRAP +D   HDLH SDCL DL PGDHIEIQWR
Sbjct  246  QTDTFQARYPPHGRRAGARECGIPWERLRAPPIDTSPHDLHFSDCLNDLYPGDHIEIQWR  305

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGVVGHLE+C+G+++YCRCH
Sbjct  306  RNKEFPYGWWYGVVGHLESCNGSENYCRCH  335



>gb|KDO54745.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=405

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>ref|XP_006446321.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59561.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=405

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 120/138 (87%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>ref|XP_009393902.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   238 bits (608),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 124/147 (84%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            + +G+K  +  P DS+M WY +LESGK WFPAQVYNRE+GHVGFMLSCYDAE+SYD  TD
Sbjct  189  IDSGNKHKSPLPDDSIMSWYRSLESGKLWFPAQVYNREHGHVGFMLSCYDAEVSYDCSTD  248

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TFHARYPPHGR  + +E GV WDRLRAP V+ PA+DLHISDCL DLR GDHIEIQWRRNK
Sbjct  249  TFHARYPPHGRRMMIMEEGVQWDRLRAPPVNTPAYDLHISDCLSDLRAGDHIEIQWRRNK  308

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FPYGWWYGV+GHLE+CDGN+  C CH
Sbjct  309  EFPYGWWYGVIGHLESCDGNELLCHCH  335



>ref|XP_009420968.1| PREDICTED: F-box protein At2g32560-like [Musa acuminata subsp. 
malaccensis]
Length=443

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 124/146 (85%), Gaps = 1/146 (1%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
            G    R+ LP  DS+M WY +LESG FWFPAQVYNRE+GHVGFMLSCYDAE+ YD +T++
Sbjct  235  GGCQNRSPLPD-DSIMSWYRSLESGGFWFPAQVYNREHGHVGFMLSCYDAEVRYDRQTNS  293

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            FHARYPPHGR  + +E GV WDRLRAP V+ P HDLHISDCL DLRPG+HIEIQWRRNK+
Sbjct  294  FHARYPPHGRRTIVVEEGVQWDRLRAPPVNTPPHDLHISDCLSDLRPGNHIEIQWRRNKE  353

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYGV+GHLE+C+GN+HYC CH
Sbjct  354  FPYGWWYGVIGHLESCNGNEHYCSCH  379



>dbj|BAJ88045.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04065.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=406

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M  YL +ESGKFWFPAQVYNRE+GHVGFM+SCYDAE+SYD RTDTFHARYPPHGR  
Sbjct  209  DSIMSCYLHMESGKFWFPAQVYNREHGHVGFMMSCYDAEVSYDFRTDTFHARYPPHGRRT  268

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV W+R+RAP V+  AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGH
Sbjct  269  VVLEDGVQWERVRAPPVETLAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGH  328

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+H+CRCH
Sbjct  329  LESCDGNEHFCRCH  342



>ref|XP_007146143.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 ref|XP_007146144.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 gb|ESW18137.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
 gb|ESW18138.1| hypothetical protein PHAVU_006G015900g [Phaseolus vulgaris]
Length=398

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            KR++LP +DS+M WYLA++SG F FPAQVYNRENGHVGFMLSCYDAE+SYDPRTDTF AR
Sbjct  194  KRSSLP-VDSIMNWYLAIDSGNFCFPAQVYNRENGHVGFMLSCYDAEISYDPRTDTFQAR  252

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHGR A A E G+ W+RLRAP +D   HDLHIS+CL DL PGDHIEIQWRRNK+FPYG
Sbjct  253  YPPHGRRADARECGIPWERLRAPPIDASPHDLHISECLNDLYPGDHIEIQWRRNKEFPYG  312

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE+C+G+++YCRCH
Sbjct  313  WWYGVVGHLESCNGSENYCRCH  334



>ref|NP_001042756.1| Os01g0281000 [Oryza sativa Japonica Group]
 dbj|BAA87845.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB00648.2| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAB17744.1| OSJNBa0036E02.18 [Oryza sativa Japonica Group]
 dbj|BAB44118.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04670.1| Os01g0281000 [Oryza sativa Japonica Group]
 dbj|BAG89293.1| unnamed protein product [Oryza sativa Japonica Group]
Length=415

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 125/146 (86%), Gaps = 0/146 (0%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
            G+G K       DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DT
Sbjct  206  GSGGKSAGPVLDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDT  265

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYPPHGR  V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+
Sbjct  266  FRARYPPHGRRTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKE  325

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYGVVGHLE+CDG++H+CRCH
Sbjct  326  FPYGWWYGVVGHLESCDGSEHFCRCH  351



>ref|NP_001151624.1| cyclin-like F-box [Zea mays]
 gb|ACG43557.1| cyclin-like F-box [Zea mays]
Length=407

 Score =   237 bits (605),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDA LSYD  TDTF ARYPPHGR  
Sbjct  210  DSIMSWYLSVESGKFWFPAQVYNREHGHVGFMMSCYDAALSYDLHTDTFRARYPPHGRRT  269

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP VD  AH LH SDCL++LRPGDHIEIQWRRNK+FPYGWWYGVVGH
Sbjct  270  VVLEDGVQWDRVRAPPVDTLAHYLHTSDCLHELRPGDHIEIQWRRNKEFPYGWWYGVVGH  329

Query  285  LETCDGNQHYCRCH  244
            LE+CDG++H+CRCH
Sbjct  330  LESCDGSEHFCRCH  343



>ref|XP_001785923.1| predicted protein [Physcomitrella patens]
 gb|EDQ49265.1| predicted protein [Physcomitrella patens]
Length=307

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = -1

Query  657  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            +PP+DS+M WY ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD  TD+F ARYPPH
Sbjct  106  VPPLDSLMAWYWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRITDSFKARYPPH  165

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            G   + IE GV W+RLRAP +D PAHDLH SDCL +L+PGDH+E+QWRRNK+FPYGWWYG
Sbjct  166  GPRTIVIEEGVRWERLRAPPLDTPAHDLHQSDCLIELQPGDHVEVQWRRNKEFPYGWWYG  225

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGH E CDGN  +CRCH
Sbjct  226  VVGHSEACDGNSRHCRCH  243



>emb|CDM82916.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   237 bits (604),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DS+M WYL LESGK WFPAQVYNRE+GHVGFM+SCYDAELSYD RTDTFHARYPPHGR  
Sbjct  206  DSIMSWYLHLESGKLWFPAQVYNREHGHVGFMMSCYDAELSYDFRTDTFHARYPPHGRRT  265

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
            V +E GV WDR+RAP V   AHDLH SDCL++LRPG +IEIQWRRNK+FPYGWWYGVVGH
Sbjct  266  VVLEDGVQWDRVRAPPVGTLAHDLHASDCLHELRPGANIEIQWRRNKEFPYGWWYGVVGH  325

Query  285  LETCDGNQHYCRCH  244
            LE+CDGN+H+CRC+
Sbjct  326  LESCDGNEHFCRCY  339



>gb|KDO53603.1| hypothetical protein CISIN_1g040396mg, partial [Citrus sinensis]
Length=226

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY PHGR
Sbjct  29   PVDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSPHGR  88

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  ++WDRLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  89   RMV--EENISWDRLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVV  146

Query  291  GHLETCDGNQHYCRC  247
            GHLE+C  N+H+C C
Sbjct  147  GHLESCGRNEHHCLC  161



>ref|XP_006644069.1| PREDICTED: F-box protein At2g32560-like [Oryza brachyantha]
Length=195

 Score =   227 bits (579),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -1

Query  636  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  457
            M  YL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  TDTF ARYPPHGR  V +
Sbjct  1    MSCYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHTDTFRARYPPHGRRTVVL  60

Query  456  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  277
            E GV WDR+RAP V+  AHDLH+SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+
Sbjct  61   EDGVQWDRVRAPPVNTHAHDLHVSDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLES  120

Query  276  CDGNQHYCRCH  244
            CDG++H+CRCH
Sbjct  121  CDGSEHFCRCH  131



>ref|XP_006470522.1| PREDICTED: F-box protein At2g32560-like [Citrus sinensis]
Length=405

 Score =   234 bits (596),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 119/138 (86%), Gaps = 2/138 (1%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGF+LSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFILSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV  +RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYGWWYG
Sbjct  264  GRRPIAIECGVPRERLRAAAVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGWWYG  323

Query  297  VVGHLETCDGNQHYCRCH  244
            VVGHLE+CDGN+++C CH
Sbjct  324  VVGHLESCDGNENFCHCH  341



>gb|ABR18151.1| unknown [Picea sitchensis]
Length=395

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 120/149 (81%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P +  G K  N PP DSVM WYLALESGKFWFPAQVYNRE GHVGFMLSCYDAELSYD R
Sbjct  185  PEINRGGK--NGPPSDSVMAWYLALESGKFWFPAQVYNRERGHVGFMLSCYDAELSYDRR  242

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARYPPHG   + +E GV W+RLRAP VD  AHDLH SDCL DL PGDH+EIQWRR
Sbjct  243  TDTFQARYPPHGHRKIVVEEGVQWERLRAPPVDTTAHDLHPSDCLNDLCPGDHVEIQWRR  302

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+FPYGWWYGVVGH + CD +  +C+CH
Sbjct  303  NKEFPYGWWYGVVGHSDYCDRDSRHCQCH  331



>ref|XP_009148635.1| PREDICTED: F-box protein At2g32560-like [Brassica rapa]
Length=376

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  177  PLDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFQARYPPHGR  236

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA+E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  237  RAVAVEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIV  296

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN ++C CH
Sbjct  297  GHLESCDGNLNHCHCH  312



>ref|XP_006482074.1| PREDICTED: F-box protein At2g32560-like [Citrus sinensis]
Length=382

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/135 (77%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY PHGR
Sbjct  185  PVDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSPHGR  244

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  ++WDRLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  245  RMV--EENISWDRLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVV  302

Query  291  GHLETCDGNQHYCRC  247
            GHLE+C  N+H+C C
Sbjct  303  GHLESCGRNEHHCLC  317



>emb|CAN78683.1| hypothetical protein VITISV_043889 [Vitis vinifera]
Length=364

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 123/169 (73%), Gaps = 33/169 (20%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WYLALE+G+FWFPAQVYNRE+GHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  132  PVDSIMSWYLALETGRFWFPAQVYNRESGHVGFMLSCYDAELSYDSHTDTFQARYPPHGR  191

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY-------  313
              VAIE GV+WDRLRAP V+ P HDLH+SDCL +L PGDHIEIQWRRNK+FPY       
Sbjct  192  RTVAIENGVSWDRLRAPPVETPPHDLHMSDCLNELHPGDHIEIQWRRNKEFPYDTSLFFL  251

Query  312  --------------------------GWWYGVVGHLETCDGNQHYCRCH  244
                                      GWWYG+VGHLE+CDGN+ YCRCH
Sbjct  252  YFLFVIFNPGWWEVDSLLDMRCYDIAGWWYGIVGHLESCDGNESYCRCH  300



>emb|CDY30036.1| BnaC05g09840D [Brassica napus]
Length=374

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  175  PLDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFKARYPPHGR  234

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA+E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  235  RAVAVEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIV  294

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN ++C CH
Sbjct  295  GHLESCDGNLNHCHCH  310



>ref|XP_006430547.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
 gb|ESR43787.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
Length=394

 Score =   231 bits (589),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY PHGR
Sbjct  185  PVDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSPHGR  244

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  ++W+RLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  245  RMV--EENISWERLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVV  302

Query  291  GHLETCDGNQHYCRC  247
            GHLE+C  N+H+C C
Sbjct  303  GHLESCGRNEHHCLC  317



>ref|XP_001775579.1| predicted protein [Physcomitrella patens]
 gb|EDQ59526.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   228 bits (582),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -1

Query  663  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  484
            + +PP DS+M WY ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD RTDTF ARYP
Sbjct  105  SAIPPPDSLMAWYWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRRTDTFKARYP  164

Query  483  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  304
            PHG+    +E GV W+RLRAP V+ PAHDLH SDCL DL+PGD +E+QWRRNK FPYGWW
Sbjct  165  PHGQRTAVVEEGVQWERLRAPPVETPAHDLHQSDCLADLKPGDCVEVQWRRNKDFPYGWW  224

Query  303  YGVVGHLETCDGNQHYCRCH  244
            YGVVGH E C+G+  +CRC+
Sbjct  225  YGVVGHSEGCEGSSRHCRCY  244



>ref|XP_006430546.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
 gb|ESR43786.1| hypothetical protein CICLE_v10011910mg [Citrus clementina]
Length=382

 Score =   231 bits (588),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 118/135 (87%), Gaps = 2/135 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M WY++LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD RTDTF ARY PHGR
Sbjct  185  PVDSIMAWYVSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSRTDTFRARYSPHGR  244

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  ++W+RLRAP VD P+H LH SDCL+DL+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  245  RMV--EENISWERLRAPAVDTPSHVLHNSDCLHDLKPGDHIEIQWRRNKEFPYGWWYGVV  302

Query  291  GHLETCDGNQHYCRC  247
            GHLE+C  N+H+C C
Sbjct  303  GHLESCGRNEHHCLC  317



>ref|XP_001777099.1| predicted protein [Physcomitrella patens]
 gb|EDQ58092.1| predicted protein [Physcomitrella patens]
Length=322

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            L   ++   +PP DS+M WY ALESG FWFPAQVYNRENGHVGFMLSCYDAEL+YD +TD
Sbjct  112  LNLQNQTPAVPPPDSLMAWYWALESGSFWFPAQVYNRENGHVGFMLSCYDAELNYDRQTD  171

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
             F ARYPPHG+    +E GV W+RLRAP VD PA  LH SDCL DL+PGDH+E+QWRRNK
Sbjct  172  AFKARYPPHGQRTAVVEEGVQWERLRAPPVDTPAQVLHQSDCLADLQPGDHVEVQWRRNK  231

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
             FPYGWWYGVVGH E C+GN  +CRCH
Sbjct  232  DFPYGWWYGVVGHSEACEGNTRHCRCH  258



>ref|XP_010469573.1| PREDICTED: F-box protein At2g32560-like [Camelina sativa]
Length=370

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  172  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDRLRA  +D   H LH+SD L +LRPGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  232  RAAAVEKGVTWDRLRAAPIDASPHHLHVSDSLKELRPGDHIEIQWRRNKEFPYGWWYGVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C CH
Sbjct  292  GHLESCDGDLNHCHCH  307



>ref|XP_006294453.1| hypothetical protein CARUB_v10023466mg [Capsella rubella]
 gb|EOA27351.1| hypothetical protein CARUB_v10023466mg [Capsella rubella]
Length=370

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  172  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDRLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  232  RAAAVEKGVTWDRLRAAPIDASPHHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C CH
Sbjct  292  GHLESCDGDLNHCHCH  307



>ref|XP_010509997.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
 ref|XP_010509998.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
 ref|XP_010509999.1| PREDICTED: F-box protein At2g32560 [Camelina sativa]
Length=370

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  172  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDRLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  232  RAAAVEKGVTWDRLRAAPIDASPHHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C CH
Sbjct  292  GHLESCDGDLNHCHCH  307



>ref|XP_010112861.1| F-box protein [Morus notabilis]
 gb|EXC34984.1| F-box protein [Morus notabilis]
Length=327

 Score =   228 bits (580),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 119/149 (80%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P +    K     P+DSVM WYL+LESGKFWFPAQVYNRENGH+GFMLSCYDA+LSYD R
Sbjct  116  PKIEKNSKVRTNLPVDSVMAWYLSLESGKFWFPAQVYNRENGHIGFMLSCYDAQLSYDSR  175

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY PHGR     E  + WDRLRAP +D P   LH SDCL+DL+PGDHIEIQWRR
Sbjct  176  TDTFQARYSPHGRRTA--EENIGWDRLRAPPIDTPPFMLHASDCLHDLKPGDHIEIQWRR  233

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+ PYGWWYG+VGHLE CDGN+++CRC+
Sbjct  234  NKECPYGWWYGLVGHLEPCDGNENHCRCY  262



>emb|CDY34614.1| BnaC08g41730D [Brassica napus]
Length=374

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            GD++    P+DS M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF 
Sbjct  167  GDRQKKALPVDSTMSFYVSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQ  226

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR AV +E GVTW+RLRA  ++   H LH+S+ L +L+PGDHIEIQWRRNK+FP
Sbjct  227  ARYPPHGRRAVGVEKGVTWERLRAAPLEASPHHLHLSESLNELKPGDHIEIQWRRNKEFP  286

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYG+VGHLE+CDG+ ++C CH
Sbjct  287  YGWWYGIVGHLESCDGDLNHCHCH  310



>ref|XP_006417291.1| hypothetical protein EUTSA_v10007953mg [Eutrema salsugineum]
 gb|ESQ35644.1| hypothetical protein EUTSA_v10007953mg [Eutrema salsugineum]
Length=375

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  176  PLDSTMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  235

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              VAIE GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  236  RPVAIEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIV  295

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN  +C CH
Sbjct  296  GHLESCDGNLDHCHCH  311



>emb|CDY34820.1| BnaA09g47460D [Brassica napus]
Length=375

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            L  GD++    P+DS M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TD
Sbjct  165  LRDGDRQRKALPVDSTMSFYISLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTD  224

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TF ARYPPHGR AV +E GVTW+RLRA  ++   H LH+S+ L  L+PGDHIEIQWRRNK
Sbjct  225  TFQARYPPHGRRAVGVEKGVTWERLRAAPLEASPHHLHVSESLNQLKPGDHIEIQWRRNK  284

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FPYGWWYG+VGHLE+CDG+ ++C CH
Sbjct  285  EFPYGWWYGIVGHLESCDGDLNHCHCH  311



>ref|XP_009118163.1| PREDICTED: F-box protein At2g32560-like [Brassica rapa]
Length=374

 Score =   228 bits (580),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            L  GD++    P+DS M +Y++LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TD
Sbjct  164  LRDGDRQRKALPVDSTMSFYISLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTITD  223

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TF ARYPPHGR AV +E GVTW+RLRA  ++   H LH+S+ L  L+PGDHIEIQWRRNK
Sbjct  224  TFQARYPPHGRRAVGVEKGVTWERLRAAPLEASPHHLHVSESLNQLKPGDHIEIQWRRNK  283

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FPYGWWYG+VGHLE+CDG+ ++C CH
Sbjct  284  EFPYGWWYGIVGHLESCDGDLNHCHCH  310



>ref|XP_010413981.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Camelina 
sativa]
 ref|XP_010413982.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Camelina 
sativa]
Length=370

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  172  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDRLRA  +D   + LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  232  RAAAVEKGVTWDRLRAAPIDASPNHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C CH
Sbjct  292  GHLESCDGDLNHCHCH  307



>ref|XP_007028345.1| F-box family protein isoform 4 [Theobroma cacao]
 gb|EOY08847.1| F-box family protein isoform 4 [Theobroma cacao]
Length=393

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 124/154 (81%), Gaps = 3/154 (2%)
 Frame = -1

Query  690  PNL-GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            PNL G+  +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD 
Sbjct  184  PNLEGSSSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDS  243

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWR
Sbjct  244  KTDTFQARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWR  301

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCHECVL  232
            RNK+FPYGWWYGVVGHLE+CDG +++CRC   V+
Sbjct  302  RNKEFPYGWWYGVVGHLESCDGAENHCRCQYTVI  335



>ref|XP_007028342.1| F-box family protein isoform 1 [Theobroma cacao]
 ref|XP_007028344.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY08844.1| F-box family protein isoform 1 [Theobroma cacao]
 gb|EOY08846.1| F-box family protein isoform 1 [Theobroma cacao]
Length=395

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 122/150 (81%), Gaps = 3/150 (2%)
 Frame = -1

Query  690  PNL-GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            PNL G+  +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD 
Sbjct  184  PNLEGSSSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDS  243

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWR
Sbjct  244  KTDTFQARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWR  301

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGVVGHLE+CDG +++CRC 
Sbjct  302  RNKEFPYGWWYGVVGHLESCDGAENHCRCQ  331



>ref|XP_002880840.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57099.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=371

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = -1

Query  684  LGAGDKRNNLP---PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            LG  + R   P   P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD 
Sbjct  158  LGDDNHRRRYPSSIPLDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDT  217

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
             T+TF ARYPPHGR A+AIE  VTW+R+RA  +D   H L++SD L +L+PGDHIEIQWR
Sbjct  218  HTNTFQARYPPHGRRAIAIEKDVTWERIRAAPIDASPHHLYVSDSLNELKPGDHIEIQWR  277

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWY VVGHLE+CDGN ++C+CH
Sbjct  278  RNKEFPYGWWYSVVGHLESCDGNLNHCQCH  307



>gb|EEC70414.1| hypothetical protein OsI_01411 [Oryza sativa Indica Group]
Length=382

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
            G+G K       DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DT
Sbjct  183  GSGGKSAGPVLDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDT  242

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYPPHGR  V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+
Sbjct  243  FRARYPPHGRRTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKE  302

Query  321  FPYGWWYGVVGHLETCDGN  265
            FPYGWWYGVVGHLE+CDGN
Sbjct  303  FPYGWWYGVVGHLESCDGN  321



>ref|XP_008240697.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Prunus mume]
Length=396

 Score =   226 bits (575),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = -1

Query  690  PNLGAGD-KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P L   D K     P++SVM  Y++LESGKFWFPAQVYNRENG+VGFMLSCYDA++SYD 
Sbjct  185  PKLATSDCKARTSLPVESVMSLYISLESGKFWFPAQVYNRENGNVGFMLSCYDAQVSYDS  244

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            RT+TF ARY P+GR A   E  + WDRLRA  VD P+H LH++DCL+DL+PGDHIEIQWR
Sbjct  245  RTNTFQARYSPYGRRAT--EDNIPWDRLRAAPVDTPSHKLHVTDCLHDLKPGDHIEIQWR  302

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGV+GHLE CDG++++CRCH
Sbjct  303  RNKEFPYGWWYGVIGHLELCDGHENHCRCH  332



>ref|XP_010413980.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Camelina 
sativa]
Length=409

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 102/136 (75%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  211  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  270

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDRLRA  +D   + LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  271  RAAAVEKGVTWDRLRAAPIDASPNHLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVV  330

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C CH
Sbjct  331  GHLESCDGDLNHCHCH  346



>gb|EEE54342.1| hypothetical protein OsJ_01321 [Oryza sativa Japonica Group]
Length=382

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
            G+G K       DS+M WYL++ESGKFWFPAQVYNRE+GHVGFM+SCYDAELSYD  +DT
Sbjct  183  GSGGKSAGPVLDDSIMSWYLSMESGKFWFPAQVYNREHGHVGFMMSCYDAELSYDFHSDT  242

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYPPHGR  V +E GV WDR+RAP VD  AHDLH SDCL++LRPGD+IEIQWRRNK+
Sbjct  243  FRARYPPHGRRTVVLEDGVHWDRVRAPPVDTHAHDLHASDCLHELRPGDNIEIQWRRNKE  302

Query  321  FPYGWWYGVVGHLETCDGN  265
            FPYGWWYGVVGHLE+CDGN
Sbjct  303  FPYGWWYGVVGHLESCDGN  321



>ref|XP_007202057.1| hypothetical protein PRUPE_ppa006765mg [Prunus persica]
 gb|EMJ03256.1| hypothetical protein PRUPE_ppa006765mg [Prunus persica]
Length=396

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 123/150 (82%), Gaps = 3/150 (2%)
 Frame = -1

Query  690  PNLGAGD-KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P L + D K     P++SVM  YL+LESGKFWFPAQVYNRENG+VGFMLSCYDA++SYD 
Sbjct  185  PKLPSSDCKVRTSLPVESVMSLYLSLESGKFWFPAQVYNRENGNVGFMLSCYDAQVSYDS  244

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            RT+TF ARY P+GR A   E  + WDRLRA  VD P+H LH+SDCL+DL+PGDHIEIQWR
Sbjct  245  RTNTFQARYSPYGRRAT--EDNIPWDRLRAAPVDTPSHKLHVSDCLHDLKPGDHIEIQWR  302

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            RNK+FPYGWWYGV+GHLE CDG+++ CRCH
Sbjct  303  RNKEFPYGWWYGVIGHLELCDGHENRCRCH  332



>ref|NP_850191.1| F-box protein [Arabidopsis thaliana]
 sp|Q8RY82.1|FB121_ARATH RecName: Full=F-box protein At2g32560 [Arabidopsis thaliana]
 gb|AAL69504.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20109.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62789.1| unknown [Arabidopsis thaliana]
 gb|AEC08700.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  173  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  232

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A AIE GVTWDR+RA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  233  RASAIEKGVTWDRIRAAPIDASPHLLHVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGLV  292

Query  291  GHLETCDGNQHYCRCH  244
             HLE+CDG+ ++C CH
Sbjct  293  RHLESCDGDHNHCHCH  308



>emb|CDX98095.1| BnaA06g08460D [Brassica napus]
Length=372

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+ S M + L+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  173  PLYSTMSFCLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTLTDTFLARYPPHGR  232

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             AVA+E GVTW+RLRA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYGWWYG+V
Sbjct  233  RAVAVEKGVTWERLRAAPIDASPHHLHVSDSLNELKPGDHIEIQWRRNKEFPYGWWYGIV  292

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDGN ++C CH
Sbjct  293  GHLESCDGNLNHCHCH  308



>ref|NP_180253.2| F-box protein [Arabidopsis thaliana]
 sp|Q6NLB1.1|FB118_ARATH RecName: Full=F-box protein At2g26850 [Arabidopsis thaliana]
 gb|AAS76708.1| At2g26850 [Arabidopsis thaliana]
 gb|AAS92339.1| At2g26850 [Arabidopsis thaliana]
 gb|AEC07898.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  T+TF ARYPPHG+
Sbjct  172  PLDSTMNFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTDTNTFQARYPPHGK  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A+A+E  VTW+R+RA  VD   H+L++SD L +L+PGDHIEIQWRRNK+FPYGWWY VV
Sbjct  232  RAIAVEKDVTWERIRAAPVDASPHNLYVSDSLNELKPGDHIEIQWRRNKEFPYGWWYSVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GH+E+CDGN ++C+CH
Sbjct  292  GHMESCDGNLNHCQCH  307



>ref|XP_002879398.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55657.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=370

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  172  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFLARYPPHGR  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A A+E GVTWDR+RA  +D   H L++SD L +L+PGDHIEIQWRRNK+FPYGWWYGVV
Sbjct  232  RAAAVEKGVTWDRIRAAPIDASPHHLYVSDSLKELKPGDHIEIQWRRNKEFPYGWWYGVV  291

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+CDG+ ++C C 
Sbjct  292  GHLESCDGDLNHCHCQ  307



>ref|XP_002522176.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40217.1| conserved hypothetical protein [Ricinus communis]
Length=353

 Score =   220 bits (560),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M  YL+LE GKFWFPAQVYNRENGHVGF+LSCYDA +SYD RTDTF ARY P+GR
Sbjct  133  PVDSIMAMYLSLEKGKFWFPAQVYNRENGHVGFLLSCYDALVSYDSRTDTFQARYSPYGR  192

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                IE G+ WDRLRA  VD PAHDLHISDCL+DL+PGDHIEIQWRR+  FPYGWWY +V
Sbjct  193  RM--IEDGIHWDRLRASPVDTPAHDLHISDCLHDLKPGDHIEIQWRRSNGFPYGWWYAIV  250

Query  291  GHLETCDGNQHYCRCH  244
            GH+E+CDGN+  C C 
Sbjct  251  GHIESCDGNESRCHCQ  266



>ref|XP_002307980.2| hypothetical protein POPTR_0006s03840g [Populus trichocarpa]
 gb|EEE91503.2| hypothetical protein POPTR_0006s03840g [Populus trichocarpa]
Length=373

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P   +  K     P+DS+M  YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD +
Sbjct  163  PKCESRSKPTTCLPVDSIMALYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSK  222

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY P  R    IE  + W+RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR
Sbjct  223  TDTFQARYSPFARQT--IEQSIHWERLRAPPVDTPAHVLHTSDCLNDLKPGDHIEIQWRR  280

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +K+FPYGWWY VVGH E CDGN++ CRC 
Sbjct  281  SKEFPYGWWYAVVGHQELCDGNENRCRCR  309



>gb|KEH33371.1| F-box plant-like protein [Medicago truncatula]
Length=335

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 118/136 (87%), Gaps = 1/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+++VM WYLA+E+G+FWFPAQVYNRENGH+GF+LSCYDAELSYD RT+TF ARYP HGR
Sbjct  137  PVEAVMNWYLAIETGRFWFPAQVYNRENGHLGFLLSCYDAELSYDSRTNTFLARYPSHGR  196

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
               A E G+ W+R+RAP VD   HDLHIS+CL DL PG+HIEIQWRR K+FPYGWWYGVV
Sbjct  197  RE-ARECGIPWERIRAPPVDISPHDLHISNCLNDLHPGNHIEIQWRRKKEFPYGWWYGVV  255

Query  291  GHLETCDGNQHYCRCH  244
            GHLE+C+ N+++CRCH
Sbjct  256  GHLESCNNNENHCRCH  271



>gb|KEH33372.1| F-box plant-like protein [Medicago truncatula]
Length=378

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 126/156 (81%), Gaps = 8/156 (5%)
 Frame = -1

Query  693  GPNLGAGD------KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDA  532
            G  L  GD       R++LP +++VM WYLA+E+G+FWFPAQVYNRENGH+GF+LSCYDA
Sbjct  183  GMKLKVGDGNDSCNHRSSLP-VEAVMNWYLAIETGRFWFPAQVYNRENGHLGFLLSCYDA  241

Query  531  ELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDH  352
            ELSYD RT+TF ARYP HGR   A E G+ W+R+RAP VD   HDLHIS+CL DL PG+H
Sbjct  242  ELSYDSRTNTFLARYPSHGRRE-ARECGIPWERIRAPPVDISPHDLHISNCLNDLHPGNH  300

Query  351  IEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            IEIQWRR K+FPYGWWYGVVGHLE+C+ N+++CRCH
Sbjct  301  IEIQWRRKKEFPYGWWYGVVGHLESCNNNENHCRCH  336



>gb|KHG29237.1| hypothetical protein F383_00101 [Gossypium arboreum]
Length=404

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = -1

Query  666  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  487
            +N    +DS+M WYLALE+G+F FPAQVYNRENGH GF+LSCYDA+LSYD +TDTF ARY
Sbjct  202  KNGGLAVDSIMAWYLALETGRFSFPAQVYNRENGHAGFLLSCYDAKLSYDSKTDTFQARY  261

Query  486  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  307
             PHGR     E  ++WDRLRAP VD  ++DLHISD L++L+PGDHIEIQWRRN++FPYGW
Sbjct  262  SPHGRRTT--EENISWDRLRAPPVDTCSYDLHISDSLFELKPGDHIEIQWRRNREFPYGW  319

Query  306  WYGVVGHLETCDGNQHYCRCHE  241
            WYGVVGH+E+C+GN+ +CRC +
Sbjct  320  WYGVVGHMESCNGNESHCRCQD  341



>ref|XP_010521562.1| PREDICTED: LOW QUALITY PROTEIN: hydroxymethylglutaryl-CoA lyase, 
mitochondrial [Tarenaya hassleriana]
Length=799

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 131/181 (72%), Gaps = 15/181 (8%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M  YLALE+ +FWFPAQV+NRENGHVGFMLSCYDAELSYDP TDTF ARY PHGR
Sbjct  230  PVDSIMNLYLALETDRFWFPAQVFNRENGHVGFMLSCYDAELSYDPHTDTFEARYTPHGR  289

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              VA+E GVTW+RLRAP +D   H LH+SDCL +L+PGDHIEIQWRRNK+FPYGWWYGV 
Sbjct  290  RVVAVEKGVTWERLRAPPLDTSPHHLHVSDCLNELKPGDHIEIQWRRNKEFPYGWWYGV-  348

Query  291  GHLETCDGNQHYCRCHECVLQKSGLGAG*SAPRH*AVGPLGVDLSLKAP*AVPRRLAIFS  112
               E+CDGN+++C CH  V   + + +           PLG D   K P     R+  FS
Sbjct  349  ---ESCDGNENHCHCHLSVSHFAAMSS--------LEEPLGFD---KLPRMTTDRIQRFS  394

Query  111  T  109
            +
Sbjct  395  S  395



>ref|XP_006646414.1| PREDICTED: F-box protein At2g26850-like [Oryza brachyantha]
Length=301

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            D+V  WY A+E G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  104  DTVAAWYRAVECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  163

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E+GV W R+RAP V  PAHDLH S CL +LRPGDH EIQWR+NK FPYGWWYGVVGH
Sbjct  164  AKEESGVQWSRIRAPPVSTPAHDLHASGCLGNLRPGDHFEIQWRKNKDFPYGWWYGVVGH  223

Query  285  LETCDGNQHYCRCHE  241
             ETC+ N H CRCHE
Sbjct  224  QETCNANDHLCRCHE  238



>gb|KDP29248.1| hypothetical protein JCGZ_16637 [Jatropha curcas]
Length=329

 Score =   217 bits (552),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M  YL+LE GKFWFPAQVYNRENGHVGF+LSCYDA++SYD RT+TF ARY P+GR
Sbjct  132  PVDSIMAMYLSLERGKFWFPAQVYNRENGHVGFLLSCYDAKISYDSRTNTFQARYSPYGR  191

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                IE  + WDRLRA  VD PAHDLHISDCL DL+PGDHIEIQWRR+K+FPYGWWY +V
Sbjct  192  RM--IEESIHWDRLRASPVDTPAHDLHISDCLDDLKPGDHIEIQWRRSKEFPYGWWYAIV  249

Query  291  GHLETCDGNQHYCRCH  244
            GH++ CDGN + C C 
Sbjct  250  GHIDPCDGNANLCNCQ  265



>emb|CDP09596.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
            ++RN+LP +DSV  WYLA+E+GKF FPAQVYNRENG VGFMLSCYDAELSYD  TDTF A
Sbjct  193  EQRNSLP-VDSVKAWYLAIETGKFRFPAQVYNRENGQVGFMLSCYDAELSYDSSTDTFIA  251

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RY   GR    IE  + W+R+RAP VD PAH LH+SDCL+DL+PGDHIE+QWRRN+ FPY
Sbjct  252  RYSAPGRRPT-IEDNIKWNRIRAPAVDIPAHVLHVSDCLHDLKPGDHIEVQWRRNRDFPY  310

Query  312  GWWYGVVGHLETCDGNQHYCRCH  244
            GWWYGVVGHLE+C G + +C+CH
Sbjct  311  GWWYGVVGHLESCTGQESHCQCH  333



>gb|KJB46204.1| hypothetical protein B456_007G352500 [Gossypium raimondii]
Length=392

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = -1

Query  666  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  487
            +N    +DS+M WYLALE+G+F FPAQVYNRENGH GF+LSCYDA+LSYD +TDTF ARY
Sbjct  202  KNGGLAVDSIMAWYLALETGRFSFPAQVYNRENGHAGFLLSCYDAKLSYDSKTDTFQARY  261

Query  486  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  307
             PH R     E  ++WDRLRAP VD  ++DLHIS+ L+DL+PGDHIEIQWRRN++FPYGW
Sbjct  262  SPHVRQTT--EQNISWDRLRAPPVDTCSYDLHISNSLFDLKPGDHIEIQWRRNREFPYGW  319

Query  306  WYGVVGHLETCDGNQHYCRCHE  241
            WYGVVGH+E+C+GN+++CRC +
Sbjct  320  WYGVVGHMESCNGNENHCRCQD  341



>ref|XP_006296486.1| hypothetical protein CARUB_v10025671mg [Capsella rubella]
 gb|EOA29384.1| hypothetical protein CARUB_v10025671mg [Capsella rubella]
Length=371

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            +DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAEL YD  T+ F ARYPPHGR 
Sbjct  173  LDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELCYDTHTNAFQARYPPHGRR  232

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A+A+E  V W+R+RA  +D   H LHISD L +++PGDHIEIQWRRNK+FPYGWWY VVG
Sbjct  233  AIAVEKDVPWERIRAAPIDASPHHLHISDSLREVKPGDHIEIQWRRNKEFPYGWWYSVVG  292

Query  288  HLETCDGNQHYCRCH  244
            HLE+CDGN +YC CH
Sbjct  293  HLESCDGNLNYCHCH  307



>gb|ACL53470.1| unknown [Zea mays]
 tpg|DAA57197.1| TPA: cyclin-like F-box [Zea mays]
Length=428

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
             D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCYDA L Y  RTDTF ARYPPHGR 
Sbjct  230  TDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCYDAHLRYHQRTDTFTARYPPHGRK  289

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A   E GV W+R+RAP +  PAHDLH SDCL +LRPGDH EIQWR+NK FPYGWWYGVVG
Sbjct  290  AAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRPGDHFEIQWRKNKDFPYGWWYGVVG  349

Query  288  HLETCDGNQHYCRCHE  241
            H E+C+GN+H CRCH+
Sbjct  350  HQESCNGNEHLCRCHQ  365



>ref|XP_010055882.1| PREDICTED: F-box protein At2g26850-like [Eucalyptus grandis]
 gb|KCW90030.1| hypothetical protein EUGRSUZ_A02233 [Eucalyptus grandis]
Length=395

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = -1

Query  690  PNLGAG-DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            PNL  G +K  +  P+DS+M  YL+LE+GKFWFPAQVYNRENGH GFMLSCYDA +SYD 
Sbjct  184  PNLECGSNKPRSDFPVDSIMCLYLSLENGKFWFPAQVYNRENGHSGFMLSCYDAHVSYDS  243

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            RTDTF ARY   GR  V  E  + WDRLRAP +  P H+LH SDCL DLRPGDHIEIQWR
Sbjct  244  RTDTFQARYSSPGRRTV--EENIPWDRLRAPPISTPPHELHNSDCLNDLRPGDHIEIQWR  301

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            ++K+FPYGWWYGVVGHLE+CDGN  +CRCH
Sbjct  302  KSKEFPYGWWYGVVGHLESCDGNGDHCRCH  331



>ref|NP_001147974.1| cyclin-like F-box precursor [Zea mays]
 gb|ACG29298.1| cyclin-like F-box [Zea mays]
 gb|ACG29718.1| cyclin-like F-box [Zea mays]
Length=428

 Score =   218 bits (556),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
             D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCYDA L Y  RTDTF ARYPPHGR 
Sbjct  230  TDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCYDAHLRYHQRTDTFTARYPPHGRK  289

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A   E GV W+R+RAP +  PAHDLH SDCL +LRPGDH EIQWR+NK FPYGWWYGVVG
Sbjct  290  AAKEEDGVQWNRVRAPPLATPAHDLHASDCLEELRPGDHFEIQWRKNKDFPYGWWYGVVG  349

Query  288  HLETCDGNQHYCRCHE  241
            H E+C+GN+H CRCH+
Sbjct  350  HQESCNGNEHLCRCHQ  365



>ref|XP_010417831.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            +DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYD  T+TF AR+PPHGR 
Sbjct  173  LDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAQLSYDTHTNTFQARFPPHGRR  232

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A+A+E  VTW+R+RA  +D   H L+ISD L +L+PGDHIEIQWRRNK+FPYGWWY VVG
Sbjct  233  AIAVEKDVTWERIRAAPIDASPHHLYISDSLKELKPGDHIEIQWRRNKEFPYGWWYSVVG  292

Query  288  HLETCDGNQHYCRCH  244
            HL++CDGN ++C CH
Sbjct  293  HLDSCDGNLNHCHCH  307



>ref|XP_010510850.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            +DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDA LSYD  T+TF AR+PPHGR 
Sbjct  173  LDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAHLSYDTHTNTFQARFPPHGRR  232

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A+A+E  VTW+R+RA  +D   H L+ISD L +L+PGDHIEIQWRRNK+FPYGWWY VVG
Sbjct  233  AIAVEKDVTWERIRATPIDASPHHLYISDSLKELKPGDHIEIQWRRNKEFPYGWWYSVVG  292

Query  288  HLETCDGNQHYCRCH  244
            HL++CDGN ++C+CH
Sbjct  293  HLDSCDGNLNHCQCH  307



>ref|NP_001044567.1| Os01g0806200 [Oryza sativa Japonica Group]
 dbj|BAD68058.1| F-box family protein-like [Oryza sativa Japonica Group]
 dbj|BAF06481.1| Os01g0806200 [Oryza sativa Japonica Group]
 dbj|BAG97148.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71668.1| hypothetical protein OsI_04131 [Oryza sativa Indica Group]
Length=427

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -1

Query  654  PPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG  475
            P  D+V  WY A+E G+F FPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHG
Sbjct  227  PATDTVAAWYRAVECGEFSFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHG  286

Query  474  RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGV  295
            R     E+GV W R+R+P V  PAHDLH S CL DLRPGDH EIQWR+NK FPYGWWYGV
Sbjct  287  RKPAKEESGVQWSRVRSPPVSTPAHDLHASGCLGDLRPGDHFEIQWRKNKDFPYGWWYGV  346

Query  294  VGHLETCDGNQHYCRCHE  241
            VGH ETC+ N+H CRCHE
Sbjct  347  VGHQETCNANEHLCRCHE  364



>ref|XP_010473070.1| PREDICTED: F-box protein At2g26850-like [Camelina sativa]
Length=371

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            +DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDA+LSYD  T+TF AR+PPHGR 
Sbjct  173  LDSTMSFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAQLSYDTHTNTFQARFPPHGRR  232

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A+A+E  VTW+R+RA  +D   H L+ISD L +L+PGDH+EIQWRRNK+FPYGWWY VVG
Sbjct  233  AIAVEKDVTWERIRAAPIDASPHHLYISDSLKELKPGDHVEIQWRRNKEFPYGWWYSVVG  292

Query  288  HLETCDGNQHYCRCH  244
            HL++CDGN ++C CH
Sbjct  293  HLDSCDGNLNHCHCH  307



>gb|ACN33240.1| unknown [Zea mays]
Length=428

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 111/136 (82%), Gaps = 0/136 (0%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
             D+V  WY ALE G+FWFPAQVYNRE+GHVGF+LSCYDA L Y  +TDTF ARYPPHGR 
Sbjct  230  TDTVAAWYRALECGEFWFPAQVYNREDGHVGFVLSCYDAHLRYHQQTDTFTARYPPHGRK  289

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A   E GV W+R+RAP +  PAHDLH SDCL +LRPGDH EIQWR+NK FPYGWWYGVVG
Sbjct  290  AAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRPGDHFEIQWRKNKDFPYGWWYGVVG  349

Query  288  HLETCDGNQHYCRCHE  241
            H E+C+GN+H CRCH+
Sbjct  350  HQESCNGNEHLCRCHQ  365



>ref|XP_011000416.1| PREDICTED: F-box protein At2g26850-like [Populus euphratica]
Length=394

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P   + +K     P+DS+M  YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD R
Sbjct  184  PQCESRNKPTTCLPVDSIMALYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSR  243

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY    R    IE  + WDRLRAP V+ PAH L+ SDCL DL+PGDHIEIQWRR
Sbjct  244  TDTFQARYSLFARRT--IEESIHWDRLRAPPVETPAHVLYTSDCLNDLKPGDHIEIQWRR  301

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +K+FPYGWWY VVGH E CDGN++ CRC 
Sbjct  302  SKEFPYGWWYAVVGHQELCDGNENRCRCR  330



>ref|XP_011027255.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Populus euphratica]
Length=346

 Score =   214 bits (545),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M  YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+L+YD +TDTF ARY P  R
Sbjct  178  PVDSIMALYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLNYDSKTDTFQARYSPFAR  237

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                IE  + W+RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VV
Sbjct  238  QT--IEQSIHWERLRAPPVDTPAHVLHPSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVV  295

Query  291  GHLETCDGNQHYCRCHECVLQ  229
            GH E CDGN++ C C   V +
Sbjct  296  GHQELCDGNENRCHCRHNVTE  316



>ref|XP_002323241.2| hypothetical protein POPTR_0016s03510g [Populus trichocarpa]
 gb|EEF05002.2| hypothetical protein POPTR_0016s03510g [Populus trichocarpa]
Length=372

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
            +K     P+DS+M  YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+LSYD +TDTF A
Sbjct  168  NKPTTCLPVDSIMALYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLSYDSKTDTFQA  227

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RY P  R    IE  +  DRLRAP V+ PAH LH SDCL DL+PGDHIEIQWRR+K+FPY
Sbjct  228  RYSPFARRT--IEESIHRDRLRAPPVETPAHVLHTSDCLNDLKPGDHIEIQWRRSKEFPY  285

Query  312  GWWYGVVGHLETCDGNQHYCRC  247
            GWWY VVGH E CDGN++ CRC
Sbjct  286  GWWYAVVGHQELCDGNENRCRC  307



>ref|XP_008387444.1| PREDICTED: F-box protein At2g26850-like [Malus domestica]
Length=393

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            +DS+M  YL+LE+GKFWFPAQVYNRENG+VGFMLSCYDA + YD  T+TF ARY P+GR 
Sbjct  197  VDSIMSLYLSLETGKFWFPAQVYNRENGNVGFMLSCYDARVRYDSTTNTFQARYSPYGRR  256

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
            A   E  + WDRLRA  VD P H LH+SDCL+DL+PGD+IEIQWRRNK+FPYGWWYGV+G
Sbjct  257  AT--EENIPWDRLRAAPVDTPPHKLHVSDCLHDLKPGDYIEIQWRRNKEFPYGWWYGVIG  314

Query  288  HLETCDGNQHYCRCH  244
            HLE CDGN++ CRCH
Sbjct  315  HLEFCDGNENGCRCH  329



>ref|XP_011027254.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Populus euphratica]
Length=375

 Score =   214 bits (545),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 111/135 (82%), Gaps = 2/135 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS+M  YL+LESGKFWFPAQVYNRENGHVGFMLSCYDA+L+YD +TDTF ARY P  R
Sbjct  178  PVDSIMALYLSLESGKFWFPAQVYNRENGHVGFMLSCYDAQLNYDSKTDTFQARYSPFAR  237

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                IE  + W+RLRAP VD PAH LH SDCL DL+PGDHIEIQWRR+K+FPYGWWY VV
Sbjct  238  QT--IEQSIHWERLRAPPVDTPAHVLHPSDCLNDLKPGDHIEIQWRRSKEFPYGWWYAVV  295

Query  291  GHLETCDGNQHYCRC  247
            GH E CDGN++ C C
Sbjct  296  GHQELCDGNENRCHC  310



>dbj|BAK00229.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            DSV  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  203  DSVAAWYRALECGDFWFPAQVYNREDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKP  262

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E GV W R+RA  +  PA DLH S CL DLRPGDH EIQWR+NK FPYGWWYGVVGH
Sbjct  263  AKEEEGVQWCRVRAAPLSTPAQDLHASGCLEDLRPGDHFEIQWRKNKDFPYGWWYGVVGH  322

Query  285  LETCDGNQHYCRCHE  241
            LE+C+ N+H CRCHE
Sbjct  323  LESCNANEHLCRCHE  337



>ref|XP_008672833.1| PREDICTED: cyclin-like F-box isoform X1 [Zea mays]
 tpg|DAA57196.1| TPA: hypothetical protein ZEAMMB73_495322 [Zea mays]
Length=429

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 1/137 (1%)
 Frame = -1

Query  648  IDSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
             D+V  WY ALE G+FWFPAQVYNRE +GHVGF+LSCYDA L Y  RTDTF ARYPPHGR
Sbjct  230  TDTVAAWYRALECGEFWFPAQVYNREQDGHVGFVLSCYDAHLRYHQRTDTFTARYPPHGR  289

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A   E GV W+R+RAP +  PAHDLH SDCL +LRPGDH EIQWR+NK FPYGWWYGVV
Sbjct  290  KAAKEEDGVKWNRVRAPPLATPAHDLHASDCLEELRPGDHFEIQWRKNKDFPYGWWYGVV  349

Query  291  GHLETCDGNQHYCRCHE  241
            GH E+C+GN+H CRCH+
Sbjct  350  GHQESCNGNEHLCRCHQ  366



>ref|XP_003624978.1| F-box protein [Medicago truncatula]
Length=382

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+   YL+LE+GKFWFPAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR
Sbjct  185  PDDSIAALYLSLENGKFWFPAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGR  244

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                 E  + W+RLR P +D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+
Sbjct  245  WTT--EENIKWERLRVPPIDSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVI  302

Query  291  GHLETCDGNQHYCRCHE  241
            GHLETC G+ ++C+CH+
Sbjct  303  GHLETCQGDGNHCQCHD  319



>gb|KHN30351.1| F-box protein [Glycine soja]
Length=267

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + ++  P DS+   YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF 
Sbjct  60   GTESSSSLPEDSIAALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFL  119

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY PHGR     E  + WDRLR P +    H LHISDCL DLRPGDHIEIQWRRNK+FP
Sbjct  120  ARYSPHGRWTT--EENIQWDRLRVPPIATSPHALHISDCLDDLRPGDHIEIQWRRNKEFP  177

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGV+GHLE C G+ ++C CH
Sbjct  178  YGWWYGVIGHLEQCQGHGNHCHCH  201



>gb|ABD33039.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81196.2| F-box plant-like protein [Medicago truncatula]
Length=394

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+   YL+LE+GKFWFPAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR
Sbjct  197  PDDSIAALYLSLENGKFWFPAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGR  256

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                 E  + W+RLR P +D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+
Sbjct  257  WTT--EENIKWERLRVPPIDSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVI  314

Query  291  GHLETCDGNQHYCRCHE---CVLQKSGLGAG  208
            GHLETC G+ ++C+CH+    +L+ +   AG
Sbjct  315  GHLETCQGDGNHCQCHDKDTVILEFTQYTAG  345



>gb|AFK37960.1| unknown [Medicago truncatula]
Length=394

 Score =   213 bits (541),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 117/151 (77%), Gaps = 5/151 (3%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+   YL+LE+GKFWFPAQVYNRENGH GF+LSCYDAEL YD RTDTF ARY PHGR
Sbjct  197  PDDSIAALYLSLENGKFWFPAQVYNRENGHAGFLLSCYDAELCYDSRTDTFQARYSPHGR  256

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                 E  + W+RLR P +D+ +H LHISDCL DL+PGDH+EIQWRRN +FPYGWWY V+
Sbjct  257  WTT--EENIKWERLRVPPIDSSSHVLHISDCLDDLKPGDHVEIQWRRNNEFPYGWWYSVI  314

Query  291  GHLETCDGNQHYCRCHE---CVLQKSGLGAG  208
            GHLETC G+ ++C+CH+    +L+ +   AG
Sbjct  315  GHLETCQGDGNHCQCHDKDTVILEFTQYTAG  345



>ref|XP_006411383.1| hypothetical protein EUTSA_v10016802mg [Eutrema salsugineum]
 gb|ESQ52836.1| hypothetical protein EUTSA_v10016802mg [Eutrema salsugineum]
Length=379

 Score =   212 bits (540),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 114/146 (78%), Gaps = 3/146 (2%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
            G+    +NL PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDT
Sbjct  172  GSSSSSSNLAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKVRYDCKTDT  231

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARY  HGR A   E  VTW RLR  L+D  + DLH+SDCL  LRPGDH EIQWRR K+
Sbjct  232  FQARYSAHGRRAA--EENVTWQRLRPSLIDTESRDLHVSDCLQGLRPGDHFEIQWRRTKE  289

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYG+VGHL+ CDG  + CRC+
Sbjct  290  FPYGWWYGIVGHLQNCDGEDN-CRCN  314



>gb|KHN08884.1| F-box protein [Glycine soja]
Length=333

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + N+    DS+   YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF 
Sbjct  126  GTQSNSSLSEDSIAALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFL  185

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY PHGR     E  + WDRLR P + +  H LHISDCL DLRPGDHIEIQWRRNK+FP
Sbjct  186  ARYSPHGRWTT--EENIQWDRLRVPPIASSPHALHISDCLDDLRPGDHIEIQWRRNKEFP  243

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGV+GHLE C G+ ++C CH
Sbjct  244  YGWWYGVIGHLEQCQGHGNHCHCH  267



>gb|EPS60658.1| hypothetical protein M569_14143, partial [Genlisea aurea]
Length=379

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 110/134 (82%), Gaps = 1/134 (1%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            VM  YLAL SG FWFPAQVYNRENGH GF+LSCYDAELSYD  TDTF ARYPPHG  A A
Sbjct  184  VMSCYLALHSGNFWFPAQVYNRENGHSGFLLSCYDAELSYDRITDTFSARYPPHGWRASA  243

Query  459  IETGVTWDRLRA-PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  283
            +ETG+TWDR+RA  L D   HDLH SDCL +LRPGDH+EIQWRR K+FPYGWWYGV+GHL
Sbjct  244  VETGITWDRVRASSLGDASPHDLHASDCLNELRPGDHVEIQWRRYKEFPYGWWYGVIGHL  303

Query  282  ETCDGNQHYCRCHE  241
            E+CDGN   CRC +
Sbjct  304  ESCDGNLICCRCRD  317



>ref|XP_008392525.1| PREDICTED: F-box protein At2g26850-like [Malus domestica]
Length=399

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 2/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+ S+M  YL+LESGKFWFPAQVYNRE+G++GF+LSCYDA+L YD RT+TF ARY P+GR
Sbjct  202  PVHSIMSLYLSLESGKFWFPAQVYNREHGNLGFLLSCYDAQLRYDSRTNTFQARYSPYGR  261

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  + WDRLRA  VD P + LH+SDCL+DL+PGDHIEIQWRRN +FPYGWWYGV+
Sbjct  262  RVV--EENIPWDRLRAAPVDTPPYKLHVSDCLHDLKPGDHIEIQWRRNNEFPYGWWYGVI  319

Query  291  GHLETCDGNQHYCRCH  244
            GHLE C+GN ++CRCH
Sbjct  320  GHLELCNGNVNHCRCH  335



>ref|XP_003554122.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
Length=399

 Score =   212 bits (539),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + N+    DS+   YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF 
Sbjct  192  GTQSNSSLSEDSIAALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFL  251

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY PHGR     E  + WDRLR P + +  H LHISDCL DLRPGDHIEIQWRRNK+FP
Sbjct  252  ARYSPHGRWTT--EENIQWDRLRVPPIASSPHALHISDCLDDLRPGDHIEIQWRRNKEFP  309

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGV+GHLE C G+ ++C CH
Sbjct  310  YGWWYGVIGHLEQCQGHGNHCHCH  333



>ref|XP_002881759.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58018.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=370

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 111/144 (77%), Gaps = 3/144 (2%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G     L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF 
Sbjct  166  GSSSTYLAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQ  225

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY  HGR A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FP
Sbjct  226  ARYSAHGRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFP  283

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWW+G+VGHL+ CDG ++ CRCH
Sbjct  284  YGWWFGIVGHLQNCDGGEN-CRCH  306



>emb|CAN79391.1| hypothetical protein VITISV_034661 [Vitis vinifera]
Length=313

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P L +  + +    +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD R
Sbjct  103  PKLESSGEPSCSLSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSR  162

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY P G     IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+
Sbjct  163  TDTFRARYSPQG--PQTIEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRK  220

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+ PYGWWYG++ HLETC+GN+++C CH
Sbjct  221  NKELPYGWWYGIISHLETCNGNENHCCCH  249



>ref|XP_003521127.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
Length=401

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + ++  P DS+   YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF 
Sbjct  194  GTESSSSLPEDSIAALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFL  253

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY PHGR     E  + WDRLR P +    H LHISDCL DLRPGDHIEIQWRRNK+FP
Sbjct  254  ARYSPHGRWTT--EENIQWDRLRVPPIATSPHALHISDCLDDLRPGDHIEIQWRRNKEFP  311

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGV+GHLE C G+ ++C CH
Sbjct  312  YGWWYGVIGHLEQCQGHGNHCHCH  335



>emb|CBI32779.3| unnamed protein product [Vitis vinifera]
Length=313

 Score =   207 bits (528),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P L +  + +    +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD R
Sbjct  53   PKLESSGEPSCSLSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSR  112

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY P G     IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+
Sbjct  113  TDTFRARYSPQGPQT--IEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRK  170

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+ PYGWWYG++ HLETC+GN+++C CH
Sbjct  171  NKELPYGWWYGIISHLETCNGNENHCCCH  199



>gb|AAD11995.1| unknown protein [Arabidopsis thaliana]
Length=371

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -1

Query  657  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  H
Sbjct  42   LAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAH  101

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G
Sbjct  102  GRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFG  159

Query  297  VVGHLETCDGNQHYCRC  247
            +VGHL+ CDG Q+ CRC
Sbjct  160  IVGHLQNCDGVQN-CRC  175



>ref|XP_007162078.1| hypothetical protein PHAVU_001G121900g [Phaseolus vulgaris]
 gb|ESW34072.1| hypothetical protein PHAVU_001G121900g [Phaseolus vulgaris]
Length=398

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + ++  P DSVM  YL+LESGKFWFPAQVYNRENGH GFMLSCYDA+L YD R+DTF 
Sbjct  191  GTQSSSSFPEDSVMALYLSLESGKFWFPAQVYNRENGHAGFMLSCYDAQLCYDSRSDTFQ  250

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY PHGR     E  + WDRLR P + +  H LHISD L +LRPGDHIEIQWRRNK FP
Sbjct  251  ARYSPHGRWTT--EENIQWDRLRVPPIASSPHALHISDSLDNLRPGDHIEIQWRRNKDFP  308

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGV+GHLE C G+ ++C CH
Sbjct  309  YGWWYGVIGHLEQCQGHGNHCLCH  332



>ref|XP_004290535.1| PREDICTED: F-box protein At2g32560-like [Fragaria vesca subsp. 
vesca]
Length=402

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DSVM  YL+LE G FWFPAQVYNRENG+VGFMLSCYDA+L YD  +DTF ARY P+GR
Sbjct  205  PVDSVMSLYLSLEIGDFWFPAQVYNRENGNVGFMLSCYDAQLRYDSGSDTFQARYSPYGR  264

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
                +E  + WDR+RA  VD P+H LH+SDCL+DL+PGDHIEIQWRR+K+FPYGWWYGV+
Sbjct  265  RT--MEENIPWDRIRAAPVDTPSHMLHVSDCLHDLKPGDHIEIQWRRSKEFPYGWWYGVI  322

Query  291  GHLETCDGNQHYCRCH  244
            GH E C+G++++C CH
Sbjct  323  GHFELCNGSENHCHCH  338



>ref|XP_006294441.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
 gb|EOA27339.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
Length=314

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G   +   PIDSVM+WY  LE+GKFWFPAQVYNRE+GHVGFM+SCYDA++ YD +TDTF 
Sbjct  110  GSASSYFAPIDSVMYWYSNLENGKFWFPAQVYNREHGHVGFMMSCYDAKIRYDFKTDTFQ  169

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            A+Y  HGR A   E  VTW RLR   VD  + +LH+SDCL+ LRPGDH EIQWRR K+FP
Sbjct  170  AKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRELHVSDCLHGLRPGDHFEIQWRRTKEFP  227

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWW+G+VGHL+ CDG ++ CRCH
Sbjct  228  YGWWFGIVGHLQNCDGEEN-CRCH  250



>ref|XP_004141125.1| PREDICTED: F-box protein At2g32560-like [Cucumis sativus]
 gb|KGN59728.1| hypothetical protein Csa_3G842010 [Cucumis sativus]
Length=387

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G+ R+ LP IDS+  WY +LE+GK WFPAQVYNRE+GH GFMLSCYDA++SYD +TD F 
Sbjct  183  GNIRSPLP-IDSMKAWYQSLENGKLWFPAQVYNRESGHAGFMLSCYDAQISYDWQTDMFK  241

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR A  IE  + W+RLRAP VD P H LH S+CL DL+PGDH+EIQWR++K+F 
Sbjct  242  ARYPPHGRRA--IEENIFWNRLRAPPVDIPPHLLHASECLADLKPGDHVEIQWRKSKEFS  299

Query  315  YGWWYGVVGHLETCDGNQHYCRC  247
            YGWWYGVVGHLE CDGN + C+C
Sbjct  300  YGWWYGVVGHLEACDGNANKCQC  322



>ref|XP_004158332.1| PREDICTED: F-box protein At2g32560-like [Cucumis sativus]
Length=387

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G+ R+ LP IDS+  WY +LE+GK WFPAQVYNRE+GH GFMLSCYDA++SYD +TD F 
Sbjct  183  GNIRSPLP-IDSMKAWYQSLENGKLWFPAQVYNRESGHAGFMLSCYDAQISYDWQTDMFK  241

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYPPHGR A  IE  + W+RLRAP VD P H LH S+CL DL+PGDH+EIQWR++K+F 
Sbjct  242  ARYPPHGRRA--IEENIFWNRLRAPPVDIPPHLLHASECLADLKPGDHVEIQWRKSKEFS  299

Query  315  YGWWYGVVGHLETCDGNQHYCRC  247
            YGWWYGVVGHLE CDGN + C+C
Sbjct  300  YGWWYGVVGHLEACDGNANKCQC  322



>dbj|BAD94811.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -1

Query  657  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  H
Sbjct  173  LAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAH  232

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G
Sbjct  233  GRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFG  290

Query  297  VVGHLETCDGNQHYCRC  247
            +VGHL+ CDG Q+ CRC
Sbjct  291  IVGHLQNCDGVQN-CRC  306



>ref|NP_850347.1| F-box protein [Arabidopsis thaliana]
 sp|Q6NKN8.1|FB132_ARATH RecName: Full=F-box protein At2g41170 [Arabidopsis thaliana]
 gb|AAT06475.1| At2g41170 [Arabidopsis thaliana]
 gb|AEC09940.1| F-box protein [Arabidopsis thaliana]
Length=371

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -1

Query  657  LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            L PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  H
Sbjct  173  LAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTFQARYSAH  232

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR A   E  VTW RLR    D  + DLH+SDCL+ LRPGDH EIQWRR K+FPYGWW+G
Sbjct  233  GRRAA--EEKVTWQRLRPSQDDTKSRDLHVSDCLHGLRPGDHFEIQWRRTKEFPYGWWFG  290

Query  297  VVGHLETCDGNQHYCRC  247
            +VGHL+ CDG Q+ CRC
Sbjct  291  IVGHLQNCDGVQN-CRC  306



>ref|XP_006294440.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
 gb|EOA27338.1| hypothetical protein CARUB_v10023454mg [Capsella rubella]
Length=373

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G   +   PIDSVM+WY  LE+GKFWFPAQVYNRE+GHVGFM+SCYDA++ YD +TDTF 
Sbjct  169  GSASSYFAPIDSVMYWYSNLENGKFWFPAQVYNREHGHVGFMMSCYDAKIRYDFKTDTFQ  228

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            A+Y  HGR A   E  VTW RLR   VD  + +LH+SDCL+ LRPGDH EIQWRR K+FP
Sbjct  229  AKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRELHVSDCLHGLRPGDHFEIQWRRTKEFP  286

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWW+G+VGHL+ CDG ++ CRCH
Sbjct  287  YGWWFGIVGHLQNCDGEEN-CRCH  309



>emb|CDY23870.1| BnaC04g01670D [Brassica napus]
Length=391

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 108/135 (80%), Gaps = 3/135 (2%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            PIDSVM+WY  LESGKFWFPAQVYNRENGHVGFM+SCYDA++ YD RT+TF ARY  HGR
Sbjct  195  PIDSVMYWYSNLESGKFWFPAQVYNRENGHVGFMMSCYDAKVRYDNRTNTFQARYSAHGR  254

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A   E  VTW RLR  LV+  + DLH+SDCL  LRPGDH EIQWRR K+FPYGWW+GVV
Sbjct  255  RAA--EENVTWQRLRPALVETESRDLHVSDCLQGLRPGDHFEIQWRRTKEFPYGWWFGVV  312

Query  291  GHLETCDGNQHYCRC  247
            GHL+ C G ++ CRC
Sbjct  313  GHLQNCVGEEN-CRC  326



>ref|XP_009618519.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Nicotiana 
tomentosiformis]
Length=393

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
              K  +   + S+M WYL+LESGKFWF AQV+NRENGHVGFMLSCYDAE+SYD  T+TF 
Sbjct  188  NSKVRSSSAMSSIMDWYLSLESGKFWFSAQVFNRENGHVGFMLSCYDAEVSYDCSTNTFR  247

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYP  GR  V  E  + W+RLRAP VD P + LHISDCL DL+P DH EIQWR++K+FP
Sbjct  248  ARYPTQGRRIV--EENIEWNRLRAPTVDTPPYVLHISDCLNDLKPDDHFEIQWRKSKEFP  305

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYG VGHLE+C+GN+  C CH
Sbjct  306  YGWWYGAVGHLESCNGNELNCHCH  329



>emb|CDM84605.1| unnamed protein product [Triticum aestivum]
Length=400

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRM  469
            D+V  WY ALE G FWFPAQVYNRE +GHVGF+LSCYDA L YD RTDTF ARYPPHGR 
Sbjct  202  DTVAAWYRALECGDFWFPAQVYNREQDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRK  261

Query  468  AVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVG  289
                E GV W R+RA  +  PA DLH S CL DLRPGDH EIQWR+NK FPYGWWYGVVG
Sbjct  262  PAKEEEGVQWCRVRAAPLSTPAQDLHASACLEDLRPGDHFEIQWRKNKDFPYGWWYGVVG  321

Query  288  HLETCDGNQHYCRCHE  241
            HLE C+ N+H CRCHE
Sbjct  322  HLEPCNANEHLCRCHE  337



>ref|XP_010653619.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Vitis vinifera]
Length=415

 Score =   208 bits (529),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P L +  + +    +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD R
Sbjct  243  PKLESSGEPSCSLSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSR  302

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY P G     IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+
Sbjct  303  TDTFRARYSPQGPQT--IEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRK  360

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+ PYGWWYG++ HLETC+GN+++C CH
Sbjct  361  NKELPYGWWYGIISHLETCNGNENHCCCH  389



>ref|XP_004970296.1| PREDICTED: F-box protein At2g41170-like isoform X2 [Setaria italica]
Length=458

 Score =   209 bits (532),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  211  DTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  270

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPYGWWYGVVGH
Sbjct  271  AKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGWWYGVVGH  330

Query  285  LETCDGNQH-YCRCHE  241
              +C+ N+H +CRCHE
Sbjct  331  QASCNANEHLWCRCHE  346



>ref|XP_004970298.1| PREDICTED: F-box protein At2g41170-like isoform X4 [Setaria italica]
Length=409

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  211  DTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  270

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPYGWWYGVVGH
Sbjct  271  AKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGWWYGVVGH  330

Query  285  LETCDGNQH-YCRCHE  241
              +C+ N+H +CRCHE
Sbjct  331  QASCNANEHLWCRCHE  346



>ref|XP_010673039.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=348

 Score =   206 bits (523),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = -1

Query  690  PNLGAGDK-RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P LG     + +LPP DS+M WYL+LESG+FWFPAQVYNRENGH GF+LSCYDA+LSY+ 
Sbjct  186  PKLGGTSLIKGSLPP-DSIMSWYLSLESGEFWFPAQVYNRENGHDGFVLSCYDAKLSYNS  244

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            ++DTF ARY  HGR  V  E  ++W R+RAP +DN  +DLH+SD L DL+PGDH EIQWR
Sbjct  245  KSDTFQARYTVHGRETV--EENISWSRIRAPPIDNSPYDLHVSDSLDDLKPGDHFEIQWR  302

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            RN+ FPYGWWYGVV HLE+C  N+ +C CH+
Sbjct  303  RNRGFPYGWWYGVVDHLESCTRNEDHCICHD  333



>ref|XP_002277192.2| PREDICTED: F-box protein At2g32560-like isoform X1 [Vitis vinifera]
Length=453

 Score =   209 bits (531),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            P L +  + +    +DS+  WYL+LESGK WFPAQVYNRENGH+GF++SCYDA LSYD R
Sbjct  243  PKLESSGEPSCSLSVDSIKAWYLSLESGKLWFPAQVYNRENGHLGFVMSCYDALLSYDSR  302

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            TDTF ARY P G     IE  + W RLRAP +D P H LH+SDCL DL+PGDHIEIQWR+
Sbjct  303  TDTFRARYSPQGPQT--IEENIPWHRLRAPPIDVPPHVLHVSDCLNDLKPGDHIEIQWRK  360

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            NK+ PYGWWYG++ HLETC+GN+++C CH
Sbjct  361  NKELPYGWWYGIISHLETCNGNENHCCCH  389



>ref|XP_003564433.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Brachypodium 
distachyon]
Length=411

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = -1

Query  630  WYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIET  451
            WY ALE G+FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR     E 
Sbjct  218  WYRALECGQFWFPAQVYNREDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKLAKEED  277

Query  450  GVTWDRLR-APLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETC  274
            GV W R+R AP    P HDLH+S CL DLRPGDH EIQWR+NK FPYGWWYG VGHLE+C
Sbjct  278  GVQWCRVRAAPASTPPPHDLHVSACLDDLRPGDHFEIQWRKNKDFPYGWWYGAVGHLESC  337

Query  273  DGNQHYCRCHE  241
            + N+H CRCHE
Sbjct  338  NANEHLCRCHE  348



>ref|XP_009345151.1| PREDICTED: F-box protein At2g26850-like [Pyrus x bretschneideri]
Length=399

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+ S+M  YL+LESGKFWFPAQVYNRE+G++GF+LSCYDA+L YD  T+TF ARY P+GR
Sbjct  202  PVHSIMSLYLSLESGKFWFPAQVYNREHGNLGFLLSCYDAQLRYDSWTNTFQARYSPYGR  261

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V  E  + WDRLRA  VD P + LH+SDCL+DL+PGDHIEIQWRRN ++PYGWWYGV+
Sbjct  262  RVV--EENIPWDRLRAAPVDTPPYKLHVSDCLHDLKPGDHIEIQWRRNNEYPYGWWYGVI  319

Query  291  GHLETCDGNQHYCRCH  244
            GHLE C+GN ++CRCH
Sbjct  320  GHLELCNGNVNHCRCH  335



>ref|XP_010327750.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Solanum lycopersicum]
Length=387

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 2/142 (1%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K  N   + S+M WYL+LE+GKFWFPAQV+NRENGH+GFMLSCYDAE+SYD RT+TF AR
Sbjct  184  KIGNSSEMSSIMDWYLSLETGKFWFPAQVFNRENGHIGFMLSCYDAEVSYDCRTNTFSAR  243

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K+F YG
Sbjct  244  YPSYGRRM--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLQPDDHIEIQWRKSKEFAYG  301

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVVGHLE+C G++  C CH
Sbjct  302  WWYGVVGHLESCSGSKLNCHCH  323



>ref|XP_010508750.1| PREDICTED: F-box protein At2g41170-like isoform X1 [Camelina 
sativa]
Length=372

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 113/147 (77%), Gaps = 7/147 (5%)
 Frame = -1

Query  672  DKRNNLP----PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            DKR +L     PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TD
Sbjct  165  DKRGSLSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTD  224

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TF A+Y  HGR A   E  VTW RLR   VD  + DLH+SDCL  LRPGDH EIQWR+ K
Sbjct  225  TFQAKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRDLHVSDCLDGLRPGDHFEIQWRKTK  282

Query  324  KFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +FP+GWW+G+VGH + CDG ++ CRCH
Sbjct  283  EFPFGWWFGIVGHQQNCDGEEN-CRCH  308



>emb|CDX79953.1| BnaA05g02030D [Brassica napus]
Length=391

 Score =   206 bits (525),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            PIDSVM+WY  LESGKFWFPAQVYNRENGHVGFM+SCYDA++ YD +T+TF ARY  HGR
Sbjct  195  PIDSVMYWYSNLESGKFWFPAQVYNRENGHVGFMMSCYDAKVRYDNKTNTFQARYSAHGR  254

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A   E  VTW RLR  LV+  + DLH+SDCL  LRPGDH EIQWRR K+FPYGWW+GVV
Sbjct  255  RAA--EENVTWQRLRPALVETESRDLHVSDCLQGLRPGDHFEIQWRRTKEFPYGWWFGVV  312

Query  291  GHLETCDGNQHYCRC  247
            GHL  C G ++ CRC
Sbjct  313  GHLRNCGGEEN-CRC  326



>ref|XP_008464952.1| PREDICTED: F-box protein At2g26850-like [Cucumis melo]
Length=384

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 2/142 (1%)
 Frame = -1

Query  672  DKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
            + R N+   DS+  WY +LE+GK WFPAQVYNRE+GH GFMLSCYDA++SYD +TD F A
Sbjct  180  ESRGNIRSPDSMKAWYQSLENGKLWFPAQVYNRESGHAGFMLSCYDAQISYDSQTDMFKA  239

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHGR A  IE  + W+RLRAP VD P H LH S+CL DL+PGDH+EIQWR++K+F Y
Sbjct  240  RYPPHGRRA--IEENIFWNRLRAPPVDIPPHLLHASECLADLKPGDHVEIQWRKSKEFSY  297

Query  312  GWWYGVVGHLETCDGNQHYCRC  247
            GWWYGVVGHLE CDG+ + C C
Sbjct  298  GWWYGVVGHLEACDGSANNCHC  319



>ref|XP_010517604.1| PREDICTED: F-box protein At2g41170-like [Camelina sativa]
Length=368

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 112/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  672  DKRNN--LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  499
            DKR +    PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF
Sbjct  163  DKRGSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTDTF  222

Query  498  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  319
             A+Y  HGR A   E  VTW RLR   VD  + DLH+SD L+ LRPGDH EIQWRR K+F
Sbjct  223  QAKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRDLHVSDSLHGLRPGDHFEIQWRRTKEF  280

Query  318  PYGWWYGVVGHLETCDGNQHYCRCH  244
            PYGWW+G+VGH + CDG ++ CRCH
Sbjct  281  PYGWWFGIVGHQQNCDGEEN-CRCH  304



>ref|XP_011075626.1| PREDICTED: F-box protein At2g32560-like [Sesamum indicum]
Length=373

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 3/141 (2%)
 Frame = -1

Query  666  RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARY  487
            R  LPP +SVM  YLALESGKFWFPAQV+NR NG+VGFMLSCYDA+LSYD   D F ARY
Sbjct  200  RCPLPP-NSVMSCYLALESGKFWFPAQVFNRGNGNVGFMLSCYDAQLSYDSIADNFVARY  258

Query  486  PPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGW  307
            P  GR    IE G+ WDR+RAP VD PA+ LHISDCL++L+P DHIEIQW +NK+FPYGW
Sbjct  259  PAQGRSM--IEEGIEWDRIRAPSVDTPANVLHISDCLHELKPDDHIEIQWTKNKEFPYGW  316

Query  306  WYGVVGHLETCDGNQHYCRCH  244
            WYGVVGHL++C+ N+  C CH
Sbjct  317  WYGVVGHLDSCNANEFNCYCH  337



>ref|XP_010673037.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=396

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 4/151 (3%)
 Frame = -1

Query  690  PNLGAGDK-RNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P LG     + +LPP DS+M WYL+LESG+FWFPAQVYNRENGH GF+LSCYDA+LSY+ 
Sbjct  186  PKLGGTSLIKGSLPP-DSIMSWYLSLESGEFWFPAQVYNRENGHDGFVLSCYDAKLSYNS  244

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            ++DTF ARY  HGR  V  E  ++W R+RAP +DN  +DLH+SD L DL+PGDH EIQWR
Sbjct  245  KSDTFQARYTVHGRETV--EENISWSRIRAPPIDNSPYDLHVSDSLDDLKPGDHFEIQWR  302

Query  333  RNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            RN+ FPYGWWYGVV HLE+C  N+ +C CH+
Sbjct  303  RNRGFPYGWWYGVVDHLESCTRNEDHCICHD  333



>ref|XP_010910139.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Elaeis guineensis]
Length=373

 Score =   205 bits (522),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = -1

Query  684  LGAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            + +  K +N  P DS+M WYL+LESGKFWFPAQVYNRE+GHVGFMLSCYDAE+SYD  TD
Sbjct  188  IESSSKPSNPLPDDSIMSWYLSLESGKFWFPAQVYNREHGHVGFMLSCYDAEISYDHHTD  247

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TFHARYPPHGR  + IE GV WDR+RAP VD PAHDLHISDCL DL PGDHIEIQWRRNK
Sbjct  248  TFHARYPPHGRRTIVIEEGVQWDRIRAPPVDTPAHDLHISDCLNDLHPGDHIEIQWRRNK  307

Query  324  KFPY  313
            +FPY
Sbjct  308  EFPY  311



>ref|XP_009142728.1| PREDICTED: F-box protein At2g41170 [Brassica rapa]
Length=391

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 107/135 (79%), Gaps = 3/135 (2%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            PIDSVM+WY  LESGKFWFPAQVYNRENGHVGFM+SCYDA++ YD +T+TF ARY  HGR
Sbjct  195  PIDSVMYWYSNLESGKFWFPAQVYNRENGHVGFMMSCYDAKVRYDNKTNTFQARYSAHGR  254

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
             A   E  VTW RLR  LV+  + DLH+SDCL  LRPGDH EIQWRR K+FPYGWW+GVV
Sbjct  255  RAA--EENVTWQRLRPALVETESRDLHVSDCLQGLRPGDHFEIQWRRTKEFPYGWWFGVV  312

Query  291  GHLETCDGNQHYCRC  247
            GHL  C G ++ CRC
Sbjct  313  GHLHNCVGEEN-CRC  326



>ref|XP_010505881.1| PREDICTED: F-box protein At2g41170-like [Camelina sativa]
Length=368

 Score =   204 bits (520),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 111/145 (77%), Gaps = 5/145 (3%)
 Frame = -1

Query  672  DKRNN--LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTF  499
            DKR +    PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD R+DTF
Sbjct  163  DKRGSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFRSDTF  222

Query  498  HARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKF  319
             A+Y  HGR A   E  VTW RLR   VD  + DLH+SDCL+ LRPGDH EIQWRR K+F
Sbjct  223  QAKYSAHGRRAA--EEKVTWQRLRPSQVDIKSRDLHVSDCLHGLRPGDHFEIQWRRTKEF  280

Query  318  PYGWWYGVVGHLETCDGNQHYCRCH  244
            PYGWW+G+VGH   C G ++ CRCH
Sbjct  281  PYGWWFGIVGHQRNCGGEEN-CRCH  304



>ref|XP_004493395.1| PREDICTED: F-box protein At2g26850-like [Cicer arietinum]
Length=391

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 117/161 (73%), Gaps = 5/161 (3%)
 Frame = -1

Query  681  GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDT  502
               +K   L P DSV   YL+LE+G FWFPAQVYNRENGH GFMLSCYDA+L YD R+DT
Sbjct  184  SKSEKDIKLSPDDSVAALYLSLENGNFWFPAQVYNRENGHAGFMLSCYDAQLCYDYRSDT  243

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARY PHGR     E  + W+RLR P +++  H LHISDCL +L+ GDH+EIQWRRNK+
Sbjct  244  FQARYSPHGRWTT--EENIKWERLRVPPIESSPHVLHISDCLDELKAGDHVEIQWRRNKE  301

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH---ECVLQKSGLGAG  208
            FPYGWWY V+GHLETC G  ++C+CH   + +L+ +   AG
Sbjct  302  FPYGWWYSVIGHLETCQGEGNHCQCHNNDKVILEFTQYTAG  342



>gb|KFK36964.1| hypothetical protein AALP_AA4G195400 [Arabis alpina]
Length=310

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 111/140 (79%), Gaps = 3/140 (2%)
 Frame = -1

Query  660  NLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPP  481
            +L P+DS+M+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TDTF ARY  
Sbjct  111  SLAPVDSLMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDYKTDTFQARYSA  170

Query  480  HGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  301
            HGR A   E  VTW RLR  LV+  + DLH+SDCL  L PGDH EIQWRR K+FPYGWWY
Sbjct  171  HGRRAA--EEKVTWQRLRPSLVEAGSRDLHVSDCLDGLCPGDHFEIQWRRTKEFPYGWWY  228

Query  300  GVVGHLETCDGNQHYCRCHE  241
            G+VGHL+ C+G ++ C CH+
Sbjct  229  GIVGHLQYCEG-ENNCNCHD  247



>ref|XP_006362270.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Solanum tuberosum]
Length=386

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 114/148 (77%), Gaps = 4/148 (3%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            K  N   + S+M WYL+LE+GKFWFPAQV+NRENG VGFMLSCYDAE+SYD RT+TF AR
Sbjct  183  KVGNSSEMSSIMDWYLSLETGKFWFPAQVFNRENGQVGFMLSCYDAEVSYDSRTNTFSAR  242

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K+F YG
Sbjct  243  YPSYGRRI--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLKPDDHIEIQWRKSKEFAYG  300

Query  309  WWYGVVGHLETCDGNQHYCRCH--ECVL  232
            WWYGVVGH E+C G++  C CH  E VL
Sbjct  301  WWYGVVGHSESCSGSKLNCHCHASETVL  328



>ref|XP_002458655.1| hypothetical protein SORBIDRAFT_03g037510 [Sorghum bicolor]
 gb|EES03775.1| hypothetical protein SORBIDRAFT_03g037510 [Sorghum bicolor]
Length=419

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            V  WY ALE G+F FPAQVYNRE+GHVGF+LSCYDA L Y  RTDTF ARYPP GR    
Sbjct  224  VAAWYRALECGEFSFPAQVYNREDGHVGFVLSCYDAHLRYHRRTDTFTARYPPLGRKPGK  283

Query  459  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  280
             E GV W+R+RAP V  PA DLH SDCL +LRPGDH EIQWR+NK FPYGWWYGVVGH E
Sbjct  284  EEDGVQWNRVRAPPVSTPAQDLHASDCLEELRPGDHFEIQWRKNKDFPYGWWYGVVGHQE  343

Query  279  TCDGNQHYCRCHE  241
            +C+GN+H CRCH+
Sbjct  344  SCNGNEHMCRCHQ  356



>ref|XP_009618518.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Nicotiana 
tomentosiformis]
Length=395

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTDT  502
              K  +   + S+M WYL+LESGKFWF AQV+NRE  NGHVGFMLSCYDAE+SYD  T+T
Sbjct  188  NSKVRSSSAMSSIMDWYLSLESGKFWFSAQVFNREVQNGHVGFMLSCYDAEVSYDCSTNT  247

Query  501  FHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKK  322
            F ARYP  GR  V  E  + W+RLRAP VD P + LHISDCL DL+P DH EIQWR++K+
Sbjct  248  FRARYPTQGRRIV--EENIEWNRLRAPTVDTPPYVLHISDCLNDLKPDDHFEIQWRKSKE  305

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCH  244
            FPYGWWYG VGHLE+C+GN+  C CH
Sbjct  306  FPYGWWYGAVGHLESCNGNELNCHCH  331



>ref|XP_010232469.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Brachypodium 
distachyon]
Length=412

 Score =   202 bits (515),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 104/132 (79%), Gaps = 2/132 (2%)
 Frame = -1

Query  630  WYLALESGKFWFPAQVYNRE-NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIE  454
            WY ALE G+FWFPAQVYNRE +GHVGF+LSCYDA L YD RTDTF ARYPPHGR     E
Sbjct  218  WYRALECGQFWFPAQVYNREQDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKLAKEE  277

Query  453  TGVTWDRLRA-PLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  277
             GV W R+RA P    P HDLH+S CL DLRPGDH EIQWR+NK FPYGWWYG VGHLE+
Sbjct  278  DGVQWCRVRAAPASTPPPHDLHVSACLDDLRPGDHFEIQWRKNKDFPYGWWYGAVGHLES  337

Query  276  CDGNQHYCRCHE  241
            C+ N+H CRCHE
Sbjct  338  CNANEHLCRCHE  349



>ref|XP_004249133.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Solanum lycopersicum]
Length=389

 Score =   201 bits (512),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 113/144 (78%), Gaps = 4/144 (3%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTDTFH  496
            K  N   + S+M WYL+LE+GKFWFPAQV+NRE  NGH+GFMLSCYDAE+SYD RT+TF 
Sbjct  184  KIGNSSEMSSIMDWYLSLETGKFWFPAQVFNREVQNGHIGFMLSCYDAEVSYDCRTNTFS  243

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K+F 
Sbjct  244  ARYPSYGRRM--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLQPDDHIEIQWRKSKEFA  301

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            YGWWYGVVGHLE+C G++  C CH
Sbjct  302  YGWWYGVVGHLESCSGSKLNCHCH  325



>ref|XP_009768151.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Nicotiana 
sylvestris]
Length=383

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = -1

Query  687  NLGAGDKRNN-LPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPR  511
            N   G++ N+ +    ++M WYL+LESG FWF AQV+NRENGHVGF LSCYDAE+SYD  
Sbjct  173  NRSKGNEDNSKVRSSSAIMDWYLSLESGTFWFSAQVFNRENGHVGFTLSCYDAEVSYDCN  232

Query  510  TDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRR  331
            T+TF ARYP  GR  V  E  + W+RLRAP VD P + LH+SDCL DL+P DH EIQWR+
Sbjct  233  TNTFRARYPSQGRRIV--EENIEWNRLRAPTVDTPPYVLHVSDCLSDLKPDDHFEIQWRK  290

Query  330  NKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            +K+F YGWWYGVVGHLE+C+GN+  C CH
Sbjct  291  SKEFAYGWWYGVVGHLESCNGNKLNCHCH  319



>gb|EMS62261.1| hypothetical protein TRIUR3_33055 [Triticum urartu]
Length=176

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 103/131 (79%), Gaps = 19/131 (15%)
 Frame = -1

Query  636  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  457
            M WYL LES KFWFPAQVYNRE+GHVGFM+SCYDAELSYD RTDTFHAR           
Sbjct  1    MSWYLHLESSKFWFPAQVYNREHGHVGFMMSCYDAELSYDFRTDTFHAR-----------  49

Query  456  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  277
                    +RAP V   AHDLH SDCL++LRPGD+IEIQWRRNK+FPYGWWYGVVGHLE+
Sbjct  50   --------VRAPPVGTLAHDLHASDCLHELRPGDNIEIQWRRNKEFPYGWWYGVVGHLES  101

Query  276  CDGNQHYCRCH  244
            CDGN+H+CRCH
Sbjct  102  CDGNEHFCRCH  112



>ref|XP_006446320.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
 gb|ESR59560.1| hypothetical protein CICLE_v10015455mg [Citrus clementina]
Length=335

 Score =   198 bits (504),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPYG +Y 
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPYGMFYS  323



>ref|XP_006362269.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Solanum tuberosum]
Length=388

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 6/150 (4%)
 Frame = -1

Query  669  KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYDPRTDTFH  496
            K  N   + S+M WYL+LE+GKFWFPAQV+NRE  NG VGFMLSCYDAE+SYD RT+TF 
Sbjct  183  KVGNSSEMSSIMDWYLSLETGKFWFPAQVFNREVQNGQVGFMLSCYDAEVSYDSRTNTFS  242

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARYP +GR    IE  + W+RLRAP VD   + LH+SDCL DL+P DHIEIQWR++K+F 
Sbjct  243  ARYPSYGRRI--IEDDIEWNRLRAPTVDTLPYVLHVSDCLDDLKPDDHIEIQWRKSKEFA  300

Query  315  YGWWYGVVGHLETCDGNQHYCRCH--ECVL  232
            YGWWYGVVGH E+C G++  C CH  E VL
Sbjct  301  YGWWYGVVGHSESCSGSKLNCHCHASETVL  330



>gb|KJB55452.1| hypothetical protein B456_009G077900 [Gossypium raimondii]
Length=314

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P DS+M W+LALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYDPR DTF ARYPPHGR
Sbjct  201  PDDSIMSWFLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDPRIDTFKARYPPHGR  260

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
             AVA E  V W+RLRAP  D   HDLHISDCL +LRPGD+IEIQWRRNK+FPYG
Sbjct  261  RAVAKEGDVPWERLRAPPFDTSPHDLHISDCLNELRPGDNIEIQWRRNKEFPYG  314



>ref|XP_002967788.1| hypothetical protein SELMODRAFT_88058 [Selaginella moellendorffii]
 gb|EFJ31135.1| hypothetical protein SELMODRAFT_88058 [Selaginella moellendorffii]
Length=327

 Score =   196 bits (497),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            +S+M WY  LE+G+F FPAQVYNRENGHVGFMLSCYDAE+SY+  TD F A YPPHG   
Sbjct  131  NSLMAWYWDLETGRFRFPAQVYNRENGHVGFMLSCYDAEVSYNSATDVFLASYPPHGPRT  190

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E  V W+R+RAP VD  AH+LH SDCL+DLRPGDHIE+QWRRN+ FPYGWWYG+VGH
Sbjct  191  SVYEEDVPWERVRAPPVDTAAHELHASDCLHDLRPGDHIEVQWRRNRDFPYGWWYGIVGH  250

Query  285  LETCDGNQHYCRCH  244
             + C  N H C+CH
Sbjct  251  TDLCPRN-HQCQCH  263



>ref|XP_002992630.1| hypothetical protein SELMODRAFT_135657 [Selaginella moellendorffii]
 gb|EFJ06332.1| hypothetical protein SELMODRAFT_135657 [Selaginella moellendorffii]
Length=327

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            +S+M WY  LE+G+F FPAQVYNRENGHVGFMLSCYDAE+SY+  TD F A YPPHG   
Sbjct  131  NSLMAWYWDLETGRFRFPAQVYNRENGHVGFMLSCYDAEVSYNSATDAFLASYPPHGPRT  190

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
               E  V W+R+RAP VD  AH+LH SDCL+DLRPGDHIE+QWRRN+ FPYGWWYG+VGH
Sbjct  191  SVYEEDVPWERVRAPPVDTAAHELHASDCLHDLRPGDHIEVQWRRNRDFPYGWWYGIVGH  250

Query  285  LETCDGNQHYCRCH  244
             + C  N H C+CH
Sbjct  251  TDLCPRN-HQCQCH  263



>ref|XP_011459459.1| PREDICTED: F-box protein At2g32560 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=329

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            +SVM WYLAL +G+FWFPAQVYNRENGHVGF+LSCYDAEL YDPR D+F ARYPPHGR A
Sbjct  157  NSVMSWYLALTTGRFWFPAQVYNRENGHVGFVLSCYDAELCYDPRNDSFQARYPPHGRRA  216

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            VAIE  V W+RLRAP VD   HDLHISDCL DLRPGDHIEIQWRRNK+FPY
Sbjct  217  VAIENCVPWERLRAPPVDTLPHDLHISDCLNDLRPGDHIEIQWRRNKEFPY  267



>ref|XP_009421118.1| PREDICTED: F-box protein At2g32560-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   197 bits (501),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -1

Query  663  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  484
            NN  P D  M  Y ALESG+ W PAQ+ NRENG+VGF+LSCYDAEL YD  +DTF+ARY 
Sbjct  182  NNTSPADVTMSCYSALESGRLWVPAQICNRENGNVGFVLSCYDAELRYDRHSDTFYARYY  241

Query  483  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  304
            PHG  AV  E GV+W+R+R P VD   H++H+S+CL +L PGDHIE+QWRR++KFP GWW
Sbjct  242  PHGSKAVQEEEGVSWNRVRVPPVDISPHEIHVSECLSELSPGDHIEVQWRRSQKFPCGWW  301

Query  303  YGVVGHLETCDGNQHYCRCH  244
            YGV+GHL++CDG++  C C+
Sbjct  302  YGVIGHLDSCDGDEQRCLCN  321



>ref|XP_009421126.1| PREDICTED: F-box protein At2g32560-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -1

Query  663  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  484
            NN  P D  M  Y ALESG+ W PAQ+ NRENG+VGF+LSCYDAEL YD  +DTF+ARY 
Sbjct  182  NNTSPADVTMSCYSALESGRLWVPAQICNRENGNVGFVLSCYDAELRYDRHSDTFYARYY  241

Query  483  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  304
            PHG  AV  E GV+W+R+R P VD   H++H+S+CL +L PGDHIE+QWRR++KFP GWW
Sbjct  242  PHGSKAVQEEEGVSWNRVRVPPVDISPHEIHVSECLSELSPGDHIEVQWRRSQKFPCGWW  301

Query  303  YGVVGHLETCDGNQHYCRCH  244
            YGV+GHL++CDG++  C C+
Sbjct  302  YGVIGHLDSCDGDEQRCLCN  321



>ref|XP_010554766.1| PREDICTED: F-box protein At2g41170 isoform X2 [Tarenaya hassleriana]
Length=329

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            SVM WY +LE+GKF FPAQV+NRENGHVGFM+SCYDAE+ Y+ + DTF ARY P GR   
Sbjct  135  SVMSWYSSLENGKFSFPAQVFNRENGHVGFMMSCYDAEIRYNSKLDTFRARYSPCGRRTA  194

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  283
              E  VTW+RLR+P VD P+  LH SDCL++LRP DH+EIQWRR+K+FPYGWWYG+VGHL
Sbjct  195  --EENVTWERLRSPPVDTPSRALHESDCLHELRPDDHVEIQWRRSKEFPYGWWYGIVGHL  252

Query  282  ETCDGNQHYCRCH  244
            + C G++  C C 
Sbjct  253  QICSGHEKNCLCE  265



>ref|XP_009768150.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Nicotiana 
sylvestris]
Length=385

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 113/151 (75%), Gaps = 5/151 (3%)
 Frame = -1

Query  687  NLGAGDKRNN-LPPIDSVMFWYLALESGKFWFPAQVYNRE--NGHVGFMLSCYDAELSYD  517
            N   G++ N+ +    ++M WYL+LESG FWF AQV+NRE  NGHVGF LSCYDAE+SYD
Sbjct  173  NRSKGNEDNSKVRSSSAIMDWYLSLESGTFWFSAQVFNREVQNGHVGFTLSCYDAEVSYD  232

Query  516  PRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQW  337
              T+TF ARYP  GR  V  E  + W+RLRAP VD P + LH+SDCL DL+P DH EIQW
Sbjct  233  CNTNTFRARYPSQGRRIV--EENIEWNRLRAPTVDTPPYVLHVSDCLSDLKPDDHFEIQW  290

Query  336  RRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            R++K+F YGWWYGVVGHLE+C+GN+  C CH
Sbjct  291  RKSKEFAYGWWYGVVGHLESCNGNKLNCHCH  321



>ref|XP_002968595.1| hypothetical protein SELMODRAFT_409561 [Selaginella moellendorffii]
 gb|EFJ30849.1| hypothetical protein SELMODRAFT_409561 [Selaginella moellendorffii]
Length=362

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 111/147 (76%), Gaps = 6/147 (4%)
 Frame = -1

Query  666  RNNLP-PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            R+  P P DS+M WY ALE+G  WF  QV+NRENGHVGF+LSCYDAELSY   +D+F AR
Sbjct  152  RSKAPRPSDSLMAWYWALETGNLWFRGQVFNRENGHVGFLLSCYDAELSYVRSSDSFRAR  211

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            YPPHG  A+ +E  ++W+R+RA  V  PAHDLH SDCL +LRPGDHIE+QWRR K+FPYG
Sbjct  212  YPPHGPRALVMEDDISWERVRASPVQTPAHDLHTSDCLAELRPGDHIEVQWRRTKEFPYG  271

Query  309  WWYGVVGHLETC-----DGNQHYCRCH  244
            WWYG+VGH ++C     + ++ +C C 
Sbjct  272  WWYGIVGHSDSCSNAGNNSSRQHCSCQ  298



>ref|XP_002975888.1| hypothetical protein SELMODRAFT_104188 [Selaginella moellendorffii]
 gb|EFJ22793.1| hypothetical protein SELMODRAFT_104188 [Selaginella moellendorffii]
Length=358

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -1

Query  669  KRNNLP-PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHA  493
             R+  P P DS+M WY ALE+G  WF  QV+NRENGHVGF+LSCYDAELSY   +D+F A
Sbjct  151  SRSKAPTPSDSLMAWYWALETGNLWFRGQVFNRENGHVGFLLSCYDAELSYVRSSDSFRA  210

Query  492  RYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            RYPPHG  A+ +E  ++W+R+RA  V  PAHDLH SDCL +LRPGDHIE+QWRR K+FPY
Sbjct  211  RYPPHGPRALVMEDDISWERVRASPVQTPAHDLHTSDCLAELRPGDHIEVQWRRTKEFPY  270

Query  312  GWWYGVVGHLETCD  271
            GWWYG+VGH E+C 
Sbjct  271  GWWYGIVGHSESCS  284



>ref|XP_010554764.1| PREDICTED: F-box protein At2g41170 isoform X1 [Tarenaya hassleriana]
 ref|XP_010554765.1| PREDICTED: F-box protein At2g41170 isoform X1 [Tarenaya hassleriana]
Length=372

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 105/133 (79%), Gaps = 2/133 (2%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            SVM WY +LE+GKF FPAQV+NRENGHVGFM+SCYDAE+ Y+ + DTF ARY P GR   
Sbjct  178  SVMSWYSSLENGKFSFPAQVFNRENGHVGFMMSCYDAEIRYNSKLDTFRARYSPCGRRTA  237

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  283
              E  VTW+RLR+P VD P+  LH SDCL++LRP DH+EIQWRR+K+FPYGWWYG+VGHL
Sbjct  238  --EENVTWERLRSPPVDTPSRALHESDCLHELRPDDHVEIQWRRSKEFPYGWWYGIVGHL  295

Query  282  ETCDGNQHYCRCH  244
            + C G++  C C 
Sbjct  296  QICSGHEKNCLCE  308



>gb|KDO54744.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=380

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 91/115 (79%), Positives = 98/115 (85%), Gaps = 2/115 (2%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH  478
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPH
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQARYPPH  263

Query  477  GRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
            GR  +AIE GV W+RLRA  VD   HDLHISDCL DL PGDHIEIQWRRNK+FPY
Sbjct  264  GRRPIAIECGVPWERLRAAPVDTSPHDLHISDCLNDLHPGDHIEIQWRRNKEFPY  318



>gb|AAC25938.1| unknown protein [Arabidopsis thaliana]
Length=228

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M  YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF ARYPPHGR
Sbjct  114  PLDSSMSCYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTHTDTFQARYPPHGR  173

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
             A AIE GVTWDR+RA  +D   H LH+SD L +L+PGDHIEIQWRRNK+FPYG
Sbjct  174  RASAIEKGVTWDRIRAAPIDASPHLLHVSDSLKELKPGDHIEIQWRRNKEFPYG  227



>ref|XP_004970295.1| PREDICTED: F-box protein At2g41170-like isoform X1 [Setaria italica]
Length=500

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 106/178 (60%), Gaps = 43/178 (24%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  211  DTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  270

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY---------  313
               E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPY         
Sbjct  271  AKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGTYARITSP  330

Query  312  ---------------------------------GWWYGVVGHLETCDGNQH-YCRCHE  241
                                             GWWYGVVGH  +C+ N+H +CRCHE
Sbjct  331  AFKPQYAAARHDSTISVGSSVADTMPFLRCVTTGWWYGVVGHQASCNANEHLWCRCHE  388



>ref|XP_007028346.1| F-box family protein isoform 5 [Theobroma cacao]
 gb|EOY08848.1| F-box family protein isoform 5 [Theobroma cacao]
Length=318

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 102/128 (80%), Gaps = 3/128 (2%)
 Frame = -1

Query  690  PNL-GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            PNL G+  +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD 
Sbjct  184  PNLEGSSSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDS  243

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWR
Sbjct  244  KTDTFQARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWR  301

Query  333  RNKKFPYG  310
            RNK+FPYG
Sbjct  302  RNKEFPYG  309



>ref|XP_004970297.1| PREDICTED: F-box protein At2g41170-like isoform X3 [Setaria italica]
Length=451

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 106/178 (60%), Gaps = 43/178 (24%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
            D+V  WY ALE G FWFPAQVYNRE+GHVGF+LSCYDA L YD RTDTF ARYPPHGR  
Sbjct  211  DTVAAWYRALECGDFWFPAQVYNREDGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKP  270

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY---------  313
               E GV W R+RAP V  PAHDLH S CL  LRPGDH EIQWR+NK FPY         
Sbjct  271  AKEEDGVQWSRIRAPPVSTPAHDLHGSGCLGALRPGDHFEIQWRKNKDFPYGTYARITSP  330

Query  312  ---------------------------------GWWYGVVGHLETCDGNQH-YCRCHE  241
                                             GWWYGVVGH  +C+ N+H +CRCHE
Sbjct  331  AFKPQYAAARHDSTISVGSSVADTMPFLRCVTTGWWYGVVGHQASCNANEHLWCRCHE  388



>ref|XP_007028343.1| F-box family protein isoform 2 [Theobroma cacao]
 gb|EOY08845.1| F-box family protein isoform 2 [Theobroma cacao]
Length=311

 Score =   184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = -1

Query  690  PNL-GAGDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            PNL G+  +R    P DS+M WYL+LE+GKFWFPAQVYNRENGH GFMLSCYDA+L YD 
Sbjct  184  PNLEGSSSQRKTDLPNDSMMSWYLSLETGKFWFPAQVYNRENGHAGFMLSCYDAKLCYDS  243

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            +TDTF ARY PHG+     E  ++WDRLR P VD P+H LHISDC+ DL+PGDHIEIQWR
Sbjct  244  KTDTFQARYSPHGQRTT--EEYISWDRLRVPPVDTPSHVLHISDCIPDLKPGDHIEIQWR  301

Query  333  RNKKFPY  313
            RNK+FPY
Sbjct  302  RNKEFPY  308



>ref|XP_008240698.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Prunus mume]
Length=371

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 3/127 (2%)
 Frame = -1

Query  690  PNLGAGD-KRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDP  514
            P L   D K     P++SVM  Y++LESGKFWFPAQVYNRENG+VGFMLSCYDA++SYD 
Sbjct  185  PKLATSDCKARTSLPVESVMSLYISLESGKFWFPAQVYNRENGNVGFMLSCYDAQVSYDS  244

Query  513  RTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR  334
            RT+TF ARY P+GR A   E  + WDRLRA  VD P+H LH++DCL+DL+PGDHIEIQWR
Sbjct  245  RTNTFQARYSPYGRRAT--EDNIPWDRLRAAPVDTPSHKLHVTDCLHDLKPGDHIEIQWR  302

Query  333  RNKKFPY  313
            RNK+FPY
Sbjct  303  RNKEFPY  309



>gb|AAC32240.1| unknown protein [Arabidopsis thaliana]
Length=346

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 98/113 (87%), Gaps = 0/113 (0%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DS M +YL+LE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  T+TF ARYPPHG+
Sbjct  172  PLDSTMNFYLSLETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDTDTNTFQARYPPHGK  231

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
             A+A+E  VTW+R+RA  VD   H+L++SD L +L+PGDHIEIQWRRNK+FPY
Sbjct  232  RAIAVEKDVTWERIRAAPVDASPHNLYVSDSLNELKPGDHIEIQWRRNKEFPY  284



>gb|EPS66079.1| hypothetical protein M569_08700, partial [Genlisea aurea]
Length=366

 Score =   181 bits (458),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  645  DSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMA  466
             S+M  Y+ALE+GKFWFPAQV+NRENG +GF LSCYDA++ YD  TD F ARYP  G   
Sbjct  171  SSLMALYIALETGKFWFPAQVFNRENGFLGFALSCYDAKICYDSTTDHFIARYPSQG--V  228

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
              IE  + W+R+RAP+VD P++ LH+SDCL +L+P D +EIQWR+N  FPYGWWYGVVGH
Sbjct  229  SLIEESIGWNRIRAPVVDTPSNILHVSDCLNELKPDDQVEIQWRKNNLFPYGWWYGVVGH  288

Query  285  LETCDGNQHYCRC  247
            L++C GN  YC C
Sbjct  289  LDSCSGNT-YCGC  300



>gb|EEE55551.1| hypothetical protein OsJ_03804 [Oryza sativa Japonica Group]
Length=404

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = -1

Query  570  NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLH  391
            +GHVGF+LSCYDA L YD RTDTF ARYPPHGR     E+GV W R+R+P V  PAHDLH
Sbjct  232  DGHVGFVLSCYDAHLRYDRRTDTFTARYPPHGRKPAKEESGVQWSRVRSPPVSTPAHDLH  291

Query  390  ISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
             S CL DLRPGDH EIQWR+NK FPYGWWYGVVGH ETC+ N+H CRCHE
Sbjct  292  ASGCLGDLRPGDHFEIQWRKNKDFPYGWWYGVVGHQETCNANEHLCRCHE  341



>gb|EMT27387.1| hypothetical protein F775_17219 [Aegilops tauschii]
Length=181

 Score =   173 bits (438),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/115 (70%), Positives = 87/115 (76%), Gaps = 0/115 (0%)
 Frame = -1

Query  585  VYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNP  406
            V   E+GHVGF+LSCYDA L YD RTDTF ARYPPHGR     E GV W R+RA  +  P
Sbjct  4    VLALEDGHVGFLLSCYDAHLRYDRRTDTFTARYPPHGRKPAKEEEGVQWCRVRAAPLSTP  63

Query  405  AHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            A DLH S CL DLRPGDH EIQWR+NK FPYGWWYGVVGHLE C+ N+H CRCHE
Sbjct  64   AQDLHASGCLEDLRPGDHFEIQWRKNKDFPYGWWYGVVGHLEPCNANEHLCRCHE  118



>ref|XP_010112853.1| F-box protein [Morus notabilis]
 gb|EXC34976.1| F-box protein [Morus notabilis]
Length=340

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 100/139 (72%), Gaps = 4/139 (3%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P+DSVM +Y ALESGKFWFPAQ+Y R+NG+ G ML CYDA++SYD RT+TF ARY   G 
Sbjct  131  PVDSVMAFYFALESGKFWFPAQIYYRQNGYTGVMLLCYDAQISYDSRTNTFRARYTSQGW  190

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDL--HISDCLYDLRPGDHIEIQWRRNKKFPYGWWYG  298
                 E  + WDR+RAP V  P      H+SDCL+DL+PGDHIEIQW+     PY WWY 
Sbjct  191  GTG--EENIGWDRVRAPPVGVPLDPFVPHVSDCLHDLKPGDHIEIQWKSRTDLPYAWWYA  248

Query  297  VVGHLETCDGNQHYCRCHE  241
            ++GHLE CD NQ++C CHE
Sbjct  249  LIGHLEPCDKNQNHCLCHE  267



>ref|XP_010112851.1| F-box protein [Morus notabilis]
 gb|EXC34974.1| F-box protein [Morus notabilis]
Length=340

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
              K     P+DSVM +Y ALESGKFWFPAQ+Y R+NG+   ML CYDA++SYD RT+TF 
Sbjct  123  SSKVRTTLPVDSVMAFYFALESGKFWFPAQIYYRQNGYTEVMLLCYDAQISYDSRTNTFR  182

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDL--HISDCLYDLRPGDHIEIQWRRNKK  322
            ARY   G      E  + WDR+RAP VD P      H+SDCL+DL+PGDHIEIQW+    
Sbjct  183  ARYSSQGWGRG--EENIGWDRVRAPPVDVPLDPFVPHVSDCLHDLKPGDHIEIQWKSRTD  240

Query  321  FPYGWWYGVVGHLETCDGNQHYCRCHE  241
             PY WWY ++GHLE CD NQ++C CHE
Sbjct  241  LPYAWWYALIGHLELCDKNQNHCLCHE  267



>ref|XP_010508751.1| PREDICTED: F-box protein At2g41170-like isoform X2 [Camelina 
sativa]
Length=325

 Score =   166 bits (421),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 91/121 (75%), Gaps = 6/121 (5%)
 Frame = -1

Query  672  DKRNNLP----PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTD  505
            DKR +L     PIDSVM+WY  LE+GKFWFPAQVYNRENGHVGFM+SCYDA++ YD +TD
Sbjct  165  DKRGSLSSYFAPIDSVMYWYSNLENGKFWFPAQVYNRENGHVGFMMSCYDAKIRYDFKTD  224

Query  504  TFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNK  325
            TF A+Y  HGR A   E  VTW RLR   VD  + DLH+SDCL  LRPGDH EIQWR+ K
Sbjct  225  TFQAKYSAHGRRAA--EEKVTWQRLRPSQVDTKSRDLHVSDCLDGLRPGDHFEIQWRKTK  282

Query  324  K  322
            +
Sbjct  283  E  283



>ref|XP_010112859.1| F-box protein [Morus notabilis]
 gb|EXC34982.1| F-box protein [Morus notabilis]
Length=344

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 7/138 (5%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH--  478
            P+  VM +YLALESGKFWFPAQ+Y   NG+ G ML CYDA++SYD  TDTF A YP H  
Sbjct  150  PVGHVMAFYLALESGKFWFPAQIYYGGNGYTGAMLLCYDAQVSYDYSTDTFRASYPAHVW  209

Query  477  GRMAVAIETGVTWDRLRAPLVDNP-AHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  301
            GR     ET + WDRLRA  VD P     H+SD L+DL+PGDHIEIQW+ + K PYGWWY
Sbjct  210  GRK----ETNIKWDRLRAAPVDTPDPFTPHVSDYLHDLKPGDHIEIQWKSHDKSPYGWWY  265

Query  300  GVVGHLETCDGNQHYCRC  247
             +VGHL+ CD N ++CRC
Sbjct  266  ALVGHLDQCDENVNHCRC  283



>ref|XP_010112850.1| F-box protein [Morus notabilis]
 gb|EXC34973.1| F-box protein [Morus notabilis]
Length=344

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 98/139 (71%), Gaps = 7/139 (5%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPH--  478
            P+  VM +YLALESGKFWFPAQVY   NG+ G  L CYDA++SYD  TDTF A YP    
Sbjct  150  PVGHVMAFYLALESGKFWFPAQVYYGGNGYTGVTLLCYDAQVSYDYSTDTFRASYPAQVW  209

Query  477  GRMAVAIETGVTWDRLRAPLVDN-PAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWY  301
            GR     ET + WDRLRAP VD       H+SD L+DL+PGDHIEIQW+ + K PYGWWY
Sbjct  210  GRN----ETNIKWDRLRAPPVDTLDPFTPHVSDYLHDLKPGDHIEIQWKSHDKSPYGWWY  265

Query  300  GVVGHLETCDGNQHYCRCH  244
             +VGHL+ CD N ++CRCH
Sbjct  266  ALVGHLDQCDENVNHCRCH  284



>gb|ADE76919.1| unknown [Picea sitchensis]
Length=324

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 92/136 (68%), Gaps = 1/136 (1%)
 Frame = -1

Query  651  PIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGR  472
            P +     Y  LESGK WFPAQVYNR+NGHVGF+LSCYDAEL+Y   +DTF ARY P+  
Sbjct  126  PSERFASMYSDLESGKLWFPAQVYNRQNGHVGFVLSCYDAELNYVRDSDTFCARYSPY-Y  184

Query  471  MAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVV  292
              V IE G+ W R+R P V+    ++HI D   + RPGDHIE+QW+R + FPYGWWYG+V
Sbjct  185  PRVIIEDGIPWARIRKPAVETSPSEIHIPDIAEEFRPGDHIEVQWKRCQYFPYGWWYGIV  244

Query  291  GHLETCDGNQHYCRCH  244
            GH   C  +   C CH
Sbjct  245  GHAANCTRDDQDCECH  260



>gb|ACI23490.1| putative cyclin-like F-box [Triticum monococcum]
 gb|ACI23491.1| putative cyclin-like F-box [Aegilops speltoides]
 gb|ACI23492.1| putative cyclin-like F-box [Triticum urartu]
Length=86

 Score =   144 bits (364),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = -1

Query  570  NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLH  391
            +GHVGFM+SCYDAELSYD RTDTFHARYPPHGR  V +E GV WDR+RAP V   AHDLH
Sbjct  1    HGHVGFMMSCYDAELSYDFRTDTFHARYPPHGRRTVVLEDGVQWDRVRAPPVGTLAHDLH  60

Query  390  ISDCLYDLRPGDHIEIQWRRNKKFPY  313
             SDCL++LRPGD+IEIQWRRNK+FPY
Sbjct  61   ASDCLHELRPGDNIEIQWRRNKEFPY  86



>gb|ACI23489.1| putative cyclin-like F-box [Secale cereale]
Length=86

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = -1

Query  570  NGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLH  391
            +GHVGFM+SCYDAELSYD  TD FHARYPPHGR  V +E GV WDR+RAP V   AHDLH
Sbjct  1    HGHVGFMMSCYDAELSYDFCTDKFHARYPPHGRRTVVLEDGVQWDRVRAPRVGTLAHDLH  60

Query  390  ISDCLYDLRPGDHIEIQWRRNKKFPY  313
             SDCL++LRPGD+IEIQWRRNK+FPY
Sbjct  61   ASDCLHELRPGDNIEIQWRRNKEFPY  86



>ref|XP_003520488.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Glycine max]
Length=321

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 84/134 (63%), Gaps = 10/134 (7%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG-RMA  466
            S M  Y++LESG FWFP QV+   N      L CYDA +SYD RTDTF +R P  G RM 
Sbjct  135  SKMALYISLESGLFWFPVQVFKITN------LFCYDAIVSYDSRTDTFKSRSPTGGWRM-  187

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGH  286
              IE  +  DRLR    +      ++S+ + DL+PGDHIEIQ RR K+ PY WWY V+GH
Sbjct  188  --IEGNIQRDRLRLAPAETSPMTFYMSNSMNDLKPGDHIEIQIRRRKESPYNWWYAVIGH  245

Query  285  LETCDGNQHYCRCH  244
            LETC+ N ++C C 
Sbjct  246  LETCNQNVNHCHCQ  259



>ref|XP_003537295.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=316

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/140 (47%), Positives = 89/140 (64%), Gaps = 12/140 (9%)
 Frame = -1

Query  663  NNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYP  484
            N   P + +M  Y +LESG+FWFPAQVY       G ML  ++A +SYD  ++TF ARY 
Sbjct  119  NGQRPNNFLMSLYFSLESGRFWFPAQVYK------GLML--HNALVSYDSESNTFQARYQ  170

Query  483  PHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWW  304
              G   +     + WD +R P VD+P + +H+SDCL +L+P DHIEIQWR N   PY WW
Sbjct  171  TGGWRCLG--RNIEWDMVRVPSVDSPPYVMHVSDCLDNLKPEDHIEIQWRGNTHCPYDWW  228

Query  303  YGVVGHLETCDGNQHYCRCH  244
            Y V+GHL++C+ N   C+CH
Sbjct  229  YAVIGHLDSCNKNN--CQCH  246



>ref|XP_003624987.1| F-box protein [Medicago truncatula]
 gb|ABD33047.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81205.1| F-box plant-like protein [Medicago truncatula]
Length=314

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 82/131 (63%), Gaps = 10/131 (8%)
 Frame = -1

Query  636  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  457
            M  YL+LESGKFWFPAQ++          L  ++A LSYD +TDTF AR        V  
Sbjct  132  MALYLSLESGKFWFPAQLFRG--------LYVHEALLSYDSKTDTFQARTRSGNWRIVG-  182

Query  456  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  277
               + WD+LR  LV+  +   H+SDC  DL+ GDHIEIQWR N + PY WWY V+GHL++
Sbjct  183  -NKIHWDKLRPSLVETSSCVRHVSDCYQDLKLGDHIEIQWRGNTQTPYDWWYAVIGHLDS  241

Query  276  CDGNQHYCRCH  244
            C+ N++YC C 
Sbjct  242  CNENENYCFCQ  252



>ref|XP_003520491.1| PREDICTED: F-box protein At2g26850-like [Glycine max]
Length=308

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 85/132 (64%), Gaps = 11/132 (8%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            +M  Y +LE+GKFWFPAQ+Y       G ++   DA + YD +TD F AR    G   + 
Sbjct  120  MMALYFSLENGKFWFPAQIYR------GLLVR--DALVRYDSKTDKFQARQQNGGWQVMG  171

Query  459  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWR-RNKKFPYGWWYGVVGHL  283
                + WD LRAP VD P  +LH+SDCL DL+P DHIEIQ + R +  PY WWY V+GH+
Sbjct  172  --NNIQWDILRAPPVDTPPWNLHVSDCLQDLKPEDHIEIQRKPRRESTPYDWWYAVIGHM  229

Query  282  ETCDGNQHYCRC  247
            E+C+ NQ++CRC
Sbjct  230  ESCNENQNFCRC  241



>ref|XP_003520490.1| PREDICTED: F-box protein At2g32560-like [Glycine max]
 gb|KHN30353.1| F-box protein [Glycine soja]
Length=307

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/132 (45%), Positives = 82/132 (62%), Gaps = 10/132 (8%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            +M  Y +LE+G FWFPAQ+Y          L   DA + YD +TD F AR    G   + 
Sbjct  120  MMALYFSLENGNFWFPAQIYRG--------LYFRDALVRYDSKTDNFQARQQNAGWKIMG  171

Query  459  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  280
                + WD+LRAP VD      ++SDCL DL+PGDHIE+QW+ ++  PY WWY V+GH+E
Sbjct  172  --NNIQWDKLRAPPVDTLPSVRYVSDCLQDLKPGDHIELQWKSSRDIPYDWWYAVIGHME  229

Query  279  TCDGNQHYCRCH  244
            +C+ N+++CRC 
Sbjct  230  SCNENENFCRCR  241



>ref|XP_004499916.1| PREDICTED: F-box protein At2g26850-like isoform X1 [Cicer arietinum]
 ref|XP_004499917.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Cicer arietinum]
Length=337

 Score =   125 bits (314),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 82/133 (62%), Gaps = 7/133 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+F FPAQVY        F L CYDA + YD +TDTF AR P  GR   
Sbjct  144  SKMALYICLETGRFCFPAQVYKA----TRFTLYCYDALVCYDSKTDTFRARSPNGGRHM-  198

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY-GWWYGVVGH  286
             IE  + WDRLR P  +    D + S+CL DL+PGDHIEIQ RR +  PY  WWY VV H
Sbjct  199  -IEKDIHWDRLRKPPHNTFLVDFYHSNCLNDLKPGDHIEIQKRRRRALPYCEWWYAVVCH  257

Query  285  LETCDGNQHYCRC  247
            L +CD + ++C C
Sbjct  258  LGSCDKDINHCSC  270



>ref|XP_007162085.1| hypothetical protein PHAVU_001G122600g [Phaseolus vulgaris]
 gb|ESW34079.1| hypothetical protein PHAVU_001G122600g [Phaseolus vulgaris]
Length=315

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 84/141 (60%), Gaps = 19/141 (13%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            +M  Y +LE+GKFWFPAQVY    G V       DA + YD +TD F AR    G  AV 
Sbjct  116  MMTLYFSLENGKFWFPAQVYR--GGLV------RDALVRYDSKTDNFQARQQNGGWQAVG  167

Query  459  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY---------GW  307
                + W+ LRAP VD P    +ISDCL DL+PGDHIEIQW+  ++  Y         GW
Sbjct  168  --NNIQWEILRAPPVDTPPCVRYISDCLEDLKPGDHIEIQWKSRREISYESTKYLNDAGW  225

Query  306  WYGVVGHLETCDGNQHYCRCH  244
            WY VVGH+E+C+ NQ++C C 
Sbjct  226  WYAVVGHMESCNENQNFCCCR  246



>gb|EYU18616.1| hypothetical protein MIMGU_mgv1a0077792mg, partial [Erythranthe 
guttata]
Length=144

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 64/82 (78%), Gaps = 2/82 (2%)
 Frame = -1

Query  489  YPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
            Y   GR    IE G+ WDR+RAP V+ P + LHISDCL  ++PGDHIEIQWR+NK+FP+G
Sbjct  1    YRAQGRSM--IEEGIEWDRIRAPSVNTPPNSLHISDCLDQIKPGDHIEIQWRKNKEFPFG  58

Query  309  WWYGVVGHLETCDGNQHYCRCH  244
            WWYGVV HLE+C+GN+  C+CH
Sbjct  59   WWYGVVEHLESCNGNEFNCQCH  80



>ref|XP_003624981.1| F-box protein [Medicago truncatula]
 gb|ABD33041.1| Cyclin-like F-box [Medicago truncatula]
 gb|AES81199.1| F-box plant-like protein [Medicago truncatula]
Length=318

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 10/131 (8%)
 Frame = -1

Query  636  MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVAI  457
            M  ++ALE+G+FWFPAQVY +        LSCYDA +SYD R DTF AR P +G     I
Sbjct  131  MSLFIALETGQFWFPAQVYKK-------ALSCYDALISYDSRNDTFKARSPSNG---WRI  180

Query  456  ETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLET  277
               V WD LR P       D +  + + +L+PGD++E+Q RR K++PY WW+ ++GHLE+
Sbjct  181  RGDVEWDMLRIPPPQTFLSDYYKPNYINNLKPGDYVEVQKRRRKEYPYDWWFAIIGHLES  240

Query  276  CDGNQHYCRCH  244
            CD + ++C C 
Sbjct  241  CDEDMNHCHCQ  251



>ref|XP_007162082.1| hypothetical protein PHAVU_001G122300g [Phaseolus vulgaris]
 gb|ESW34076.1| hypothetical protein PHAVU_001G122300g [Phaseolus vulgaris]
Length=325

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 83/132 (63%), Gaps = 10/132 (8%)
 Frame = -1

Query  639  VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAVA  460
            +M  Y +LE+GKFWFPAQVY       G  +   DA + YD ++D F AR    G   + 
Sbjct  128  MMSLYFSLENGKFWFPAQVYR------GVFVR--DALVRYDSKSDNFQARQQSGGWHIMG  179

Query  459  IETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHLE  280
                + WD LRAP VD+PA   ++ DCL +L+PGDHIEIQ R  ++ PY W Y V+GHLE
Sbjct  180  --NNIQWDNLRAPPVDSPACVRYVCDCLQELKPGDHIEIQRRFRRETPYDWCYAVIGHLE  237

Query  279  TCDGNQHYCRCH  244
            +C+ N+++C CH
Sbjct  238  SCNENENFCSCH  249



>ref|XP_007162081.1| hypothetical protein PHAVU_001G122200g [Phaseolus vulgaris]
 gb|ESW34075.1| hypothetical protein PHAVU_001G122200g [Phaseolus vulgaris]
Length=321

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LESG+FWFP QVY   N +    L C DA +SYD RT+TF AR P  G    
Sbjct  135  SKMALYICLESGRFWFPLQVYKNGNQN----LFCCDAIVSYDCRTNTFQARSPRGGWQM-  189

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYGWWYGVVGHL  283
             IE  V W+RLR   V+      ++S+ + DL+PGD IEIQ RR K   Y WWY V+GHL
Sbjct  190  -IEGNVPWNRLRISPVETSTRAFYMSNSMNDLKPGDQIEIQIRRRKDSHYNWWYAVIGHL  248

Query  282  ETCDGNQHYCRCH  244
            E C+ +   C C 
Sbjct  249  EACEEDVSQCHCQ  261



>ref|XP_007145512.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17506.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=271

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 17/144 (12%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + NN      +M  Y +LESG FWFPAQVY          L  +DA ++YD +++TF 
Sbjct  121  GQQSNNF-----MMSLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQ  167

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY   G   +     + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + P
Sbjct  168  ARYQNGGWSCLG--RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECP  225

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            Y WWY ++GHL++C  N   C+C 
Sbjct  226  YEWWYAIIGHLDSC--NHKSCQCQ  247



>ref|XP_007145513.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17507.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=322

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 17/144 (12%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + NN      +M  Y +LESG FWFPAQVY          L  +DA ++YD +++TF 
Sbjct  121  GQQSNNF-----MMSLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQ  167

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY   G   +     + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + P
Sbjct  168  ARYQNGGWSCLG--RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECP  225

Query  315  YGWWYGVVGHLETCDGNQHYCRCH  244
            Y WWY ++GHL++C  N   C+C 
Sbjct  226  YEWWYAIIGHLDSC--NHKSCQCQ  247



>gb|AFK35889.1| unknown [Lotus japonicus]
Length=317

 Score =   115 bits (289),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 90/157 (57%), Gaps = 16/157 (10%)
 Frame = -1

Query  690  PNLGAGDKRNNLPPIDSV------MFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAE  529
            P+L       N   I S+      M  ++ LESG+FWFPAQ Y +        L  YD  
Sbjct  112  PSLSLNSYLKNFGDITSLFQNCPKMALFVCLESGRFWFPAQAYLKR-----MPLYFYDVI  166

Query  528  LSYDPRTDTFHARYPPHG-RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDH  352
            +SY+  TDTF AR P +  RM   I   + WDRLR+   +N +   ++S+   DL+PGDH
Sbjct  167  VSYNSETDTFRARSPNNEWRM---IGRNIEWDRLRSSPAENFSRKFYMSN-KNDLKPGDH  222

Query  351  IEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCHE  241
            IEIQ R+ ++ PY WWY +VGHLE+CD N ++C C +
Sbjct  223  IEIQRRKRRECPYDWWYAIVGHLESCDENVNHCSCQQ  259



>ref|XP_006576778.1| PREDICTED: F-box protein At2g26850-like isoform X2 [Glycine max]
Length=170

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 4/103 (4%)
 Frame = -1

Query  549  LSCYDAELSYDPRTDTFHARYPPHG-RMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLY  373
            L CYDA +SYD RTDTF +R P  G RM   IE  +  DRLR    +      ++S+ + 
Sbjct  9    LFCYDAIVSYDSRTDTFKSRSPTGGWRM---IEGNIQRDRLRLAPAETSPMTFYMSNSMN  65

Query  372  DLRPGDHIEIQWRRNKKFPYGWWYGVVGHLETCDGNQHYCRCH  244
            DL+PGDHIEIQ RR K+ PY WWY V+GHLETC+ N ++C C 
Sbjct  66   DLKPGDHIEIQIRRRKESPYNWWYAVIGHLETCNQNVNHCHCQ  108



>gb|AES81202.2| F-box plant-like protein [Medicago truncatula]
Length=324

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 7/144 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  +
Sbjct  132  SKMALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL  186

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGH  286
             IE  ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV H
Sbjct  187  -IERDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCH  245

Query  285  LETCDGNQHYCRCHECVLQKSGLG  214
            LE+CD + ++C C +  +   G  
Sbjct  246  LESCDQDVNHCSCKDSDILVMGFS  269



>gb|ABD33044.1| Cyclin-like F-box [Medicago truncatula]
Length=330

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 7/144 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  +
Sbjct  138  SKMALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL  192

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGH  286
             IE  ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV H
Sbjct  193  -IERDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCH  251

Query  285  LETCDGNQHYCRCHECVLQKSGLG  214
            LE+CD + ++C C +  +   G  
Sbjct  252  LESCDQDVNHCSCKDSDILVMGFS  275



>ref|XP_003624984.1| F-box protein [Medicago truncatula]
Length=353

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 84/144 (58%), Gaps = 7/144 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+FWFPAQVY          L CYDA +SYD RTDTF  R  P+GR  +
Sbjct  161  SKMALYIFLETGRFWFPAQVYKA----TLLTLHCYDAIVSYDSRTDTFQTR-CPYGRKRL  215

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGH  286
             IE  ++WD LR P       D +  + L +L+PGDHIEIQ R  + FP Y W + VV H
Sbjct  216  -IERDISWDMLRMPPPKTYLVDYYEYNDLNNLKPGDHIEIQKRGRRLFPIYDWAHAVVCH  274

Query  285  LETCDGNQHYCRCHECVLQKSGLG  214
            LE+CD + ++C C +  +   G  
Sbjct  275  LESCDQDVNHCSCKDSDILVMGFS  298



>ref|XP_003624986.1| F-box protein [Medicago truncatula]
 gb|ABD33046.2| Cyclin-like F-box [Medicago truncatula]
 gb|AES81204.1| F-box plant-like protein [Medicago truncatula]
Length=323

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 81/135 (60%), Gaps = 7/135 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+FWFPAQVY          L CYDA ++YD +T+TF  R  PHGR  V
Sbjct  131  SKMALYIFLETGRFWFPAQVYKA----TLLTLYCYDAIVTYDSKTNTFQTR-TPHGRRRV  185

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP-YGWWYGVVGH  286
             IE  + W+ LR P       D +  + L +L+PGD+IEIQ R  K FP Y W + VV H
Sbjct  186  -IERDIPWNMLRMPPPKTYLVDYYEYNDLNNLKPGDYIEIQTRGRKAFPLYDWAHAVVCH  244

Query  285  LETCDGNQHYCRCHE  241
            LE+CD + ++C C +
Sbjct  245  LESCDQDVNHCSCKD  259



>gb|KDO54749.1| hypothetical protein CISIN_1g015516mg [Citrus sinensis]
Length=259

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/56 (82%), Positives = 50/56 (89%), Gaps = 2/56 (4%)
 Frame = -1

Query  651  PIDS--VMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHAR  490
            P+DS  +M WYLALE+G+FWFPAQVYNRENGHVGFMLSCYDAELSYD  TDTF AR
Sbjct  204  PVDSNSIMSWYLALETGRFWFPAQVYNRENGHVGFMLSCYDAELSYDQSTDTFQAR  259



>ref|XP_007162079.1| hypothetical protein PHAVU_001G122000g [Phaseolus vulgaris]
 gb|ESW34073.1| hypothetical protein PHAVU_001G122000g [Phaseolus vulgaris]
Length=238

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 10/111 (9%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG-RMA  466
            S M  Y+ LESG+FWFP Q+Y   N      L CYDA +SYD + DTF AR    G R+ 
Sbjct  136  SKMALYICLESGRFWFPVQLYKAAN------LLCYDAIVSYDSKRDTFKARCQTGGWRLT  189

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY  313
               E  + WDRLR+  V+    ++H+S+C+ DL+PGD IEIQ ++ K+ PY
Sbjct  190  ---EENIQWDRLRSSPVETSPREVHMSNCMNDLKPGDQIEIQLKKRKESPY  237



>gb|KEH26010.1| F-box plant-like protein [Medicago truncatula]
Length=323

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 77/135 (57%), Gaps = 7/135 (5%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHGRMAV  463
            S M  Y+ LE+G+FWFPAQVY         +L CYDA +SYD +TDTF AR P  GR   
Sbjct  131  SKMALYILLETGRFWFPAQVYK----ATLQILYCYDAIVSYDSKTDTFRARSPNLGRQ--  184

Query  462  AIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPY-GWWYGVVGH  286
             I+  + WD LR P       D +    L +L+PGD IEIQ RR   FP   W +G+V H
Sbjct  185  WIQGDIPWDMLRIPPPKTFLVDYYEYTDLDELKPGDLIEIQKRRRIGFPICDWAHGIVFH  244

Query  285  LETCDGNQHYCRCHE  241
            LE+C  + + C C +
Sbjct  245  LESCYEDVNNCSCQK  259



>gb|KHN30352.1| F-box protein [Glycine soja]
Length=296

 Score = 96.3 bits (238),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 67/112 (60%), Gaps = 10/112 (9%)
 Frame = -1

Query  642  SVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFHARYPPHG-RMA  466
            S M  Y++LESG FWFP QV+   N      L CYDA +SYD RTDTF +R P  G RM 
Sbjct  135  SKMALYISLESGLFWFPVQVFKITN------LFCYDAIVSYDSRTDTFKSRSPTGGWRM-  187

Query  465  VAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFPYG  310
              IE  +  DRLR    +      ++S+ + DL+PGDHIEIQ RR K+ PY 
Sbjct  188  --IEGNIQRDRLRLAPAETSPMTFYMSNSMNDLKPGDHIEIQIRRRKESPYN  237



>ref|XP_007145514.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
 gb|ESW17508.1| hypothetical protein PHAVU_007G244800g [Phaseolus vulgaris]
Length=299

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 70/121 (58%), Gaps = 15/121 (12%)
 Frame = -1

Query  675  GDKRNNLPPIDSVMFWYLALESGKFWFPAQVYNRENGHVGFMLSCYDAELSYDPRTDTFH  496
            G + NN      +M  Y +LESG FWFPAQVY          L  +DA ++YD +++TF 
Sbjct  121  GQQSNNF-----MMSLYFSLESGSFWFPAQVYKG--------LVIHDALVNYDSQSNTFQ  167

Query  495  ARYPPHGRMAVAIETGVTWDRLRAPLVDNPAHDLHISDCLYDLRPGDHIEIQWRRNKKFP  316
            ARY   G   +     + WD +RAPLVD P + +H+S    +L+P DHIEIQWR N + P
Sbjct  168  ARYQNGGWSCLG--RNIEWDMVRAPLVDTPPYLVHLSHFSDNLKPDDHIEIQWRSNTECP  225

Query  315  Y  313
            Y
Sbjct  226  Y  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340