BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030G16

Length=731
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009761273.1|  PREDICTED: uncharacterized protein LOC104213...  74.7    1e-12   Nicotiana sylvestris
ref|XP_009761274.1|  PREDICTED: uncharacterized protein LOC104213...  74.7    1e-12   Nicotiana sylvestris
ref|XP_009591329.1|  PREDICTED: uncharacterized protein LOC104088...  73.2    5e-12   Nicotiana tomentosiformis
ref|XP_009591328.1|  PREDICTED: uncharacterized protein LOC104088...  73.2    5e-12   Nicotiana tomentosiformis
ref|XP_007011971.1|  Calcineurin-like metallo-phosphoesterase sup...  63.5    2e-08   Theobroma cacao [chocolate]
ref|XP_004251764.1|  PREDICTED: uncharacterized protein LOC101246218  60.5    2e-07   Solanum lycopersicum
gb|KJB07373.1|  hypothetical protein B456_001G031300                  56.2    4e-06   Gossypium raimondii
gb|KJB07375.1|  hypothetical protein B456_001G031300                  56.2    6e-06   Gossypium raimondii
gb|KJB07380.1|  hypothetical protein B456_001G031300                  56.2    6e-06   Gossypium raimondii
ref|XP_008343907.1|  PREDICTED: uncharacterized protein LOC103406696  53.1    7e-06   
emb|CDP10206.1|  unnamed protein product                              53.9    4e-05   Coffea canephora [robusta coffee]
ref|XP_006453650.1|  hypothetical protein CICLE_v10009097mg           52.0    5e-05   
ref|XP_002523501.1|  conserved hypothetical protein                   53.5    5e-05   Ricinus communis
ref|XP_006453651.1|  hypothetical protein CICLE_v10009097mg           52.4    6e-05   
ref|XP_010656587.1|  PREDICTED: uncharacterized protein LOC100257...  52.4    1e-04   Vitis vinifera
ref|XP_011084007.1|  PREDICTED: uncharacterized protein LOC105166...  52.4    1e-04   Sesamum indicum [beniseed]
ref|XP_007202435.1|  hypothetical protein PRUPE_ppa009880mg           51.2    1e-04   
ref|XP_011084008.1|  PREDICTED: uncharacterized protein LOC105166...  52.0    1e-04   Sesamum indicum [beniseed]
ref|XP_006453654.1|  hypothetical protein CICLE_v10009097mg           52.0    2e-04   Citrus clementina [clementine]
ref|XP_009358478.1|  PREDICTED: uncharacterized protein LOC103949104  51.2    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_007202436.1|  hypothetical protein PRUPE_ppa009880mg           50.8    4e-04   Prunus persica
gb|KDP38654.1|  hypothetical protein JCGZ_04007                       50.8    4e-04   Jatropha curcas
ref|XP_009366153.1|  PREDICTED: uncharacterized protein LOC103955...  50.8    4e-04   
ref|XP_011033464.1|  PREDICTED: tartrate-resistant acid phosphata...  49.7    8e-04   Populus euphratica
ref|XP_006473983.1|  PREDICTED: uncharacterized protein LOC102628519  49.7    0.001   Citrus sinensis [apfelsine]



>ref|XP_009761273.1| PREDICTED: uncharacterized protein LOC104213467 isoform X1 [Nicotiana 
sylvestris]
Length=289

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDS-SNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AY+S +ACN++V+K  +  + +  +R  GP +   NQ   YSM+  NGFLLHKV+  EI
Sbjct  205  DAYISGQACNDNVEKRPVAKTKTGTARYKGPLITKVNQNLPYSMQNVNGFLLHKVSALEI  264

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
            V+Y VT EGD V+K+ L   RGK  M
Sbjct  265  VSYLVTLEGDVVQKIFLH-QRGKEIM  289



>ref|XP_009761274.1| PREDICTED: uncharacterized protein LOC104213467 isoform X2 [Nicotiana 
sylvestris]
Length=287

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDS-SNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AY+S +ACN++V+K  +  + +  +R  GP +   NQ   YSM+  NGFLLHKV+  EI
Sbjct  203  DAYISGQACNDNVEKRPVAKTKTGTARYKGPLITKVNQNLPYSMQNVNGFLLHKVSALEI  262

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
            V+Y VT EGD V+K+ L   RGK  M
Sbjct  263  VSYLVTLEGDVVQKIFLH-QRGKEIM  287



>ref|XP_009591329.1| PREDICTED: uncharacterized protein LOC104088376 isoform X2 [Nicotiana 
tomentosiformis]
Length=287

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDS-SNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AY+S +AC+++V+K  +  S +  +R  GP +   NQ   YSM+  NGFLLHKV+  EI
Sbjct  203  DAYISGQACDDNVEKRPIAKSKTGTARYRGPLLTKVNQNLPYSMQNVNGFLLHKVSALEI  262

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
            V+Y VT EGD  +K+ L   RGK  M
Sbjct  263  VSYLVTLEGDVAQKIFLH-QRGKEIM  287



>ref|XP_009591328.1| PREDICTED: uncharacterized protein LOC104088376 isoform X1 [Nicotiana 
tomentosiformis]
Length=289

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDS-SNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AY+S +AC+++V+K  +  S +  +R  GP +   NQ   YSM+  NGFLLHKV+  EI
Sbjct  205  DAYISGQACDDNVEKRPIAKSKTGTARYRGPLLTKVNQNLPYSMQNVNGFLLHKVSALEI  264

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
            V+Y VT EGD  +K+ L   RGK  M
Sbjct  265  VSYLVTLEGDVAQKIFLH-QRGKEIM  289



>ref|XP_007011971.1| Calcineurin-like metallo-phosphoesterase superfamily protein, 
putative [Theobroma cacao]
 gb|EOY29590.1| Calcineurin-like metallo-phosphoesterase superfamily protein, 
putative [Theobroma cacao]
Length=294

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 14/92 (15%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMI-------SANQEFLYSMEITNGFLLHK  371
            N YLS++ C++      L DS  V+ +  P +I       SAN  +L   E++NGFLLH+
Sbjct  210  NLYLSQQGCSSY----ALQDS--VAYIGNPGLIKENSHLPSANGRYLVRKEMSNGFLLHR  263

Query  370  VTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            ++  E+VTYFVTSEG  V K+ +Q  RGK  M
Sbjct  264  LSLLEMVTYFVTSEGKVVNKIVVQ-ERGKGVM  294



>ref|XP_004251764.1| PREDICTED: uncharacterized protein LOC101246218 [Solanum lycopersicum]
Length=290

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDS-SNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AY+S   C ++V++  +  S +++ R  GP +   NQ    SM   +GFLLHK +  EI
Sbjct  206  DAYISAPVCADNVEERHIAKSKTSIGRYKGPLLTKVNQNLPCSMGRVDGFLLHKASALEI  265

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
            V+Y VT EGD V+K  L   RGK  M
Sbjct  266  VSYLVTLEGDVVQKFFLH-QRGKDVM  290



>gb|KJB07373.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07379.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=229

 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 14/92 (15%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYS-------MEITNGFLLHK  371
            N YLS++ C +      L D  NV+ +  P +I  N    Y         E+T+GFLLH+
Sbjct  145  NVYLSQQGCFSY----ALQD--NVAYIGNPGLIKENSRLGYGNGRYRIRTEMTDGFLLHR  198

Query  370  VTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            +   E+VTYFVTS G+ V K+ +Q  RG+  M
Sbjct  199  LGSLEMVTYFVTSAGEIVNKIVVQ-QRGRQVM  229



>gb|KJB07375.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07377.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
 gb|KJB07378.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=295

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 14/92 (15%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYS-------MEITNGFLLHK  371
            N YLS++ C +      L D  NV+ +  P +I  N    Y         E+T+GFLLH+
Sbjct  211  NVYLSQQGCFSY----ALQD--NVAYIGNPGLIKENSRLGYGNGRYRIRTEMTDGFLLHR  264

Query  370  VTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            +   E+VTYFVTS G+ V K+ +Q  RG+  M
Sbjct  265  LGSLEMVTYFVTSAGEIVNKIVVQ-QRGRQVM  295



>gb|KJB07380.1| hypothetical protein B456_001G031300 [Gossypium raimondii]
Length=296

 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 14/92 (15%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYS-------MEITNGFLLHK  371
            N YLS++ C +      L D  NV+ +  P +I  N    Y         E+T+GFLLH+
Sbjct  212  NVYLSQQGCFSY----ALQD--NVAYIGNPGLIKENSRLGYGNGRYRIRTEMTDGFLLHR  265

Query  370  VTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            +   E+VTYFVTS G+ V K+ +Q  RG+  M
Sbjct  266  LGSLEMVTYFVTSAGEIVNKIVVQ-QRGRQVM  296



>ref|XP_008343907.1| PREDICTED: uncharacterized protein LOC103406696 [Malus domestica]
Length=104

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVY-GPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            NAYLS + C NS     L    N  ++  G  + S ++      ++ +GF LH+V+  EI
Sbjct  20   NAYLSGQGCANSPRSSSLSYIRNPGKMAAGAHLASVHETSASRRKLEDGFFLHRVSSLEI  79

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
             TYFVTS G+ V +  L   RGK  M
Sbjct  80   ETYFVTSAGEVVHRSVLH-QRGKEIM  104



>emb|CDP10206.1| unnamed protein product [Coffea canephora]
Length=281

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 39/78 (50%), Gaps = 1/78 (1%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRV-YGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            +AYLS  AC   V K       N  +   GP +    + F  + E  NG LLH+V+  E+
Sbjct  197  DAYLSGHACTEHVHKQSAKQPGNADQPGKGPCLTPIRRIFDQNKEKVNGLLLHRVSSLEL  256

Query  352  VTYFVTSEGDFVRKVALQ  299
            VTY +  EGD   K+ LQ
Sbjct  257  VTYSINLEGDVAHKIELQ  274



>ref|XP_006453650.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66890.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=179

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 11/85 (13%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            N YLS+  C     K    DS  ++ +  P +I +        E+ +GFLLHKV+  EI+
Sbjct  106  NTYLSKHGC----IKYSRQDS--ITYMENPGLIESGN----GREMVDGFLLHKVSSLEIL  155

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFVTSEG+ V + A +  RGK  M
Sbjct  156  TYFVTSEGEVVYRTATR-QRGKEVM  179



>ref|XP_002523501.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38840.1| conserved hypothetical protein [Ricinus communis]
Length=299

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 10/90 (11%)
 Frame = -2

Query  529  NAYLSRKACNN-----SVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVT  365
            NAYLSR  C N     SV   G+ D         P+M S N    +  E+  GFLLH+V 
Sbjct  215  NAYLSRGGCANHTFQDSVAYIGIADPIKSE----PEMASLNGSLAFQKEVEIGFLLHRVN  270

Query  364  DFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
              E+ TY VT  G+ V K+ +Q  RG+  M
Sbjct  271  SLEMATYSVTLTGEVVNKILVQ-QRGREFM  299



>ref|XP_006453651.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66891.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=195

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 11/85 (13%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            N YLS+  C     K    DS  ++ +  P +I +        E+ +GFLLHKV+  EI+
Sbjct  122  NTYLSKHGC----IKYSRQDS--ITYMENPGLIESGN----GREMVDGFLLHKVSSLEIL  171

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFVTSEG+ V + A +  RGK  M
Sbjct  172  TYFVTSEGEVVYRTATR-QRGKEVM  195



>ref|XP_010656587.1| PREDICTED: uncharacterized protein LOC100257638 isoform X3 [Vitis 
vinifera]
 ref|XP_010656588.1| PREDICTED: uncharacterized protein LOC100257638 isoform X3 [Vitis 
vinifera]
Length=296

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRV-YGPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            + YLS + C++   K  +    N   +     + S NQ   +S  + NGFLLH+V+  EI
Sbjct  212  DVYLSGEGCSDYARKDSIAYIRNPGSIDEKLPLASVNQISGFSKGMVNGFLLHRVSSLEI  271

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
             TYFV S G+ V  V LQ  RGKA M
Sbjct  272  ETYFVNSAGEVVHDVVLQ-QRGKAAM  296



>ref|XP_011084007.1| PREDICTED: uncharacterized protein LOC105166369 isoform X1 [Sesamum 
indicum]
Length=293

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 11/120 (9%)
 Frame = -2

Query  607  NPVILLDISISRIHPQR----LNTCCLPF*-NAYLSRKACNNSVDKGGLDDSSNVSRV-Y  446
            +P+I  D +I +I  +     L+T    +  +AY+S K C   + +G     S++ RV  
Sbjct  176  HPLISCDYNIQKIGKETSFEPLHTMLQQYGADAYMSMKTCAGHL-QGEAMWLSDIGRVNK  234

Query  445  GPDMISANQEFL---YSMEITNGFLLHKVTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            GP + + N       YS E  NGFLLH+V   E+VT+ V+  G+   K+++Q  RG+A M
Sbjct  235  GPHITAVNPNLASKDYSRETVNGFLLHRVNSLEMVTFVVSLNGEVEHKLSIQ-QRGRAVM  293



>ref|XP_007202435.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
 gb|EMJ03634.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
Length=196

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 42/85 (49%), Gaps = 19/85 (22%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            NAYLS + C +SV +  L    N                    ++ +GFLLH+V+  EIV
Sbjct  131  NAYLSAQGCASSVRRHSLSYLGNTG------------------QMEDGFLLHRVSTLEIV  172

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFV+S G+ V K  L   RGK  M
Sbjct  173  TYFVSSGGEVVHKSVLH-QRGKEIM  196



>ref|XP_011084008.1| PREDICTED: uncharacterized protein LOC105166369 isoform X2 [Sesamum 
indicum]
Length=265

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 11/120 (9%)
 Frame = -2

Query  607  NPVILLDISISRIHPQR----LNTCCLPF*-NAYLSRKACNNSVDKGGLDDSSNVSRV-Y  446
            +P+I  D +I +I  +     L+T    +  +AY+S K C   + +G     S++ RV  
Sbjct  148  HPLISCDYNIQKIGKETSFEPLHTMLQQYGADAYMSMKTCAGHL-QGEAMWLSDIGRVNK  206

Query  445  GPDMISANQEFL---YSMEITNGFLLHKVTDFEIVTYFVTSEGDFVRKVALQPPRGKANM  275
            GP + + N       YS E  NGFLLH+V   E+VT+ V+  G+   K+++Q  RG+A M
Sbjct  207  GPHITAVNPNLASKDYSRETVNGFLLHRVNSLEMVTFVVSLNGEVEHKLSIQ-QRGRAVM  265



>ref|XP_006453654.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
 gb|ESR66894.1| hypothetical protein CICLE_v10009097mg [Citrus clementina]
Length=289

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 47/85 (55%), Gaps = 11/85 (13%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            N YLS+  C     K    DS  ++ +  P +I +        E+ +GFLLHKV+  EI+
Sbjct  216  NTYLSKHGC----IKYSRQDS--ITYMENPGLIESGN----GREMVDGFLLHKVSSLEIL  265

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFVTSEG+ V + A +  RGK  M
Sbjct  266  TYFVTSEGEVVYRTATR-QRGKEVM  289



>ref|XP_009358478.1| PREDICTED: uncharacterized protein LOC103949104 [Pyrus x bretschneideri]
Length=287

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 46/85 (54%), Gaps = 8/85 (9%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            NAYLS + C +S    GL   SN+     P  ++A    L   ++ +GFLLH+V+  EI 
Sbjct  211  NAYLSGQGCASST---GLSSLSNIR---NPGKMAAPSARL-CRKLKDGFLLHRVSSLEIE  263

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TY VTS G+ V K  L   RGK  M
Sbjct  264  TYIVTSAGEVVHKSVLH-QRGKEIM  287



>ref|XP_007202436.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
 gb|EMJ03635.1| hypothetical protein PRUPE_ppa009880mg [Prunus persica]
Length=273

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 42/85 (49%), Gaps = 19/85 (22%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            NAYLS + C +SV +  L    N                    ++ +GFLLH+V+  EIV
Sbjct  208  NAYLSAQGCASSVRRHSLSYLGNTG------------------QMEDGFLLHRVSTLEIV  249

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFV+S G+ V K  L   RGK  M
Sbjct  250  TYFVSSGGEVVHKSVLH-QRGKEIM  273



>gb|KDP38654.1| hypothetical protein JCGZ_04007 [Jatropha curcas]
Length=299

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 7/81 (9%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLD----DSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTD  362
            N YLS + C N   +GG+        N S+   P   S N    +  E+ +GFLLH+V  
Sbjct  215  NVYLSTQGCVNHTFQGGVAYIGIADPNKSK---PYEASLNGSSAFQGEMDDGFLLHRVGS  271

Query  361  FEIVTYFVTSEGDFVRKVALQ  299
             EI TYFVTS G+ V K  +Q
Sbjct  272  LEIATYFVTSRGEVVYKNLIQ  292



>ref|XP_009366153.1| PREDICTED: uncharacterized protein LOC103955964 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009366154.1| PREDICTED: uncharacterized protein LOC103955964 isoform X2 [Pyrus 
x bretschneideri]
Length=295

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVY-GPDMISANQEFLYSMEITNGFLLHKVTDFEI  353
            NAYLSR+ C +S     L    N  ++  G  + S N+      ++ +GF LH+V+  EI
Sbjct  211  NAYLSRQGCASSPRLSSLSYIRNPGKMAAGAYLASVNETSASRRKLEDGFFLHRVSSLEI  270

Query  352  VTYFVTSEGDFVRKVALQPPRGKANM  275
             T FVTS G+ V +  L   RGK  M
Sbjct  271  ETCFVTSAGEVVHRSVLH-QRGKEIM  295



>ref|XP_011033464.1| PREDICTED: tartrate-resistant acid phosphatase type 5-like [Populus 
euphratica]
Length=296

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 5/89 (6%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSM----EITNGFLLHKVTD  362
            NAY+SR+ CN    + G+        +    + S+N+   +       + + FLLH+V  
Sbjct  209  NAYISRQGCNCHTVQDGVAYIGIADSIESEPLNSSNRRLAFRSFHRDTVNDWFLLHRVGS  268

Query  361  FEIVTYFVTSEGDFVRKVALQPPRGKANM  275
             EI TYFV+S G  V K  ++  RGK +M
Sbjct  269  LEITTYFVSSAGKIVNKAVIK-QRGKVDM  296



>ref|XP_006473983.1| PREDICTED: uncharacterized protein LOC102628519 [Citrus sinensis]
 gb|KDO59426.1| hypothetical protein CISIN_1g022941mg [Citrus sinensis]
Length=289

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 11/85 (13%)
 Frame = -2

Query  529  NAYLSRKACNNSVDKGGLDDSSNVSRVYGPDMISANQEFLYSMEITNGFLLHKVTDFEIV  350
            N YLS+  C     K    DS  ++ +  P +I +        E+ +GFLLHKV+  EI+
Sbjct  216  NTYLSKHGC----IKYSRQDS--ITYMENPGLIESGN----GREMVDGFLLHKVSSLEIL  265

Query  349  TYFVTSEGDFVRKVALQPPRGKANM  275
            TYFVT EG+ V + A +  RGK  M
Sbjct  266  TYFVTLEGEVVYRTATR-ERGKEVM  289



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470