BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030F21

Length=651
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP05185.1|  unnamed protein product                                308   6e-99   Coffea canephora [robusta coffee]
ref|XP_009605985.1|  PREDICTED: cleavage and polyadenylation spec...    303   1e-95   Nicotiana tomentosiformis
ref|XP_009605984.1|  PREDICTED: cleavage and polyadenylation spec...    303   1e-95   
ref|XP_004166238.1|  PREDICTED: cleavage and polyadenylation spec...    289   6e-95   
ref|XP_009789216.1|  PREDICTED: cleavage and polyadenylation spec...    304   9e-95   Nicotiana sylvestris
ref|XP_006353867.1|  PREDICTED: cleavage and polyadenylation spec...    302   3e-94   Solanum tuberosum [potatoes]
ref|XP_009605983.1|  PREDICTED: cleavage and polyadenylation spec...    302   4e-94   Nicotiana tomentosiformis
ref|XP_004234405.1|  PREDICTED: cleavage and polyadenylation spec...    302   5e-94   Solanum lycopersicum
ref|XP_011084423.1|  PREDICTED: cleavage and polyadenylation spec...    300   4e-93   Sesamum indicum [beniseed]
ref|XP_010662728.1|  PREDICTED: cleavage and polyadenylation spec...    294   1e-91   Vitis vinifera
gb|KDP24115.1|  hypothetical protein JCGZ_25772                         295   3e-91   Jatropha curcas
gb|KHG29898.1|  Cleavage and polyadenylation specificity factor s...    293   4e-91   Gossypium arboreum [tree cotton]
ref|XP_007038718.1|  Cleavage and polyadenylation specificity fac...    294   5e-91   
ref|XP_002268591.1|  PREDICTED: cleavage and polyadenylation spec...    294   6e-91   Vitis vinifera
ref|XP_006587304.1|  PREDICTED: cleavage and polyadenylation spec...    291   9e-91   Glycine max [soybeans]
ref|XP_010671862.1|  PREDICTED: cleavage and polyadenylation spec...    291   1e-90   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB52780.1|  hypothetical protein B456_008G276300                    293   1e-90   Gossypium raimondii
ref|XP_002517902.1|  cleavage and polyadenylation specificity fac...    293   2e-90   Ricinus communis
ref|XP_008439247.1|  PREDICTED: cleavage and polyadenylation spec...    291   6e-90   Cucumis melo [Oriental melon]
ref|XP_006587303.1|  PREDICTED: cleavage and polyadenylation spec...    291   7e-90   
ref|XP_010671861.1|  PREDICTED: cleavage and polyadenylation spec...    291   9e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010035148.1|  PREDICTED: cleavage and polyadenylation spec...    290   1e-89   Eucalyptus grandis [rose gum]
ref|XP_010255376.1|  PREDICTED: cleavage and polyadenylation spec...    290   1e-89   Nelumbo nucifera [Indian lotus]
ref|XP_010035149.1|  PREDICTED: cleavage and polyadenylation spec...    290   1e-89   Eucalyptus grandis [rose gum]
ref|XP_008374076.1|  PREDICTED: cleavage and polyadenylation spec...    286   1e-89   Malus domestica [apple tree]
ref|XP_008374075.1|  PREDICTED: cleavage and polyadenylation spec...    286   2e-89   Malus domestica [apple tree]
ref|XP_004140773.1|  PREDICTED: cleavage and polyadenylation spec...    290   2e-89   Cucumis sativus [cucumbers]
gb|EYU19552.1|  hypothetical protein MIMGU_mgv1a0019022mg               284   2e-89   Erythranthe guttata [common monkey flower]
ref|XP_006587302.1|  PREDICTED: cleavage and polyadenylation spec...    290   2e-89   Glycine max [soybeans]
ref|XP_008234231.1|  PREDICTED: cleavage and polyadenylation spec...    288   6e-89   Prunus mume [ume]
ref|XP_008234230.1|  PREDICTED: cleavage and polyadenylation spec...    288   6e-89   Prunus mume [ume]
gb|KDO52014.1|  hypothetical protein CISIN_1g004656mg                   288   6e-89   Citrus sinensis [apfelsine]
ref|XP_006490412.1|  PREDICTED: cleavage and polyadenylation spec...    288   8e-89   
ref|XP_006421948.1|  hypothetical protein CICLE_v10004414mg             288   9e-89   Citrus clementina [clementine]
ref|XP_007220238.1|  hypothetical protein PRUPE_ppa001928mg             286   3e-88   Prunus persica
ref|XP_004499957.1|  PREDICTED: cleavage and polyadenylation spec...    286   7e-88   Cicer arietinum [garbanzo]
ref|XP_008376608.1|  PREDICTED: cleavage and polyadenylation spec...    286   8e-88   
ref|XP_010934798.1|  PREDICTED: cleavage and polyadenylation spec...    285   9e-88   Elaeis guineensis
ref|XP_008787501.1|  PREDICTED: cleavage and polyadenylation spec...    285   9e-88   Phoenix dactylifera
ref|XP_009342955.1|  PREDICTED: cleavage and polyadenylation spec...    285   9e-88   Pyrus x bretschneideri [bai li]
ref|XP_009342954.1|  PREDICTED: cleavage and polyadenylation spec...    285   9e-88   Pyrus x bretschneideri [bai li]
ref|XP_008376609.1|  PREDICTED: cleavage and polyadenylation spec...    285   1e-87   
ref|XP_003548179.1|  PREDICTED: cleavage and polyadenylation spec...    285   2e-87   Glycine max [soybeans]
gb|KEH41412.1|  cleavage and polyadenylation specificity factor s...    284   4e-87   Medicago truncatula
ref|XP_007152251.1|  hypothetical protein PHAVU_004G114000g             283   1e-86   Phaseolus vulgaris [French bean]
ref|XP_010108351.1|  Cleavage and polyadenylation specificity fac...    280   1e-85   Morus notabilis
ref|XP_009401035.1|  PREDICTED: cleavage and polyadenylation spec...    279   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011008814.1|  PREDICTED: cleavage and polyadenylation spec...    277   1e-84   Populus euphratica
ref|XP_006369487.1|  Cleavage and polyadenylation specificity fac...    277   2e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006394646.1|  hypothetical protein EUTSA_v10003707mg             275   7e-84   Eutrema salsugineum [saltwater cress]
gb|KDO52015.1|  hypothetical protein CISIN_1g004656mg                   275   7e-84   Citrus sinensis [apfelsine]
ref|XP_002872080.1|  CPSF100                                            273   6e-83   
ref|XP_010454671.1|  PREDICTED: cleavage and polyadenylation spec...    273   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010493506.1|  PREDICTED: cleavage and polyadenylation spec...    273   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010550556.1|  PREDICTED: cleavage and polyadenylation spec...    273   8e-83   Tarenaya hassleriana [spider flower]
ref|XP_010421194.1|  PREDICTED: cleavage and polyadenylation spec...    272   8e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006287134.1|  hypothetical protein CARUB_v10000306mg             272   8e-83   Capsella rubella
ref|XP_010421193.1|  PREDICTED: cleavage and polyadenylation spec...    272   8e-83   Camelina sativa [gold-of-pleasure]
gb|AAF82809.1|AF283277_1  polyadenylation cleavage/specificity fa...    271   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197776.1|  cleavage and polyadenylation specificity factor...    271   4e-82   Arabidopsis thaliana [mouse-ear cress]
gb|KFK27677.1|  hypothetical protein AALP_AA8G414300                    270   4e-82   Arabis alpina [alpine rockcress]
emb|CDX88053.1|  BnaA06g26440D                                          270   5e-82   
emb|CDX80392.1|  BnaC07g30520D                                          270   7e-82   
ref|XP_009150911.1|  PREDICTED: cleavage and polyadenylation spec...    270   8e-82   Brassica rapa
gb|KHN19838.1|  Cleavage and polyadenylation specificity factor s...    252   3e-81   Glycine soja [wild soybean]
ref|XP_009340044.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...    268   4e-81   
ref|XP_004308076.1|  PREDICTED: cleavage and polyadenylation spec...    266   1e-80   Fragaria vesca subsp. vesca
gb|KHN18612.1|  Cleavage and polyadenylation specificity factor s...    251   1e-79   Glycine soja [wild soybean]
ref|NP_001063978.1|  Os09g0569400                                       263   2e-79   
ref|XP_006661571.1|  PREDICTED: cleavage and polyadenylation spec...    263   4e-79   Oryza brachyantha
ref|XP_006827641.1|  hypothetical protein AMTR_s00009p00247750          260   4e-78   Amborella trichopoda
ref|XP_003578687.1|  PREDICTED: cleavage and polyadenylation spec...    259   9e-78   Brachypodium distachyon [annual false brome]
ref|XP_010230345.1|  PREDICTED: cleavage and polyadenylation spec...    259   1e-77   Brachypodium distachyon [annual false brome]
ref|XP_010238537.1|  PREDICTED: cleavage and polyadenylation spec...    259   1e-77   Brachypodium distachyon [annual false brome]
ref|XP_003565596.1|  PREDICTED: cleavage and polyadenylation spec...    259   1e-77   Brachypodium distachyon [annual false brome]
gb|EMT31904.1|  hypothetical protein F775_28078                         256   1e-76   
gb|KHN41472.1|  Cleavage and polyadenylation specificity factor s...    256   2e-76   Glycine soja [wild soybean]
gb|EMS56660.1|  Cleavage and polyadenylation specificity factor s...    254   6e-76   Triticum urartu
ref|XP_003590278.1|  Cleavage and polyadenylation specificity fac...    239   9e-76   
dbj|BAJ85972.1|  predicted protein                                      253   1e-75   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002466129.1|  hypothetical protein SORBIDRAFT_01g001930          248   2e-73   Sorghum bicolor [broomcorn]
ref|NP_001151557.1|  LOC100285191                                       244   1e-72   Zea mays [maize]
ref|XP_008673000.1|  PREDICTED: LOC100285191 isoform X1                 244   5e-72   
ref|XP_004956221.1|  PREDICTED: cleavage and polyadenylation spec...    243   7e-72   Setaria italica
gb|EEC85091.1|  hypothetical protein OsI_32459                          239   8e-69   Oryza sativa Indica Group [Indian rice]
tpg|DAA59080.1|  TPA: hypothetical protein ZEAMMB73_548570              232   1e-67   
ref|XP_001757858.1|  predicted protein                                  231   2e-67   
ref|XP_002971541.1|  hypothetical protein SELMODRAFT_441578             218   1e-62   
ref|XP_002991596.1|  hypothetical protein SELMODRAFT_429848             204   1e-57   
ref|XP_006591227.1|  PREDICTED: cleavage and polyadenylation spec...    168   3e-49   Glycine max [soybeans]
ref|XP_008374080.1|  PREDICTED: cleavage and polyadenylation spec...    148   1e-41   
ref|XP_006421947.1|  hypothetical protein CICLE_v10004414mg             138   4e-34   
ref|XP_001955372.1|  GF16269                                            122   3e-28   Drosophila ananassae
ref|XP_002013649.1|  GL24248                                            119   1e-27   
ref|NP_651658.1|  cleavage and polyadenylation specificity factor...    120   1e-27   Drosophila melanogaster
ref|XP_002098643.1|  GE26465, isoform A                                 120   1e-27   
ref|XP_002054797.1|  GJ24636                                            120   2e-27   
ref|XP_001981406.1|  GG11633                                            120   2e-27   Drosophila erecta
ref|XP_002105288.1|  GD21403                                            119   3e-27   
ref|XP_002037143.1|  GM12754                                            119   3e-27   Drosophila sechellia
ref|XP_011203816.1|  PREDICTED: probable cleavage and polyadenyla...    119   4e-27   Bactrocera dorsalis [papaya fruit fly]
gb|EEE70266.1|  hypothetical protein OsJ_30409                          119   7e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002071979.1|  GK22564                                            117   2e-26   Drosophila willistoni
ref|XP_001994270.1|  GH10247                                            116   4e-26   Drosophila grimshawi
ref|XP_001999467.1|  GI23051                                            116   5e-26   Drosophila mojavensis
ref|XP_004519762.1|  PREDICTED: LOW QUALITY PROTEIN: probable cle...    114   2e-25   
ref|XP_005178538.1|  PREDICTED: probable cleavage and polyadenyla...    114   2e-25   Musca domestica
ref|XP_011184046.1|  PREDICTED: probable cleavage and polyadenyla...    114   3e-25   Zeugodacus cucurbitae [melon fruit fly]
emb|CDS10120.1|  hypothetical protein LRAMOSA02797                      109   9e-24   Lichtheimia ramosa
gb|EPB87138.1|  hypothetical protein HMPREF1544_06064                   108   2e-23   Mucor circinelloides f. circinelloides 1006PhL
emb|CDH57001.1|  cleavage and polyadenylation specificity factors...    108   3e-23   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001657690.1|  AAEL000118-PA                                      107   5e-23   
emb|CEJ03741.1|  hypothetical protein RMCBS344292_17719                 103   2e-22   Rhizopus microsporus
ref|XP_011409895.1|  PREDICTED: cleavage and polyadenylation spec...    105   2e-22   
ref|XP_005649512.1|  hypothetical protein COCSUDRAFT_83661              104   6e-22   Coccomyxa subellipsoidea C-169
ref|XP_008193780.1|  PREDICTED: probable cleavage and polyadenyla...    103   8e-22   Tribolium castaneum [rust-red flour beetle]
emb|CEF96643.1|  Beta-lactamase-like                                    103   1e-21   Ostreococcus tauri
ref|XP_004205466.1|  PREDICTED: cleavage and polyadenylation spec...    102   1e-21   
ref|XP_003074308.1|  polyadenylation cleavage/specificity factor ...    103   1e-21   
ref|XP_008913556.1|  hypothetical protein, variant                      103   1e-21   Phytophthora parasitica INRA-310
ref|XP_008913555.1|  hypothetical protein PPTG_17632                    103   1e-21   Phytophthora parasitica INRA-310
gb|KFM58192.1|  Cleavage and polyadenylation specificity factor s...    102   2e-21   Stegodyphus mimosarum
dbj|GAN08051.1|  cleavage and polyadenylation specificity factor ...    102   2e-21   Mucor ambiguus
emb|CCA21717.1|  cleavage and polyadenylation specificity factor ...    101   5e-21   Albugo laibachii Nc14
gb|ENN73673.1|  hypothetical protein YQE_09718                          100   1e-20   Dendroctonus ponderosae
ref|XP_001638458.1|  predicted protein                                  100   1e-20   Nematostella vectensis
ref|XP_001415490.1|  predicted protein                                99.8    2e-20   Ostreococcus lucimarinus CCE9901
gb|ELU12868.1|  hypothetical protein CAPTEDRAFT_155355                99.0    5e-20   Capitella teleta
gb|EFA82503.1|  beta-lactamase domain-containing protein              98.2    7e-20   Heterostelium album PN500
ref|XP_003737143.1|  PREDICTED: probable cleavage and polyadenyla...  98.2    8e-20   
ref|XP_003737144.1|  PREDICTED: probable cleavage and polyadenyla...  98.2    9e-20   
ref|XP_003737142.1|  PREDICTED: probable cleavage and polyadenyla...  98.2    9e-20   
ref|XP_312464.4|  AGAP002474-PA                                       97.8    1e-19   Anopheles gambiae str. PEST
ref|XP_001850949.1|  cleavage and polyadenylation specificity fac...  97.8    1e-19   Culex quinquefasciatus
ref|XP_011305603.1|  PREDICTED: probable cleavage and polyadenyla...  97.1    2e-19   Fopius arisanus
ref|XP_005112434.1|  PREDICTED: cleavage and polyadenylation spec...  92.4    2e-19   
emb|CEG66667.1|  hypothetical protein RMATCC62417_03206               92.0    3e-19   Rhizopus microsporus
ref|XP_011500980.1|  PREDICTED: probable cleavage and polyadenyla...  96.7    3e-19   Ceratosolen solmsi marchali
ref|XP_009061638.1|  hypothetical protein LOTGIDRAFT_234977           94.7    3e-19   Lottia gigantea
ref|XP_002431330.1|  Cleavage and polyadenylation specificity fac...  96.3    4e-19   Pediculus humanus corporis [human body lice]
gb|ETN63991.1|  cleavage and polyadenylation specificity factor       95.9    5e-19   Anopheles darlingi [American malaria mosquito]
ref|XP_008869265.1|  hypothetical protein H310_06119                  95.5    6e-19   Aphanomyces invadans
ref|XP_009826607.1|  hypothetical protein H257_03975                  95.5    7e-19   Aphanomyces astaci
ref|XP_009826616.1|  hypothetical protein, variant 1                  95.5    8e-19   Aphanomyces astaci
ref|XP_002137430.2|  GA26549                                          95.1    8e-19   
ref|XP_006613635.1|  PREDICTED: probable cleavage and polyadenyla...  95.1    9e-19   Apis dorsata [rock honeybee]
ref|XP_003701904.1|  PREDICTED: probable cleavage and polyadenyla...  95.1    1e-18   Megachile rotundata
gb|EFN82620.1|  Probable cleavage and polyadenylation specificity...  94.7    1e-18   Harpegnathos saltator
ref|XP_011170847.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   
ref|XP_003696322.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   Apis florea [dwarf honeybee]
ref|XP_011142384.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   Harpegnathos saltator
ref|XP_006561139.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   
ref|XP_003485880.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   Bombus impatiens
dbj|GAM28904.1|  hypothetical protein SAMD00019534_120800             94.7    1e-18   Acytostelium subglobosum LB1
ref|XP_003395491.1|  PREDICTED: probable cleavage and polyadenyla...  94.7    1e-18   Bombus terrestris [large earth bumblebee]
ref|XP_011049258.1|  PREDICTED: probable cleavage and polyadenyla...  94.4    1e-18   Acromyrmex echinatior
emb|CCI40993.1|  unnamed protein product                              94.4    2e-18   Albugo candida
ref|XP_011258461.1|  PREDICTED: probable cleavage and polyadenyla...  93.6    3e-18   
gb|EZA60898.1|  putative cleavage and polyadenylation specificity...  93.6    3e-18   Ooceraea biroi
ref|XP_011351985.1|  PREDICTED: probable cleavage and polyadenyla...  93.6    3e-18   
gb|KDR21766.1|  putative cleavage and polyadenylation specificity...  93.2    4e-18   Zootermopsis nevadensis
ref|XP_002997000.1|  cleavage and polyadenylation specificity fac...  92.0    5e-18   Phytophthora infestans T30-4
ref|XP_009516751.1|  hypothetical protein PHYSODRAFT_552782           92.0    5e-18   Phytophthora sojae
ref|XP_004340269.1|  cleavage and polyadenylation specificity fac...  92.4    9e-18   Acanthamoeba castellanii str. Neff
ref|XP_008216190.1|  PREDICTED: probable cleavage and polyadenyla...  91.7    1e-17   Nasonia vitripennis
emb|CEP08367.1|  hypothetical protein                                 90.9    2e-17   Parasitella parasitica
ref|XP_008613583.1|  hypothetical protein SDRG_09428                  90.9    2e-17   Saprolegnia diclina VS20
gb|KDO26595.1|  hypothetical protein SPRG_07999                       90.9    3e-17   Saprolegnia parasitica CBS 223.65
ref|XP_011417088.1|  PREDICTED: cleavage and polyadenylation spec...  87.8    4e-17   
gb|EPZ32528.1|  Beta-Casp domain-containing protein                   90.1    5e-17   Rozella allomycis CSF55
ref|XP_002115881.1|  hypothetical protein TRIADDRAFT_30006            89.7    6e-17   Trichoplax adhaerens
ref|XP_006812203.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  89.4    8e-17   Saccoglossus kowalevskii
gb|ESA21701.1|  hypothetical protein GLOINDRAFT_119294                89.0    1e-16   
ref|XP_008555333.1|  PREDICTED: probable cleavage and polyadenyla...  87.4    4e-16   
gb|KFB52768.1|  hypothetical protein ZHAS_00021031                    87.0    5e-16   Anopheles sinensis
gb|KFD52003.1|  hypothetical protein M513_07135                       84.3    4e-15   Trichuris suis
gb|EHJ67102.1|  putative cleavage and polyadenylation specificity...  84.0    5e-15   
ref|XP_646760.1|  beta-lactamase domain-containing protein            84.0    6e-15   Dictyostelium discoideum AX4
ref|XP_005825644.1|  hypothetical protein GUITHDRAFT_89302            84.0    6e-15   Guillardia theta CCMP2712
gb|KHJ48938.1|  cleavage and polyadenylation specificity factor s...  83.2    9e-15   Trichuris suis
emb|CDJ87806.1|  Beta-lactamase and RNA-metabolising metallo-beta...  83.2    1e-14   Haemonchus contortus [red stomach worm]
gb|KIH44351.1|  RNA-metabolizing metallo-beta-lactamase               79.3    1e-14   Ancylostoma duodenale
emb|CDJ83222.1|  unnamed protein product                              82.8    1e-14   Haemonchus contortus [red stomach worm]
ref|XP_001949295.2|  PREDICTED: probable cleavage and polyadenyla...  82.8    1e-14   
ref|XP_002673225.1|  predicted protein                                82.0    3e-14   Naegleria gruberi strain NEG-M
gb|KHJ99454.1|  RNA-metabolizing metallo-beta-lactamase               81.3    4e-14   Oesophagostomum dentatum [nodule worm]
emb|CCJ29043.1|  unnamed protein product                              81.3    4e-14   Pneumocystis jirovecii
ref|XP_001749611.1|  hypothetical protein                             81.3    4e-14   Monosiga brevicollis MX1
ref|XP_004927215.1|  PREDICTED: probable cleavage and polyadenyla...  80.5    7e-14   
ref|XP_007343506.1|  hypothetical protein AURDEDRAFT_183466           80.5    7e-14   
ref|XP_004366024.2|  cleavage and polyadenylation specificity factor  80.5    8e-14   Capsaspora owczarzaki ATCC 30864
gb|EFX73157.1|  hypothetical protein DAPPUDRAFT_58164                 79.7    1e-13   Daphnia pulex
gb|KIH66261.1|  metallo-beta-lactamase domain protein                 79.7    1e-13   Ancylostoma duodenale
ref|XP_003375603.1|  cleavage and polyadenylation specificity fac...  79.7    1e-13   Trichinella spiralis
gb|EYC31771.1|  hypothetical protein Y032_0003g1227                   79.3    2e-13   Ancylostoma ceylanicum
emb|CDW57805.1|  cleavage and polyadenylation                         79.3    2e-13   Trichuris trichiura
ref|XP_002174386.1|  cleavage factor two Cft2/polyadenylation fac...  78.6    3e-13   Schizosaccharomyces japonicus yFS275
ref|XP_005706067.1|  cleavage and polyadenylation specificity fac...  78.6    3e-13   Galdieria sulphuraria
gb|ETN79077.1|  RNA-metabolizing metallo-beta-lactamase               78.6    3e-13   Necator americanus
gb|KIM25567.1|  hypothetical protein M408DRAFT_74190                  78.6    3e-13   Serendipita vermifera MAFF 305830
ref|XP_002461998.1|  hypothetical protein SORBIDRAFT_02g012333        69.7    2e-12   
emb|CEL63693.1|  Cleavage factor two protein 2 OS=Schizosaccharom...  75.9    2e-12   Rhizoctonia solani AG-1 IB
emb|CCO31905.1|  Cleavage factor two protein 2                        72.4    2e-12   Rhizoctonia solani AG-1 IB
gb|EPX74257.1|  cleavage factor two Cft2/polyadenylation factor C...  75.9    3e-12   Schizosaccharomyces octosporus yFS286
gb|EPY49380.1|  cleavage factor two Cft2/polyadenylation factor C...  75.1    4e-12   Schizosaccharomyces cryophilus OY26
ref|XP_003289932.1|  hypothetical protein DICPUDRAFT_80682            74.3    7e-12   Dictyostelium purpureum
ref|XP_007875190.1|  hypothetical protein PNEG_03132                  72.4    7e-12   Pneumocystis murina B123
gb|KIJ56611.1|  hypothetical protein M422DRAFT_22765                  74.7    7e-12   Sphaerobolus stellatus SS14
emb|CDS29353.1|  cleavage and polyadenylation                         74.3    9e-12   
gb|KIY74198.1|  hypothetical protein CYLTODRAFT_433892                73.9    1e-11   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_001951701.1|  PREDICTED: probable cleavage and polyadenyla...  73.9    1e-11   Acyrthosiphon pisum
ref|XP_009170171.1|  hypothetical protein T265_06603                  73.9    1e-11   Opisthorchis viverrini [Southeast Asian liver fluke]
gb|KJA29848.1|  hypothetical protein HYPSUDRAFT_31856                 73.6    1e-11   Hypholoma sublateritium FD-334 SS-4
ref|XP_008869266.1|  hypothetical protein, variant                    73.6    1e-11   Aphanomyces invadans
gb|EUB58147.1|  putative cleavage and polyadenylation specificity...  73.6    1e-11   Echinococcus granulosus
emb|CDS19808.1|  cleavage and polyadenylation                         73.6    1e-11   Echinococcus granulosus
gb|KDQ20588.1|  hypothetical protein BOTBODRAFT_100390                73.6    2e-11   Botryobasidium botryosum FD-172 SS1
emb|CCA69065.1|  hypothetical protein PIIN_02923                      73.2    2e-11   Serendipita indica DSM 11827
ref|XP_009826610.1|  hypothetical protein, variant 4                  72.8    2e-11   Aphanomyces astaci
gb|KEP55348.1|  cleavage and polyadenylation specificity factor s...  72.8    2e-11   Rhizoctonia solani 123E
gb|EUC66413.1|  cleavage and polyadenylation specificity factor s...  72.8    2e-11   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_005715060.1|  Cleavage and polyadenylation specificity fac...  72.8    3e-11   Chondrus crispus [carageen]
emb|CDI98145.1|  cleavage and polyadenylation                         72.8    3e-11   Echinococcus multilocularis
dbj|GAA43367.2|  cleavage and polyadenylation specificity factor ...  72.0    5e-11   Clonorchis sinensis [oriental liver fluke]
gb|KIP10693.1|  hypothetical protein PHLGIDRAFT_33762                 71.6    5e-11   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_007364154.1|  hypothetical protein DICSQDRAFT_135076           71.6    6e-11   Dichomitus squalens LYAD-421 SS1
ref|XP_002606625.1|  hypothetical protein BRAFLDRAFT_209615           71.2    6e-11   Branchiostoma floridae
ref|XP_007391806.1|  hypothetical protein PHACADRAFT_249539           71.2    7e-11   Phanerochaete carnosa HHB-10118-sp
gb|KII61653.1|  putative cleavage and polyadenylation specificity...  70.5    1e-10   Thelohanellus kitauei
ref|XP_007268417.1|  cleavage and polyadenylation specificity fac...  70.1    2e-10   Fomitiporia mediterranea MF3/22
gb|KHN82608.1|  putative cleavage and polyadenylation specificity...  69.7    2e-10   Toxocara canis
ref|XP_002129804.1|  PREDICTED: cleavage and polyadenylation spec...  69.3    3e-10   
ref|XP_004352034.1|  beta-lactamase domain-containing protein         68.2    7e-10   Cavenderia fasciculata
ref|XP_009021832.1|  hypothetical protein HELRODRAFT_113444           67.4    1e-09   Helobdella robusta
gb|ERG80852.1|  putative cleavage and polyadenylation specificity...  67.0    2e-09   
gb|KIL00069.1|  hypothetical protein PAXRUDRAFT_822086                66.6    3e-09   Paxillus rubicundulus Ve08.2h10
ref|XP_005986658.1|  PREDICTED: cleavage and polyadenylation spec...  66.2    3e-09   Latimeria chalumnae
ref|XP_011395741.1|  Cleavage and polyadenylation specificity fac...  65.9    4e-09   Auxenochlorella protothecoides
ref|XP_006680263.1|  hypothetical protein BATDEDRAFT_12823            65.9    4e-09   Batrachochytrium dendrobatidis JAM81
ref|XP_007255534.1|  PREDICTED: cleavage and polyadenylation spec...  65.1    8e-09   Astyanax mexicanus [blind cave fish]
ref|XP_008035425.1|  hypothetical protein TRAVEDRAFT_162694           65.1    8e-09   Trametes versicolor FP-101664 SS1
emb|CCG81055.1|  Cleavage factor two Cft2/polyadenylation factor ...  64.7    8e-09   Taphrina deformans PYCC 5710
emb|CAG03550.1|  unnamed protein product                              64.7    9e-09   Tetraodon nigroviridis
ref|XP_004996313.1|  hypothetical protein PTSG_02804                  64.7    9e-09   Salpingoeca rosetta
gb|EJW84982.1|  cleavage and polyadenylation specificity factor s...  64.3    1e-08   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_005538034.1|  cleavage and polyadenylation specific factor...  64.3    1e-08   Cyanidioschyzon merolae strain 10D
ref|XP_001895540.1|  cleavage and polyadenylation specificity factor  64.3    1e-08   Brugia malayi [agent of lymphatic filariasis]
ref|XP_003144223.1|  cleavage and polyadenylation specificity fac...  64.3    1e-08   
gb|EFO19846.2|  cleavage and polyadenylation specificity factor s...  64.3    1e-08   Loa loa
ref|XP_003971833.1|  PREDICTED: cleavage and polyadenylation spec...  63.9    1e-08   Takifugu rubripes [tiger puffer]
ref|XP_007422599.1|  PREDICTED: cleavage and polyadenylation spec...  63.9    2e-08   
ref|XP_002198279.2|  PREDICTED: cleavage and polyadenylation spec...  62.4    2e-08   
gb|KFQ68791.1|  Cleavage and polyadenylation specificity factor s...  62.4    2e-08   Phaethon lepturus
ref|XP_010293555.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    2e-08   Phaethon lepturus
gb|AEB61046.1|  cleavage and polyadenylation specificity factor s...  62.0    2e-08   Equus caballus [domestic horse]
ref|XP_004083472.1|  PREDICTED: cleavage and polyadenylation spec...  63.5    2e-08   Oryzias latipes [Japanese rice fish]
gb|EMP39872.1|  Cleavage and polyadenylation specificity factor s...  63.5    2e-08   Chelonia mydas [green seaturtle]
emb|CDQ66128.1|  unnamed protein product                              63.2    2e-08   Oncorhynchus mykiss
ref|XP_006632745.1|  PREDICTED: cleavage and polyadenylation spec...  63.5    2e-08   Lepisosteus oculatus
ref|XP_003482353.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    2e-08   
ref|XP_008110699.1|  PREDICTED: cleavage and polyadenylation spec...  63.5    3e-08   Anolis carolinensis [Carolina anole]
ref|XP_007545403.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_007545411.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_007055525.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Chelonia mydas [green seaturtle]
gb|EPY81552.1|  cleavage and polyadenylation specificity factor s...  63.2    3e-08   Camelus ferus
ref|XP_005803161.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Xiphophorus maculatus
gb|KIK43361.1|  hypothetical protein CY34DRAFT_803861                 63.2    3e-08   Suillus luteus UH-Slu-Lm8-n1
ref|XP_006269222.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Alligator mississippiensis
ref|XP_006032867.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Alligator sinensis
ref|XP_008395681.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Poecilia reticulata
ref|XP_005285489.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Chrysemys picta bellii
ref|XP_005285488.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_007302769.1|  hypothetical protein STEHIDRAFT_94995            63.2    3e-08   Stereum hirsutum FP-91666 SS1
ref|XP_006133719.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_010744029.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_007422598.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   
ref|XP_008282497.1|  PREDICTED: cleavage and polyadenylation spec...  63.2    3e-08   Stegastes partitus
ref|XP_010774825.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  63.2    3e-08   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010305532.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    3e-08   Balearica regulorum gibbericeps
ref|XP_005731184.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_004550521.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_008311723.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
gb|ETE64348.1|  Cleavage and polyadenylation specificity factor s...  62.8    4e-08   
ref|XP_005935473.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
emb|CBY42824.1|  unnamed protein product                              62.0    4e-08   
emb|CDQ84001.1|  unnamed protein product                              62.8    4e-08   
gb|ACN10893.1|  Cleavage and polyadenylation specificity factor s...  62.8    4e-08   
ref|XP_007422600.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_006792670.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_003446332.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_010880559.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|NP_001120452.1|  cleavage and polyadenylation specific factor...  62.8    4e-08   
ref|NP_001002384.1|  cleavage and polyadenylation specificity fac...  62.8    4e-08   
dbj|BAE00671.1|  unnamed protein product                              62.0    4e-08   
ref|XP_010880557.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|XP_007902040.1|  PREDICTED: cleavage and polyadenylation spec...  62.8    4e-08   
ref|NP_001134023.1|  cleavage and polyadenylation specificity fac...  62.8    4e-08   
gb|KFO13226.1|  Cleavage and polyadenylation specificity factor s...  60.1    4e-08   
ref|NP_001081123.1|  cleavage and polyadenylation specificity fac...  62.8    4e-08   
gb|AEB61113.1|  cleavage and polyadenylation specificity factor s...  58.9    4e-08   
ref|XP_009559889.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  62.4    5e-08   
gb|ELU45512.1|  cleavage and polyadenylation specificity factor s...  62.4    5e-08   
ref|XP_009247684.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    5e-08   
ref|XP_008506860.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    5e-08   
dbj|BAA92605.1|  KIAA1367 protein                                     62.4    5e-08   
dbj|BAE00542.1|  unnamed protein product                              62.4    5e-08   
emb|CAC09445.1|  hypothetical protein                                 62.0    5e-08   
ref|XP_002923884.2|  PREDICTED: cleavage and polyadenylation spec...  62.0    5e-08   
ref|XP_007985821.1|  PREDICTED: cleavage and polyadenylation spec...  62.4    5e-08   
ref|XP_005506196.1|  PREDICTED: cleavage and polyadenylation spec...  62.4    6e-08   
ref|XP_009893658.1|  PREDICTED: cleavage and polyadenylation spec...  62.4    6e-08   
ref|XP_010148765.1|  PREDICTED: cleavage and polyadenylation spec...  62.4    6e-08   
ref|NP_001026379.1|  cleavage and polyadenylation specificity fac...  62.0    6e-08   
ref|XP_005417904.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_010392610.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_005520240.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_005047579.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_001913149.1|  cleavage and polyadenylation factor              62.0    6e-08   
ref|XP_010348857.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_002200593.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_007184326.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_005483223.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
ref|XP_009951887.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    6e-08   
gb|KFP53906.1|  Cleavage and polyadenylation specificity factor s...  62.0    7e-08   
ref|XP_010184704.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_004055637.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_009076241.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_006839628.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_004682096.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_008931835.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    7e-08   
ref|XP_008576222.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    8e-08   
ref|XP_008071140.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    8e-08   
ref|XP_004739092.1|  PREDICTED: cleavage and polyadenylation spec...  62.0    8e-08   
ref|XP_009502755.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_008696719.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_005339196.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_006925597.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_003408878.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_010207574.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_005390370.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_003462702.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_010614632.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_005871272.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_006990947.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_006155869.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_005021502.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|NP_059133.1|  cleavage and polyadenylation specificity factor...  61.6    8e-08   
ref|NP_001244509.1|  cleavage and polyadenylation specificity fac...  61.6    8e-08   
gb|KFZ48733.1|  Cleavage and polyadenylation specificity factor s...  61.6    8e-08   
ref|XP_009903114.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_008942932.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_009279062.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_005149568.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
gb|KFW90886.1|  Cleavage and polyadenylation specificity factor s...  61.6    8e-08   
ref|XP_011371484.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    8e-08   
ref|XP_010165764.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009584324.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
gb|KFQ90264.1|  Cleavage and polyadenylation specificity factor s...  61.6    9e-08   
ref|XP_010014719.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010118956.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010614631.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_006879175.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004262395.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_003206716.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
dbj|BAG50992.1|  unnamed protein product                              61.6    9e-08   
ref|XP_009928126.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010214037.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010002024.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010133552.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_008490686.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_002754257.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|NP_787002.1|  cleavage and polyadenylation specificity factor...  61.6    9e-08   
ref|XP_005343528.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_005241978.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010614630.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009967915.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009935105.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009481667.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009647268.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
gb|AAH70095.1|  Cleavage and polyadenylation specific factor 2, 1...  61.6    9e-08   
ref|NP_058552.1|  cleavage and polyadenylation specificity factor...  61.6    9e-08   
gb|ELW55806.1|  Cleavage and polyadenylation specificity factor s...  61.6    9e-08   
gb|AAH07163.1|  Cpsf2 protein                                         61.6    9e-08   
ref|XP_006071303.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010834498.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009981300.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_537353.2|  PREDICTED: cleavage and polyadenylation specifi...  61.6    9e-08   
ref|XP_004649386.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004883985.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_003260944.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
gb|ELK36959.1|  Cleavage and polyadenylation specificity factor s...  61.6    9e-08   
ref|XP_007942690.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_003987977.2|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004610319.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004475461.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_007633787.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_001497134.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|NP_001100223.1|  cleavage and polyadenylation specificity fac...  61.6    9e-08   
ref|XP_009688069.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004635218.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_002719640.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_001365312.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009694023.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_008146656.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004376734.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_004698821.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_008819946.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_005871273.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_001507374.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_010071317.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_009688070.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_005068449.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_003756188.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
gb|KFP78636.1|  Cleavage and polyadenylation specificity factor s...  61.6    9e-08   
gb|EAW81483.1|  cleavage and polyadenylation specific factor 2, 1...  61.6    9e-08   
ref|XP_009873251.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    9e-08   
ref|XP_007647923.1|  PREDICTED: cleavage and polyadenylation spec...  61.6    1e-07   
ref|XP_006754770.1|  PREDICTED: LOW QUALITY PROTEIN: cleavage and...  61.6    1e-07   
gb|EGW09725.1|  Sodium/potassium/calcium exchanger 4                  61.6    1e-07   
gb|EPQ10758.1|  Cleavage and polyadenylation specificity factor s...  61.6    1e-07   
ref|XP_780045.3|  PREDICTED: cleavage and polyadenylation specifi...  61.2    1e-07   
ref|NP_595448.1|  cleavage factor two Cft2/polyadenylation factor...  60.8    2e-07   
gb|EMT12152.1|  Putative disease resistance protein RGA1              60.8    2e-07   
ref|XP_007529124.1|  PREDICTED: cleavage and polyadenylation spec...  60.1    3e-07   
emb|CBY19228.1|  unnamed protein product                              60.1    3e-07   
ref|XP_004584390.1|  PREDICTED: cleavage and polyadenylation spec...  59.7    4e-07   
ref|XP_003787126.1|  PREDICTED: cleavage and polyadenylation spec...  59.3    5e-07   
gb|EIE76188.1|  hypothetical protein RO3G_00892                       58.9    7e-07   
ref|XP_009826613.1|  hypothetical protein, variant 7                  58.5    8e-07   
ref|XP_009826614.1|  hypothetical protein, variant 8                  58.5    9e-07   
gb|KFH70570.1|  hypothetical protein MVEG_03420                       58.2    1e-06   
gb|KIK67941.1|  hypothetical protein GYMLUDRAFT_36748                 57.8    2e-06   
ref|XP_007515701.1|  predicted protein                                56.6    5e-06   
emb|CDO71405.1|  hypothetical protein BN946_scf184908.g163            55.5    8e-06   
gb|ELK37610.1|  Cleavage and polyadenylation specificity factor s...  51.6    2e-05   
ref|XP_008555336.1|  PREDICTED: probable cleavage and polyadenyla...  54.3    3e-05   
gb|EMS60783.1|  hypothetical protein TRIUR3_10353                     53.1    5e-05   
ref|XP_002667963.1|  predicted protein                                48.9    2e-04   
emb|CCU74909.1|  cleavage and polyadenylation specificity factor ...  52.0    2e-04   
emb|CCD58879.1|  cleavage and polyadenylation specificity factor,...  51.6    2e-04   
gb|KGB41819.1|  Circulating cathodic antigen                          51.6    2e-04   
ref|XP_002507150.1|  predicted protein                                50.4    6e-04   
ref|XP_007001971.1|  hypothetical protein TREMEDRAFT_67471            50.1    7e-04   
ref|XP_001732677.1|  hypothetical protein MGL_0452                    49.7    8e-04   



>emb|CDP05185.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   308 bits (788),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 173/181 (96%), Gaps = 2/181 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCL+HVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  312  HVAPLKLVLVHGSAEATEHLKQHCLQHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  371

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLG+YEIAW+DAEVGKT++GMLSLLPLS  APPHKTVLVGD+K++DFKQFLASKG
Sbjct  372  NVLFKKLGEYEIAWIDAEVGKTENGMLSLLPLSSPAPPHKTVLVGDIKMADFKQFLASKG  431

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDASQ+    +AAIQ IILEGPL+EEYY IREYLYSQFY
Sbjct  432  VQVEFAGGALRCGEYVTLRKVGDASQK--GGSAAIQQIILEGPLTEEYYKIREYLYSQFY  489

Query  110  S  108
            +
Sbjct  490  A  490



>ref|XP_009605985.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009605986.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X3 [Nicotiana tomentosiformis]
Length=603

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLK VCPHVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  424  HVAPLKLVLVHGSAEATEHLKQHCLKQVCPHVYAPQLEETIDVTSDLCAYKVQLSEKLMS  483

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGDYEIAWVDAEVG+T++ M+SLLPLS  APPHKTVLVGD+K+SDFKQFLASKG
Sbjct  484  KVLFKKLGDYEIAWVDAEVGRTENDMISLLPLSGPAPPHKTVLVGDIKMSDFKQFLASKG  543

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  544  VQVEFAGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  601

Query  110  SL  105
            SL
Sbjct  602  SL  603



>ref|XP_009605984.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Nicotiana tomentosiformis]
Length=625

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLK VCPHVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  446  HVAPLKLVLVHGSAEATEHLKQHCLKQVCPHVYAPQLEETIDVTSDLCAYKVQLSEKLMS  505

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGDYEIAWVDAEVG+T++ M+SLLPLS  APPHKTVLVGD+K+SDFKQFLASKG
Sbjct  506  KVLFKKLGDYEIAWVDAEVGRTENDMISLLPLSGPAPPHKTVLVGDIKMSDFKQFLASKG  565

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  566  VQVEFAGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  623

Query  110  SL  105
            SL
Sbjct  624  SL  625



>ref|XP_004166238.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like, partial [Cucumis sativus]
Length=237

 Score =   289 bits (739),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHGTAEATEHLKQHCLK+VCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  58   HVAPLKLVLVHGTAEATEHLKQHCLKNVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  117

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEI W+DAEVGKT++G LSLLPLS A  PHK+VLVGDLK++DFKQFLASKG
Sbjct  118  NVLFKKLGDYEITWLDAEVGKTENGTLSLLPLSKAPAPHKSVLVGDLKMADFKQFLASKG  177

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVTLRKV DASQ+     +  Q +++EGPL E+YY IRE LYSQFY
Sbjct  178  IQVEFAGGALRCGEYVTLRKVTDASQK--GGGSGTQQVVIEGPLCEDYYKIRELLYSQFY  235

Query  110  SL  105
             L
Sbjct  236  LL  237



>ref|XP_009789216.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nicotiana sylvestris]
Length=739

 Score =   304 bits (778),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLK VCPHVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKQVCPHVYAPQLEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGD+EIAWVDAEVGKT++GM+SLLP S  APPHKTVLVGD+K+SDFKQFLASKG
Sbjct  620  KVLFKKLGDHEIAWVDAEVGKTENGMISLLPFSGPAPPHKTVLVGDIKMSDFKQFLASKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  680  VQVEFAGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  737

Query  110  SL  105
            SL
Sbjct  738  SL  739



>ref|XP_006353867.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Solanum tuberosum]
Length=739

 Score =   302 bits (774),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCP VYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPQVYAPQLEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGDYEIAWVDAEVGKT++ M SLLPLS  APPHKTVLVGDLK+SDFKQFLASKG
Sbjct  620  QVLFKKLGDYEIAWVDAEVGKTENDMFSLLPLSGPAPPHKTVLVGDLKMSDFKQFLASKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEF GGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  680  VQVEFGGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  737

Query  110  SL  105
            SL
Sbjct  738  SL  739



>ref|XP_009605983.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Nicotiana tomentosiformis]
Length=739

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLK VCPHVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKQVCPHVYAPQLEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGDYEIAWVDAEVG+T++ M+SLLPLS  APPHKTVLVGD+K+SDFKQFLASKG
Sbjct  620  KVLFKKLGDYEIAWVDAEVGRTENDMISLLPLSGPAPPHKTVLVGDIKMSDFKQFLASKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  680  VQVEFAGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  737

Query  110  SL  105
            SL
Sbjct  738  SL  739



>ref|XP_004234405.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Solanum lycopersicum]
Length=739

 Score =   302 bits (773),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCP VYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPQVYAPQLEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
             VLFKKLGDYEIAWVDAEVGKT++ M SLLPLS  +PPHKTVLVGDLK+SDFKQFLASKG
Sbjct  620  QVLFKKLGDYEIAWVDAEVGKTENDMFSLLPLSGPSPPHKTVLVGDLKMSDFKQFLASKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEF GGALRCGEYVT+RKVGDASQ+     AAIQ I+LEGPLSEEYY IREYLYS FY
Sbjct  680  VQVEFGGGALRCGEYVTIRKVGDASQK--VGGAAIQQIVLEGPLSEEYYKIREYLYSHFY  737

Query  110  SL  105
            SL
Sbjct  738  SL  739



>ref|XP_011084423.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Sesamum indicum]
Length=740

 Score =   300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 169/182 (93%), Gaps = 3/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVHG+AEATEHLKQHCLK+VCPHVYAPQIEE+IDVTSDLCAYKVQLSEKLMS
Sbjct  562  HVSPLKLVLVHGSAEATEHLKQHCLKNVCPHVYAPQIEESIDVTSDLCAYKVQLSEKLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT+SG LSLLPLS   PPHKTVLVGD+K++DFKQFLASKG
Sbjct  622  NVLFKKLGDYEIAWVDAEVGKTESGTLSLLPLSTPPPPHKTVLVGDIKMADFKQFLASKG  681

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRK+GD+SQ+       IQ IILEGPL+EEYY IR++LYSQFY
Sbjct  682  VQVEFAGGALRCGEYVTLRKIGDSSQK---GGGNIQQIILEGPLTEEYYKIRDHLYSQFY  738

Query  110  SL  105
            +L
Sbjct  739  AL  740



>ref|XP_010662728.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Vitis vinifera]
Length=691

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQI ETIDVTSDLCAYKVQLSEKLMS
Sbjct  512  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIGETIDVTSDLCAYKVQLSEKLMS  571

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDAEVGKT+SG LSLLPLS   P H TV VGD+K++DFKQFLASKG
Sbjct  572  NVLFKKLGDYEVAWVDAEVGKTESGSLSLLPLSTPPPSHDTVFVGDIKMADFKQFLASKG  631

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEF+GGALRCGEYVTLRKVGDASQ+     A IQ I++EGPL +EYY IREYLYSQ+Y
Sbjct  632  IQVEFSGGALRCGEYVTLRKVGDASQK--GGGAIIQQIVMEGPLCDEYYKIREYLYSQYY  689

Query  110  SL  105
             L
Sbjct  690  LL  691



>gb|KDP24115.1| hypothetical protein JCGZ_25772 [Jatropha curcas]
Length=741

 Score =   295 bits (754),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPL LVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  562  HVAPLNLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++ MLSLLP+S + PPHK+VLVGDLK++DFKQFLASKG
Sbjct  622  NVLFKKLGDYEIAWVDAEVGKTENEMLSLLPISTSPPPHKSVLVGDLKMADFKQFLASKG  681

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRK+G+ SQ+GG +    Q I++EGPL E+YY IREYLYSQFY
Sbjct  682  VQVEFAGGALRCGEYVTLRKIGNVSQKGGGSGT--QQIVIEGPLCEDYYKIREYLYSQFY  739

Query  110  SL  105
             L
Sbjct  740  LL  741



>gb|KHG29898.1| Cleavage and polyadenylation specificity factor subunit 2 -like 
protein [Gossypium arboreum]
Length=692

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  513  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  572

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++ MLSLLP+S  APPHK+V+VGDLK++DFKQFLASKG
Sbjct  573  NVLFKKLGDYEIAWVDAEVGKTENDMLSLLPISTPAPPHKSVVVGDLKMADFKQFLASKG  632

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V+VEFA GALRCGEYVTLRKVG ASQ+     +  Q II+EGPL E+YY IREYLYSQFY
Sbjct  633  VKVEFAAGALRCGEYVTLRKVGVASQK--GGGSGTQQIIIEGPLCEDYYKIREYLYSQFY  690

Query  110  SL  105
             L
Sbjct  691  LL  692



>ref|XP_007038718.1| Cleavage and polyadenylation specificity factor 100 isoform 1 
[Theobroma cacao]
 gb|EOY23219.1| Cleavage and polyadenylation specificity factor 100 isoform 1 
[Theobroma cacao]
Length=742

 Score =   294 bits (753),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  563  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  622

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++ MLSLLPLS  APPHK+V+VGDLKL+DFKQFLASKG
Sbjct  623  NVLFKKLGDYEIAWVDAEVGKTENEMLSLLPLSTPAPPHKSVVVGDLKLADFKQFLASKG  682

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V+VEFAGGALRCGEYVTLRKVG ASQ+GG +    Q II+EGPL E+YY IR+YLYSQFY
Sbjct  683  VKVEFAGGALRCGEYVTLRKVGFASQKGGGSGT--QQIIIEGPLCEDYYKIRDYLYSQFY  740

Query  110  SL  105
             L
Sbjct  741  LL  742



>ref|XP_002268591.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Vitis vinifera]
 emb|CBI22708.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   294 bits (752),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQI ETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIGETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDAEVGKT+SG LSLLPLS   P H TV VGD+K++DFKQFLASKG
Sbjct  621  NVLFKKLGDYEVAWVDAEVGKTESGSLSLLPLSTPPPSHDTVFVGDIKMADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEF+GGALRCGEYVTLRKVGDASQ+     A IQ I++EGPL +EYY IREYLYSQ+Y
Sbjct  681  IQVEFSGGALRCGEYVTLRKVGDASQK--GGGAIIQQIVMEGPLCDEYYKIREYLYSQYY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_006587304.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X3 [Glycine max]
Length=636

 Score =   291 bits (744),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  457  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  516

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  517  NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSKG  576

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDASQ+GG + A  Q I++EGPL E+YY IR+YLYSQFY
Sbjct  577  VQVEFAGGALRCGEYVTLRKVGDASQKGGGSGA--QQIVIEGPLCEDYYKIRDYLYSQFY  634

Query  110  SL  105
             L
Sbjct  635  LL  636



>ref|XP_010671862.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHC KHVCPHVYAPQI ETIDVTSDLCAYKVQLSEKLMS
Sbjct  485  HVAPLKLVLVHGSAEATEHLKQHCSKHVCPHVYAPQIGETIDVTSDLCAYKVQLSEKLMS  544

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVG+T+ GMLSLLPLS+ AP HK+VLVGD+K++DFKQFLASKG
Sbjct  545  NVLFKKLGDYEIAWVDAEVGQTEGGMLSLLPLSNEAPAHKSVLVGDIKMADFKQFLASKG  604

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +Q EF+GGALRCGE+VTLRKVGD +Q+GG A +  Q I++EGPLSEEYY IR+YLYSQFY
Sbjct  605  IQAEFSGGALRCGEFVTLRKVGDPTQKGGVAGS--QQIVIEGPLSEEYYKIRDYLYSQFY  662

Query  110  SL  105
             L
Sbjct  663  LL  664



>gb|KJB52780.1| hypothetical protein B456_008G276300 [Gossypium raimondii]
Length=742

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  563  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  622

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++ MLSLLP+S  APPHK+V+VGDLK++DFKQFLASKG
Sbjct  623  NVLFKKLGDYEIAWVDAEVGKTENDMLSLLPISTPAPPHKSVVVGDLKMADFKQFLASKG  682

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V+VEFA GALRCGEYVTLRKVG ASQ+     +  Q II+EGPL E+YY IREYLYSQFY
Sbjct  683  VKVEFAAGALRCGEYVTLRKVGVASQK--GGGSGTQQIIIEGPLCEDYYKIREYLYSQFY  740

Query  110  SL  105
             L
Sbjct  741  LL  742



>ref|XP_002517902.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
 gb|EEF44420.1| cleavage and polyadenylation specificity factor, putative [Ricinus 
communis]
Length=740

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AE+TEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAESTEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGD+EIAWVDAEVGKT+S  LSLLP+S +APPHK+VLVGDLK++DFKQFLASKG
Sbjct  621  NVLFKKLGDFEIAWVDAEVGKTESDALSLLPISTSAPPHKSVLVGDLKMADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVG+ +Q+GG +    Q I++EGPL E+YY IREYLYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKVGNINQKGGGSGT--QQIVIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_008439247.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Cucumis melo]
Length=738

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHGTAEATEHLKQHCLK+VCPHVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVAPLKLVLVHGTAEATEHLKQHCLKNVCPHVYAPQVEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAW+DAEVGKT++G LSLLPLS A  PHK+VLVGDLK++DFKQFLASKG
Sbjct  619  NVLFKKLGDYEIAWLDAEVGKTENGTLSLLPLSKAPAPHKSVLVGDLKMADFKQFLASKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVTLRKV DASQ+     +  Q +++EGPL E+YY IRE LYSQFY
Sbjct  679  IQVEFAGGALRCGEYVTLRKVTDASQK--GGGSGTQQVVIEGPLCEDYYKIRELLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_006587303.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Glycine max]
Length=727

 Score =   291 bits (744),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  548  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  607

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  608  NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSKG  667

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDASQ+GG + A  Q I++EGPL E+YY IR+YLYSQFY
Sbjct  668  VQVEFAGGALRCGEYVTLRKVGDASQKGGGSGA--QQIVIEGPLCEDYYKIRDYLYSQFY  725

Query  110  SL  105
             L
Sbjct  726  LL  727



>ref|XP_010671861.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=738

 Score =   291 bits (744),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHC KHVCPHVYAPQI ETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVAPLKLVLVHGSAEATEHLKQHCSKHVCPHVYAPQIGETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVG+T+ GMLSLLPLS+ AP HK+VLVGD+K++DFKQFLASKG
Sbjct  619  NVLFKKLGDYEIAWVDAEVGQTEGGMLSLLPLSNEAPAHKSVLVGDIKMADFKQFLASKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +Q EF+GGALRCGE+VTLRKVGD +Q+GG A +  Q I++EGPLSEEYY IR+YLYSQFY
Sbjct  679  IQAEFSGGALRCGEFVTLRKVGDPTQKGGVAGS--QQIVIEGPLSEEYYKIRDYLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_010035148.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Eucalyptus grandis]
 gb|KCW46443.1| hypothetical protein EUGRSUZ_K00275 [Eucalyptus grandis]
Length=735

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLV G+AEATEHLKQHCLK+VCP VYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  556  HVAPLKLVLVRGSAEATEHLKQHCLKNVCPQVYAPQIEETIDVTSDLCAYKVQLSEKLMS  615

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AW+DAEVGKT++G LSLLPLS +APPHK+VLVGDLKL+DFKQFLASKG
Sbjct  616  NVLFKKLGDYEVAWIDAEVGKTENGTLSLLPLSTSAPPHKSVLVGDLKLADFKQFLASKG  675

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEF GGALRCGEYVT+RKVGDASQ+GG +    Q I+LEGPL E+YY IR+YLYSQFY
Sbjct  676  VQVEFGGGALRCGEYVTVRKVGDASQKGGLSGT--QQIVLEGPLCEDYYKIRDYLYSQFY  733

Query  110  SL  105
             L
Sbjct  734  LL  735



>ref|XP_010255376.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Nelumbo nucifera]
Length=739

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 167/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQI ETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIGETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAW+DA+VGKTD+ MLSLLPLS   PPHK+VLVGDLKL+DFKQFLASKG
Sbjct  620  NVLFKKLGDYEIAWLDAQVGKTDNDMLSLLPLSTPPPPHKSVLVGDLKLADFKQFLASKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDA Q+GG      Q ++LEGPL+EEYY IR+YLYSQFY
Sbjct  680  VQVEFAGGALRCGEYVTLRKVGDAGQKGGGTGT--QQVVLEGPLTEEYYKIRDYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_010035149.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Eucalyptus grandis]
 gb|KCW46444.1| hypothetical protein EUGRSUZ_K00275 [Eucalyptus grandis]
Length=734

 Score =   290 bits (743),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLV G+AEATEHLKQHCLK+VCP VYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  555  HVAPLKLVLVRGSAEATEHLKQHCLKNVCPQVYAPQIEETIDVTSDLCAYKVQLSEKLMS  614

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AW+DAEVGKT++G LSLLPLS +APPHK+VLVGDLKL+DFKQFLASKG
Sbjct  615  NVLFKKLGDYEVAWIDAEVGKTENGTLSLLPLSTSAPPHKSVLVGDLKLADFKQFLASKG  674

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEF GGALRCGEYVT+RKVGDASQ+GG +    Q I+LEGPL E+YY IR+YLYSQFY
Sbjct  675  VQVEFGGGALRCGEYVTVRKVGDASQKGGLSGT--QQIVLEGPLCEDYYKIRDYLYSQFY  732

Query  110  SL  105
             L
Sbjct  733  LL  734



>ref|XP_008374076.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Malus domestica]
Length=566

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  387  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  446

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVD+  GKT++ MLSL PLS   PPH+ VLVGDLK+++FKQFL+ KG
Sbjct  447  NVLFKKLGDYEIAWVDSGAGKTENEMLSLQPLSTPPPPHEYVLVGDLKMANFKQFLSDKG  506

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  507  VQVEFAGGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  564

Query  110  SL  105
             L
Sbjct  565  LL  566



>ref|XP_008374075.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Malus domestica]
Length=567

 Score =   286 bits (731),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 161/182 (88%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  388  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  447

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVD+  GKT++ MLSL PLS   PPH+ VLVGDLK+++FKQFL+ KG
Sbjct  448  NVLFKKLGDYEIAWVDSGAGKTENEMLSLQPLSTPPPPHEYVLVGDLKMANFKQFLSDKG  507

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  508  VQVEFAGGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  565

Query  110  SL  105
             L
Sbjct  566  LL  567



>ref|XP_004140773.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Cucumis sativus]
 gb|KGN57386.1| hypothetical protein Csa_3G182220 [Cucumis sativus]
Length=738

 Score =   290 bits (742),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHGTAEATEHLKQHCLK+VCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVAPLKLVLVHGTAEATEHLKQHCLKNVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEI W+DAEVGKT++G LSLLPLS A  PHK+VLVGDLK++DFKQFLASKG
Sbjct  619  NVLFKKLGDYEITWLDAEVGKTENGTLSLLPLSKAPAPHKSVLVGDLKMADFKQFLASKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVTLRKV DASQ+     +  Q +++EGPL E+YY IRE LYSQFY
Sbjct  679  IQVEFAGGALRCGEYVTLRKVTDASQK--GGGSGTQQVVIEGPLCEDYYKIRELLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>gb|EYU19552.1| hypothetical protein MIMGU_mgv1a0019022mg, partial [Erythranthe 
guttata]
Length=520

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 4/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVHG+AEATEHLK++CLK+VCP VYAPQIEE+IDVTSDLCAYKVQLSEKLMS
Sbjct  341  HVSPLKLVLVHGSAEATEHLKEYCLKNVCPDVYAPQIEESIDVTSDLCAYKVQLSEKLMS  400

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSG-MlsllplsdaapPHKTVLVGDLKLSDFKQFLASK  294
            N+LFKK+GDYEIAWVDA VGKT+S  +  L   +   PPHKTVLVGD+K++DFKQFLASK
Sbjct  401  NILFKKIGDYEIAWVDAVVGKTESDTLSLLPLSTTPPPPHKTVLVGDIKMADFKQFLASK  460

Query  293  GVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            G+QVEFAGGALRCGEYVTLRKVGD+S +       IQHIILEGPLSEEYY IR++LYSQF
Sbjct  461  GIQVEFAGGALRCGEYVTLRKVGDSSHK---GGGNIQHIILEGPLSEEYYNIRDHLYSQF  517

Query  113  YSL  105
            Y L
Sbjct  518  YPL  520



>ref|XP_006587302.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Glycine max]
Length=739

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 169/182 (93%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  620  NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDASQ+GG + A  Q I++EGPL E+YY IR+YLYSQFY
Sbjct  680  VQVEFAGGALRCGEYVTLRKVGDASQKGGGSGA--QQIVIEGPLCEDYYKIRDYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_008234231.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Prunus mume]
Length=739

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVD+E GKT++G LSLLP+S  APPH++VLVGDLK+++FKQFL+  G
Sbjct  620  NVLFKKLGDYEIAWVDSEAGKTENGALSLLPISTPAPPHESVLVGDLKMANFKQFLSDNG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  680  VQVEFAGGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_008234230.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Prunus mume]
Length=740

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 164/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVD+E GKT++G LSLLP+S  APPH++VLVGDLK+++FKQFL+  G
Sbjct  621  NVLFKKLGDYEIAWVDSEAGKTENGALSLLPISTPAPPHESVLVGDLKMANFKQFLSDNG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>gb|KDO52014.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=721

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVY PQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  542  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYTPQIEETIDVTSDLCAYKVQLSEKLMS  601

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++D K FL+SKG
Sbjct  602  NVLFKKLGDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKMADLKPFLSSKG  661

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVT+RKVG A Q+GG +    Q I++EGPL E+YY IR YLYSQFY
Sbjct  662  IQVEFAGGALRCGEYVTIRKVGPAGQKGGGSGT--QQIVIEGPLCEDYYKIRAYLYSQFY  719

Query  110  SL  105
             L
Sbjct  720  LL  721



>ref|XP_006490412.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Citrus sinensis]
Length=738

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVY PQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYTPQIEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++D K FL+SKG
Sbjct  619  NVLFKKLGDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKMADLKPFLSSKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVT+RKVG A Q+GG +    Q I++EGPL E+YY IR YLYSQFY
Sbjct  679  IQVEFAGGALRCGEYVTIRKVGPAGQKGGGSGT--QQIVIEGPLCEDYYKIRAYLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_006421948.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 ref|XP_006490411.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Citrus sinensis]
 gb|ESR35188.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 gb|KDO52016.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=739

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVY PQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYTPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++D K FL+SKG
Sbjct  620  NVLFKKLGDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKMADLKPFLSSKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEYVT+RKVG A Q+GG +    Q I++EGPL E+YY IR YLYSQFY
Sbjct  680  IQVEFAGGALRCGEYVTIRKVGPAGQKGGGSGT--QQIVIEGPLCEDYYKIRAYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_007220238.1| hypothetical protein PRUPE_ppa001928mg [Prunus persica]
 gb|EMJ21437.1| hypothetical protein PRUPE_ppa001928mg [Prunus persica]
Length=740

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCL HVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCLTHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVD+E GKT++G LSLLP+S  APPH++VLVGDLK+++FKQFL+  G
Sbjct  621  NVLFKKLGDYEIAWVDSEAGKTENGALSLLPISTPAPPHESVLVGDLKMANFKQFLSDNG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_004499957.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Cicer arietinum]
Length=740

 Score =   286 bits (731),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 165/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEAT+HLKQHCLK+VCPHVYAPQIEETIDVTSDLCAYKVQLSE+LMS
Sbjct  561  HVAPLKLVLVHGSAEATDHLKQHCLKNVCPHVYAPQIEETIDVTSDLCAYKVQLSERLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLG+YEIAWVDAEVGK ++ MLSLLP+S    PHK+VLVGDLKL+DFKQFL++KG
Sbjct  621  NVLFKKLGEYEIAWVDAEVGKAENDMLSLLPVSGPPRPHKSVLVGDLKLADFKQFLSTKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V VEFAGGALRCGEYVT+RKVGDA+Q+   A +  Q II+EGPL E+YY IR+YLYSQFY
Sbjct  681  VPVEFAGGALRCGEYVTVRKVGDAAQK--GAGSGTQQIIIEGPLCEDYYKIRDYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_008376608.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Malus domestica]
Length=740

 Score =   286 bits (731),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKK+GDYEIAWVD+E GKT++ MLSL PLS+  PPH++VLVGDLK+++FKQFL+ KG
Sbjct  621  NVLFKKVGDYEIAWVDSEAGKTENDMLSLQPLSNPPPPHESVLVGDLKMANFKQFLSDKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQ EFAGG LRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  681  VQAEFAGGVLRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_010934798.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Elaeis guineensis]
Length=739

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 163/182 (90%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHC KHVCPHVYAPQI+ETIDVTSDLCAYKVQLSE+LMS
Sbjct  562  HVAPLKLVLVHGSAEATEHLKQHCAKHVCPHVYAPQIDETIDVTSDLCAYKVQLSERLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGDYEIAW+DAEVGKT+  +L+L PLS   P HKTVLVGDLKL+DFKQFLASKG
Sbjct  622  NVIFKKLGDYEIAWIDAEVGKTND-ILTLGPLSSTPPTHKTVLVGDLKLADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRK+ D++Q+G       Q +++EGPL+EEYY IRE+LYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKISDSNQKGVTGT---QQVVIEGPLTEEYYKIREHLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_008787501.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Phoenix dactylifera]
Length=739

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (90%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHC KHVCPHVYAPQI+ETIDVTSDLCAYKVQLSE+LMS
Sbjct  562  HVAPLKLVLVHGSAEATEHLKQHCAKHVCPHVYAPQIDETIDVTSDLCAYKVQLSERLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKK+GDYEIAW+DAEVGKT+  ML+L PLS   P HKTVLVGDLKL+DFKQFLASKG
Sbjct  622  NVIFKKMGDYEIAWIDAEVGKTND-MLTLGPLSSTPPTHKTVLVGDLKLADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVT+RK+ D++Q+G       Q +++EGPL+EEYY IRE+LYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTVRKISDSNQKGVTGT---QQVVIEGPLTEEYYKIREHLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_009342955.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Pyrus x bretschneideri]
Length=739

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKK+GDYEIAWVD+E GKT++ MLSL PLS+  PPH++VLVGDLK+++FKQFL+ KG
Sbjct  620  NVLFKKVGDYEIAWVDSEAGKTENDMLSLQPLSNPPPPHESVLVGDLKMANFKQFLSDKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQ EFAGG LRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  680  VQAEFAGGVLRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_009342954.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Pyrus x bretschneideri]
Length=740

 Score =   285 bits (730),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKK+GDYEIAWVD+E GKT++ MLSL PLS+  PPH++VLVGDLK+++FKQFL+ KG
Sbjct  621  NVLFKKVGDYEIAWVDSEAGKTENDMLSLQPLSNPPPPHESVLVGDLKMANFKQFLSDKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQ EFAGG LRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  681  VQAEFAGGVLRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_008376609.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Malus domestica]
Length=739

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKK+GDYEIAWVD+E GKT++ MLSL PLS+  PPH++VLVGDLK+++FKQFL+ KG
Sbjct  620  NVLFKKVGDYEIAWVDSEAGKTENDMLSLQPLSNPPPPHESVLVGDLKMANFKQFLSDKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQ EFAGG LRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  680  VQAEFAGGVLRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_003548179.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform 1 [Glycine max]
 gb|KHN09330.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=738

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/182 (84%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQ+EETIDVTSDLCAYKV LSEKLMS
Sbjct  559  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQLEETIDVTSDLCAYKVLLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  619  NVLFKKLGDYELAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDASQ+GG + A  Q I++EGPL E+YY IR+YLYSQFY
Sbjct  679  VQVEFAGGALRCGEYVTLRKVGDASQKGGGSGA--QQIVIEGPLCEDYYKIRDYLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>gb|KEH41412.1| cleavage and polyadenylation specificity factor subunit 2 [Medicago 
truncatula]
Length=740

 Score =   284 bits (726),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 166/182 (91%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEAT+HLKQHCLK+VCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATDHLKQHCLKNVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            +VLFKKLG+YE+AWVDAE GKT++ MLSLLP+S A  PHK+VLVGDLKL+DFKQFL++KG
Sbjct  621  SVLFKKLGEYEVAWVDAEAGKTENDMLSLLPVSGAPHPHKSVLVGDLKLADFKQFLSTKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V VEFAGGALRCGEYVT+RKVGDA+Q+G  +    Q II+EGPL E+YY IR+YLYSQFY
Sbjct  681  VPVEFAGGALRCGEYVTVRKVGDATQKGAGSGT--QQIIIEGPLCEDYYKIRDYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_007152251.1| hypothetical protein PHAVU_004G114000g [Phaseolus vulgaris]
 gb|ESW24245.1| hypothetical protein PHAVU_004G114000g [Phaseolus vulgaris]
Length=739

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 168/182 (92%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHV APQI+ETIDVTSDLCAYKV LSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVSAPQIDETIDVTSDLCAYKVLLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDA VGKT+S  LS+LP+S+AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  620  NVLFKKLGDYEVAWVDAVVGKTESDTLSVLPVSEAAPPHKSVLVGDLKLADIKQFLSSKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVGDA+Q+GG + A  Q I++EGPL E+YY IR+YLYSQFY
Sbjct  680  VQVEFAGGALRCGEYVTLRKVGDATQKGGGSGA--QQIVIEGPLCEDYYKIRDYLYSQFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_010108351.1| Cleavage and polyadenylation specificity factor subunit 2 [Morus 
notabilis]
 gb|EXC19142.1| Cleavage and polyadenylation specificity factor subunit 2 [Morus 
notabilis]
Length=741

 Score =   280 bits (716),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 165/183 (90%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHC+K VCPHVYAPQIEETID+TSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCIKQVCPHVYAPQIEETIDITSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGD+E AWVD+EVGKT++G LSLLPLS AAPPHK+VLVGDLK+++FKQFLA  G
Sbjct  621  NVLFKKLGDHETAWVDSEVGKTENGTLSLLPLSSAAPPHKSVLVGDLKMANFKQFLADNG  680

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVGDAS +GG      Q I++EGPL EEYY IREYLYSQF
Sbjct  681  VQVEFAGGGALRCGEYVTLRKVGDASHKGGGPGT--QQIVIEGPLCEEYYKIREYLYSQF  738

Query  113  YSL  105
            + L
Sbjct  739  FLL  741



>ref|XP_009401035.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Musa acuminata subsp. malaccensis]
Length=735

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 164/182 (90%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHC+KHVCPHVYAP IEETIDVTSDLCAYKVQLSE+LMS
Sbjct  558  HVAPLKLVLVHGSAEATEHLKQHCIKHVCPHVYAPHIEETIDVTSDLCAYKVQLSERLMS  617

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVL KKLGDYEIAWVDAEVGKT+  ML+LLPLS A P HK+VL+GDLKL+DFKQFLAS+G
Sbjct  618  NVLLKKLGDYEIAWVDAEVGKTND-MLTLLPLSSAPPTHKSVLIGDLKLADFKQFLASQG  676

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEF GGALRCGE+VTLRK+ DASQ+GG      Q I++EGPL+EEYY IR++LYSQFY
Sbjct  677  VQVEFTGGALRCGEHVTLRKISDASQKGGTGG---QQILIEGPLTEEYYKIRKHLYSQFY  733

Query  110  SL  105
             L
Sbjct  734  LL  735



>ref|XP_011008814.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Populus euphratica]
 ref|XP_011009640.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Populus euphratica]
Length=740

 Score =   277 bits (708),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 162/182 (89%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLV+VHG+AEATEHLKQH L      VYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVMVHGSAEATEHLKQHFLNIKNVQVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++DFKQFLASKG
Sbjct  621  NVLFKKLGDYEVAWVDAEVGKTENGMLSLLPISSPAPPHKSVLVGDLKMADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVG+ SQ+    A+  Q II+EGPL E+YY IREYLYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKVGNPSQK--GGASGTQQIIIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_006369487.1| Cleavage and polyadenylation specificity factor family protein 
[Populus trichocarpa]
 gb|ERP66056.1| Cleavage and polyadenylation specificity factor family protein 
[Populus trichocarpa]
Length=740

 Score =   277 bits (708),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLV+VHG+AEATEHLKQH L      VYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVMVHGSAEATEHLKQHFLNIKNVQVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYE+AWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++DFKQFLASKG
Sbjct  621  NVLFKKLGDYEVAWVDAEVGKTENGMLSLLPISSPAPPHKSVLVGDLKMADFKQFLASKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGEYVTLRKVG+ SQ+GG +    Q II+EGPL E+YY IREYLYSQFY
Sbjct  681  VQVEFAGGALRCGEYVTLRKVGNPSQKGGTSGT--QQIIIEGPLCEDYYKIREYLYSQFY  738

Query  110  SL  105
             L
Sbjct  739  LL  740



>ref|XP_006394646.1| hypothetical protein EUTSA_v10003707mg [Eutrema salsugineum]
 gb|ESQ31932.1| hypothetical protein EUTSA_v10003707mg [Eutrema salsugineum]
Length=739

 Score =   275 bits (704),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH TAEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHATAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SLLP+  AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLLPMLSAATPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>gb|KDO52015.1| hypothetical protein CISIN_1g004656mg [Citrus sinensis]
Length=706

 Score =   275 bits (702),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -2

Query  629  VLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKL  450
            VLVHG+AEATEHLKQHCLKHVCPHVY PQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKL
Sbjct  534  VLVHGSAEATEHLKQHCLKHVCPHVYTPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKL  593

Query  449  GDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAG  270
            GDYEIAWVDAEVGKT++GMLSLLP+S  APPHK+VLVGDLK++D K FL+SKG+QVEFAG
Sbjct  594  GDYEIAWVDAEVGKTENGMLSLLPISTPAPPHKSVLVGDLKMADLKPFLSSKGIQVEFAG  653

Query  269  GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
            GALRCGEYVT+RKVG A Q+     +  Q I++EGPL E+YY IR YLYSQFY L
Sbjct  654  GALRCGEYVTIRKVGPAGQK--GGGSGTQQIVIEGPLCEDYYKIRAYLYSQFYLL  706



>ref|XP_002872080.1| CPSF100 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48339.1| CPSF100 [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 162/183 (89%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SLLP+S AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLLPMSGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_010454671.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Camelina sativa]
Length=739

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SL P++ AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLQPMAGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_010493506.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Camelina sativa]
Length=739

 Score =   273 bits (697),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SL P++ AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLQPMTGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_010550556.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550557.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Tarenaya hassleriana]
Length=762

 Score =   273 bits (698),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/185 (77%), Positives = 163/185 (88%), Gaps = 5/185 (3%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVHG+AEATEHLKQHCLK +CPHVYAPQIEET+DVTSDLCAYKVQLSE+LMS
Sbjct  580  HVSPLKLVLVHGSAEATEHLKQHCLKSICPHVYAPQIEETVDVTSDLCAYKVQLSERLMS  639

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMls--llplsdaapPHKTVLVGDLKLSDFKQFLAS  297
            NV+FKKLGDYE+AWVDAEVGKT++ MLS   +  +   PPHK+VLVGDLK++DFKQFL+S
Sbjct  640  NVIFKKLGDYEVAWVDAEVGKTETEMLSVLPMSSAAPPPPHKSVLVGDLKIADFKQFLSS  699

Query  296  KGVQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYS  120
            KGVQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYS
Sbjct  700  KGVQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYRIRDYLYS  757

Query  119  QFYSL  105
            QFY L
Sbjct  758  QFYLL  762



>ref|XP_010421194.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Camelina sativa]
Length=739

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SL P++ AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLQPMAGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_006287134.1| hypothetical protein CARUB_v10000306mg [Capsella rubella]
 gb|EOA20032.1| hypothetical protein CARUB_v10000306mg [Capsella rubella]
Length=739

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SL P+  AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVVFKKLGDSEVAWVDSEVGKTESDMRSLQPMPSAALPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_010421193.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Camelina sativa]
Length=739

 Score =   272 bits (696),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 161/183 (88%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S M SL P++ AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESDMRSLQPMAGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>gb|AAF82809.1|AF283277_1 polyadenylation cleavage/specificity factor 100 kDa subunit [Arabidopsis 
thaliana]
Length=739

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+  M SLLP+  AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTERDMRSLLPMPGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|NP_197776.1| cleavage and polyadenylation specificity factor 100 [Arabidopsis 
thaliana]
 sp|Q9LKF9.2|CPSF2_ARATH RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=AtCPSF100; Short=CPSF 100 
kDa subunit; AltName: Full=Protein EMBRYO DEFECTIVE 1265; 
AltName: Full=Protein ENHANCED SILENCING PHENOTYPE 5 [Arabidopsis 
thaliana]
 dbj|BAB10061.1| cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AAK59487.1| putative cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AAO42368.1| putative cleavage and polyadenylation specificity factor [Arabidopsis 
thaliana]
 gb|AED93228.1| cleavage and polyadenylation specificity factor 100 [Arabidopsis 
thaliana]
Length=739

 Score =   271 bits (692),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVYAPQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYAPQIEETVDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+  M SLLP+  AA PHK VLVGDLK++DFKQFL+SKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTERDMRSLLPMPGAASPHKPVLVGDLKIADFKQFLSSKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>gb|KFK27677.1| hypothetical protein AALP_AA8G414300 [Arabis alpina]
Length=735

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 160/183 (87%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH  AEATEHLKQHCL ++CPHVY+PQIEET+DVTSDLCAYKVQLSEKLMS
Sbjct  555  HVSPLKLVLVHAIAEATEHLKQHCLNNICPHVYSPQIEETVDVTSDLCAYKVQLSEKLMS  614

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S   SLLP+  AA PHK+VLVGDLK++DFKQFL+SKG
Sbjct  615  NVIFKKLGDSEVAWVDSEVGKTESDARSLLPIPSAASPHKSVLVGDLKIADFKQFLSSKG  674

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA     Q I++EGPL E+YY IR+YLYSQF
Sbjct  675  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGATGP--QQILIEGPLCEDYYKIRDYLYSQF  732

Query  113  YSL  105
            Y L
Sbjct  733  YLL  735



>emb|CDX88053.1| BnaA06g26440D [Brassica napus]
Length=739

 Score =   270 bits (691),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH TAEATEHLKQHCL  +CPHVYAP+IEETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHATAEATEHLKQHCLNSICPHVYAPKIEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S    L P++ AA PHK VLVGDLK+ DFKQFLASKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESEKRCLQPMASAAAPHKPVLVGDLKMQDFKQFLASKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>emb|CDX80392.1| BnaC07g30520D [Brassica napus]
Length=739

 Score =   270 bits (690),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH TAEATEHLKQHCL  +CPHVYAP+IEETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHATAEATEHLKQHCLNSICPHVYAPKIEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S    L P++ AA PHK VLVGDLK+ DFKQFLASKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESEKRCLQPMASAAAPHKPVLVGDLKMQDFKQFLASKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>ref|XP_009150911.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Brassica rapa]
Length=739

 Score =   270 bits (689),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HV+PLKLVLVH TAEATEHLKQHCL  +CPHVYAP+IEETIDVTSDLCAYKVQLSEKLMS
Sbjct  559  HVSPLKLVLVHATAEATEHLKQHCLNSICPHVYAPKIEETIDVTSDLCAYKVQLSEKLMS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+FKKLGD E+AWVD+EVGKT+S    L P++ AA PHK VLVGDLK+ DFKQFLASKG
Sbjct  619  NVIFKKLGDSEVAWVDSEVGKTESEKRCLQPMASAAAPHKPVLVGDLKMQDFKQFLASKG  678

Query  290  VQVEFA-GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            VQVEFA GGALRCGEYVTLRKVG   Q+GGA+    Q I++EGPL E+YY IR+YLYSQF
Sbjct  679  VQVEFAGGGALRCGEYVTLRKVGPTGQKGGASGP--QQILIEGPLCEDYYKIRDYLYSQF  736

Query  113  YSL  105
            Y L
Sbjct  737  YLL  739



>gb|KHN19838.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=180

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  18   HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  77

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+S G
Sbjct  78   NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSMG  137

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQR  210
            VQVEFAGGALRCGEYVTLRKVGDASQ+
Sbjct  138  VQVEFAGGALRCGEYVTLRKVGDASQK  164



>ref|XP_009340044.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2 [Pyrus x bretschneideri]
Length=738

 Score =   268 bits (684),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 157/182 (86%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEET DVTSDLCAYKVQLSEKLMS
Sbjct  561  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETTDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N+LFKKLGDYEIAWVD+E G  D  MLSL PLS   PPH++VLVGDLK+++FKQFL+ + 
Sbjct  621  NLLFKKLGDYEIAWVDSEAGXEDE-MLSLQPLSTPPPPHESVLVGDLKMANFKQFLSDED  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFA GALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY
Sbjct  680  VQVEFA-GALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_004308076.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Fragaria vesca subsp. vesca]
Length=739

 Score =   266 bits (681),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            H+APLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQ+EETIDVTSDLCAYK QLSE LMS
Sbjct  560  HMAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQLEETIDVTSDLCAYKAQLSEGLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++FKKLG+ EIAW D+EV KT+  MLSL P S  A PHK +LVGDLK+ DFKQFLA  G
Sbjct  620  NIIFKKLGENEIAWFDSEVRKTEDEMLSLQPCSTPARPHKPILVGDLKMGDFKQFLADNG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            VQVEFAGGALRCGE+VT+RKVGDAS +GG A++  Q I++EGP  E++Y IREYLYS FY
Sbjct  680  VQVEFAGGALRCGEHVTIRKVGDASHKGGGASS--QQIVIEGPACEDFYKIREYLYSHFY  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>gb|KHN18612.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=284

 Score =   251 bits (642),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 141/147 (96%), Gaps = 0/147 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  121  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  180

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+S G
Sbjct  181  NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSMG  240

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQR  210
            VQVEFAGGALRCGEYVTLRKVGDASQ+
Sbjct  241  VQVEFAGGALRCGEYVTLRKVGDASQK  267



>ref|NP_001063978.1| Os09g0569400 [Oryza sativa Japonica Group]
 sp|Q652P4.1|CPSF2_ORYSJ RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Oryza 
sativa Japonica Group]
 dbj|BAD46223.1| putative cleavage and polyadenylation specificity factor [Oryza 
sativa Japonica Group]
 dbj|BAF25892.1| Os09g0569400 [Oryza sativa Japonica Group]
Length=738

 Score =   263 bits (673),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCSKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGKTD  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  621  NVISKKLGEHEIAWVDAEVGKTDDKL-TLLPPSSTPAAHKSVLVGDLKLADFKQFLANKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+TLRK+GDA Q+G   +   Q I++EGPL E+YY IRE LYSQFY
Sbjct  680  LQVEFAGGALRCGEYITLRKIGDAGQKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_006661571.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Oryza brachyantha]
Length=738

 Score =   263 bits (671),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/182 (74%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCSKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVL KKLG++EIAWVDAE+GK D  + +LL  S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  621  NVLSKKLGEHEIAWVDAELGKADDKL-TLLAPSSTPAAHKSVLVGDLKLADFKQFLANKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+TLRK+GDASQ+    +   Q I++EGPL E+YY IRE LYSQFY
Sbjct  680  LQVEFAGGALRCGEYITLRKIGDASQK---GSTGCQQIVIEGPLCEDYYKIRELLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_006827641.1| hypothetical protein AMTR_s00009p00247750 [Amborella trichopoda]
 gb|ERM95057.1| hypothetical protein AMTR_s00009p00247750 [Amborella trichopoda]
Length=737

 Score =   260 bits (664),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 153/182 (84%), Gaps = 8/182 (4%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLK+VC HVYAPQI ETIDVTSDLCAYKV+LSE+LMS
Sbjct  564  HVAPLKLVLVHGSAEATEHLKQHCLKNVCSHVYAPQIGETIDVTSDLCAYKVRLSERLMS  623

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAW+D EV +TD GML+L+PLS   P HK+VLVGDLKL+DFKQFLASKG
Sbjct  624  NVLFKKLGDYEIAWIDGEVNETD-GMLTLVPLSTGPPLHKSVLVGDLKLADFKQFLASKG  682

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V  EF+ G LRCGE +TLRKVGD+         A Q + +EGPL+EEYY IRE LYSQFY
Sbjct  683  VPAEFSKGFLRCGENITLRKVGDSK-------GATQQVGIEGPLTEEYYKIRELLYSQFY  735

Query  110  SL  105
             L
Sbjct  736  LL  737



>ref|XP_003578687.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X2 [Brachypodium distachyon]
Length=738

 Score =   259 bits (661),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  621  NVISKKLGEHEIAWVDAEVGKVDEKL-NLLPPSSTPSAHKSVLVGDLKLADFKQFLANKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  680  LQVEFAGGALRCGEYITVRKIGDSNQKGSTVS---QQIVIEGPLCEDYYKIRELLYSQFF  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|XP_010230345.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X1 [Brachypodium distachyon]
Length=739

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  562  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  622  NVISKKLGEHEIAWVDAEVGKVDEKL-NLLPPSSTPSAHKSVLVGDLKLADFKQFLANKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  681  LQVEFAGGALRCGEYITVRKIGDSNQKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFF  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_010238537.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like isoform X1 [Brachypodium distachyon]
Length=739

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  562  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  621

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  622  NVISKKLGEHEIAWVDAEVGKVDEKL-NLLPPSSTPSAHKSVLVGDLKLADFKQFLANKG  680

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  681  LQVEFAGGALRCGEYITVRKIGDSNQKGSTVS---QQIVIEGPLCEDYYKIRELLYSQFF  737

Query  110  SL  105
             L
Sbjct  738  LL  739



>ref|XP_003565596.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 isoform X2 [Brachypodium distachyon]
Length=738

 Score =   259 bits (661),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  621  NVISKKLGEHEIAWVDAEVGKVDEKL-NLLPPSSTPSAHKSVLVGDLKLADFKQFLANKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  680  LQVEFAGGALRCGEYITVRKIGDSNQKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFF  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>gb|EMT31904.1| hypothetical protein F775_28078 [Aegilops tauschii]
Length=748

 Score =   256 bits (654),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  571  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  630

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVL KKLG++EIAWVD+ VGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  631  NVLSKKLGEHEIAWVDSGVGKVDEKL-TLLPPSSTPAAHKSVLVGDLKLADFKQFLANKG  689

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  690  LQVEFAGGALRCGEYITVRKIGDSNQKGSTGS---QQIVVEGPLCEDYYKIRELLYSQFF  746

Query  110  SL  105
             L
Sbjct  747  LL  748



>gb|KHN41472.1| Cleavage and polyadenylation specificity factor subunit 2 [Glycine 
soja]
Length=775

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  613  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  672

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NVLFKKLGDYEIAWVDA VGKT++  LSLLP+S AAPPHK+VLVGDLKL+D KQFL+SKG
Sbjct  673  NVLFKKLGDYEIAWVDAVVGKTENDPLSLLPVSGAAPPHKSVLVGDLKLADIKQFLSSKG  732

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQR  210
            VQVEFAGGALRCGEYVTLRKVGDASQ+
Sbjct  733  VQVEFAGGALRCGEYVTLRKVGDASQK  759



>gb|EMS56660.1| Cleavage and polyadenylation specificity factor subunit 2 [Triticum 
urartu]
Length=741

 Score =   254 bits (649),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 154/182 (85%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  564  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  623

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVD+ VGK D  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  624  NVISKKLGEHEIAWVDSGVGKVDEKL-TLLPPSSTPAAHKSVLVGDLKLADFKQFLANKG  682

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  683  LQVEFAGGALRCGEYITVRKIGDSNQKGSTGS---QQIVVEGPLCEDYYKIRELLYSQFF  739

Query  110  SL  105
             L
Sbjct  740  LL  741



>ref|XP_003590278.1| Cleavage and polyadenylation specificity factor subunit [Medicago 
truncatula]
Length=196

 Score =   239 bits (609),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 3/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLV +      + + +    K VCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  18   HVAPLKLVWIFLVFFNSIN-RAALSKDVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  76

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            +VLFKKLG+YE+AWVDAE GKT++ MLSLLP+S A  PHK+VLVGDLKL+DFKQFL++KG
Sbjct  77   SVLFKKLGEYEVAWVDAEAGKTENDMLSLLPVSGAPHPHKSVLVGDLKLADFKQFLSTKG  136

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            V VEFAGGALRCGEYVT+RKVGDA+Q+G  +    Q II+EGPL E+YY IR+YLYSQFY
Sbjct  137  VPVEFAGGALRCGEYVTVRKVGDATQKGAGSGT--QQIIIEGPLCEDYYKIRDYLYSQFY  194

Query  110  SL  105
             L
Sbjct  195  LL  196



>dbj|BAJ85972.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score =   253 bits (646),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQ+EETIDVTSDLCAYKVQLSEKLMS
Sbjct  549  HVAPLKLVLVHGSAEATEHLKMHCAKNSDLHVYAPQLEETIDVTSDLCAYKVQLSEKLMS  608

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDA VGK D  + SL+P S     H +VLVGDLKL+DFKQFLA+KG
Sbjct  609  NVISKKLGEHEIAWVDAGVGKADEKL-SLVPPSSIPAAHNSVLVGDLKLADFKQFLANKG  667

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +QVEFAGGALRCGEY+T+RK+GD++Q+G   +   Q I++EGPL E+YY IRE LYSQF+
Sbjct  668  LQVEFAGGALRCGEYITVRKIGDSNQKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFF  724

Query  110  SL  105
             L
Sbjct  725  LL  726



>ref|XP_002466129.1| hypothetical protein SORBIDRAFT_01g001930 [Sorghum bicolor]
 gb|EER93127.1| hypothetical protein SORBIDRAFT_01g001930 [Sorghum bicolor]
Length=738

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 153/182 (84%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K++  HV+APQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCTKNLDLHVHAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++ KKLG++EIAWVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQFL +KG
Sbjct  621  NIISKKLGEHEIAWVDAEVGKEDEKL-ILLPPSSTPPPHKPVLVGDLKLSDFKQFLENKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
             QVEFAGGALRCGEY+ +RK+GD+SQ+G   +   Q I++EGPL E+YY IRE LYSQFY
Sbjct  680  WQVEFAGGALRCGEYIMVRKIGDSSQKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFY  736

Query  110  SL  105
             L
Sbjct  737  LL  738



>ref|NP_001151557.1| LOC100285191 [Zea mays]
 gb|ACG43309.1| cleavage and polyadenylation specificity factor, 100 kDa subunit 
[Zea mays]
Length=673

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKL+LVHG+AEATEHLK HC K++  HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  496  HVAPLKLILVHGSAEATEHLKMHCAKNLDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  555

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++ KKLG++EIAWVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQFL +KG
Sbjct  556  NIISKKLGEHEIAWVDAEVGKEDEKL-ILLPPSSTPPPHKPVLVGDLKLSDFKQFLENKG  614

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
             QVEFAGGALRCGEY+ +RKVGD+  +G   +   Q I++EGPL E+YY IRE LYSQFY
Sbjct  615  WQVEFAGGALRCGEYIMVRKVGDSILKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFY  671

Query  110  SL  105
             L
Sbjct  672  LL  673



>ref|XP_008673000.1| PREDICTED: LOC100285191 isoform X1 [Zea mays]
 gb|ACL53436.1| unknown [Zea mays]
 tpg|DAA59077.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 1 [Zea mays]
 tpg|DAA59078.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 2 [Zea mays]
 tpg|DAA59079.1| TPA: cleavage and polyadenylation specificity factor, subunit 
isoform 3 [Zea mays]
Length=737

 Score =   244 bits (622),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 4/182 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKL+LVHG+AEATEHLK HC K++  HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLILVHGSAEATEHLKMHCAKNLDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++ KKLG++EIAWVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQFL +KG
Sbjct  620  NIISKKLGEHEIAWVDAEVGKEDEKL-ILLPPSSTPPPHKPVLVGDLKLSDFKQFLENKG  678

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
             QVEFAGGALRCGEY+ +RKVGD+  +G   +   Q I++EGPL E+YY IRE LYSQFY
Sbjct  679  WQVEFAGGALRCGEYIMVRKVGDSILKGSTGS---QQIVIEGPLCEDYYKIRELLYSQFY  735

Query  110  SL  105
             L
Sbjct  736  LL  737



>ref|XP_004956221.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Setaria italica]
Length=737

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 152/182 (84%), Gaps = 5/182 (3%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K++  HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCAKNLDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++ KKLG++EIAWVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQFL +KG
Sbjct  621  NIICKKLGEHEIAWVDAEVGKEDEKL-ILLPPSSKPPPHKPVLVGDLKLSDFKQFLENKG  679

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
             QVEF+GGALRCGE++T+RK+GD+ +    +    Q I++EGPL E+YY IRE+LYSQFY
Sbjct  680  WQVEFSGGALRCGEHITVRKIGDSQKGSTGS----QQIVIEGPLCEDYYKIREHLYSQFY  735

Query  110  SL  105
             L
Sbjct  736  LL  737



>gb|EEC85091.1| hypothetical protein OsI_32459 [Oryza sativa Indica Group]
Length=1195

 Score =   239 bits (609),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 147/177 (83%), Gaps = 8/177 (5%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCSKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            NV+ KKLG++EIAWVDAEVGKTD  + +LLP S     HK+VLVGDLKL+DFKQFLA+KG
Sbjct  621  NVISKKLGEHEIAWVDAEVGKTDDKL-TLLPPSSTPAAHKSVLVGDLKLADFKQFLANKG  679

Query  290  ----VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
                +QVEFAGGALRCGEY+TLRK+GDA Q+G   +   Q I++EGPL E+YY I+ 
Sbjct  680  LRDFLQVEFAGGALRCGEYITLRKIGDAGQKGSTGS---QQIVIEGPLCEDYYKIQR  733



>tpg|DAA59080.1| TPA: hypothetical protein ZEAMMB73_548570 [Zea mays]
Length=766

 Score =   232 bits (592),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/205 (65%), Positives = 152/205 (74%), Gaps = 27/205 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKL+LVHG+AEATEHLK HC K++  HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  566  HVAPLKLILVHGSAEATEHLKMHCAKNLDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  625

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            N++ KKLG++EIAWVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQFL +KG
Sbjct  626  NIISKKLGEHEIAWVDAEVGKEDEKL-ILLPPSSTPPPHKPVLVGDLKLSDFKQFLENKG  684

Query  290  -----------------------VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQH  180
                                   +QVEFAGGALRCGEY+ +RKVGD+  +G   +   Q 
Sbjct  685  WQDFSVERERIKYVEIQSLRKELLQVEFAGGALRCGEYIMVRKVGDSILKGSTGS---QQ  741

Query  179  IILEGPLSEEYYTIREYLYSQFYSL  105
            I++EGPL E+YY IRE LYSQFY L
Sbjct  742  IVIEGPLCEDYYKIRELLYSQFYLL  766



>ref|XP_001757858.1| predicted protein [Physcomitrella patens]
 gb|EDQ77498.1| predicted protein [Physcomitrella patens]
Length=724

 Score =   231 bits (589),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 143/182 (79%), Gaps = 11/182 (6%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAP+KLVLVHG+AEATEHL+QHC+K+VC  VYAP+I ET DVTSDLCAYKV+L+E+LMS
Sbjct  554  HVAPIKLVLVHGSAEATEHLRQHCVKNVCRDVYAPRIGETQDVTSDLCAYKVRLTERLMS  613

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            +VLF+KLGDYE+AW+D E+G  +S  +  L  S+  PPHK+V VGDL+L+DFKQ LA+KG
Sbjct  614  SVLFRKLGDYEVAWIDGEIGSQESEGMLPLLPSETPPPHKSVFVGDLRLADFKQLLATKG  673

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +Q EFAGG LRCG+   +R+ G +           Q +++EGPLSEEYY +R+ LYSQFY
Sbjct  674  IQAEFAGGVLRCGDAFAVRRSGGS-----------QQLVIEGPLSEEYYKLRDLLYSQFY  722

Query  110  SL  105
             L
Sbjct  723  ML  724



>ref|XP_002971541.1| hypothetical protein SELMODRAFT_441578 [Selaginella moellendorffii]
 gb|EFJ27290.1| hypothetical protein SELMODRAFT_441578 [Selaginella moellendorffii]
Length=721

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 141/180 (78%), Gaps = 12/180 (7%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVL+HG+AE+TEHLKQHCLK+VCP VY P++ E ++VTSDL AYK++L+E++MS
Sbjct  552  HVAPLKLVLIHGSAESTEHLKQHCLKNVCPFVYTPRVGENMNVTSDLNAYKLRLTERIMS  611

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKG  291
            +VLF+KLGDYE+AWVD E+G+ +  +L LLPL    PPHKTV VGDL+L+DFKQ LA+KG
Sbjct  612  SVLFRKLGDYELAWVDGEIGQNEEDLLPLLPLDGTPPPHKTVFVGDLRLADFKQLLATKG  671

Query  290  VQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            +Q EFAGG LRC + + +RK G             Q +++EG LS++YY +RE LYSQ++
Sbjct  672  IQAEFAGGVLRCADNIAVRKSGG------------QQLVIEGSLSDDYYKVRELLYSQYH  719



>ref|XP_002991596.1| hypothetical protein SELMODRAFT_429848 [Selaginella moellendorffii]
 gb|EFJ07350.1| hypothetical protein SELMODRAFT_429848 [Selaginella moellendorffii]
Length=715

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 134/173 (77%), Gaps = 12/173 (7%)
 Frame = -2

Query  629  VLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKL  450
            VL+HG+AE+TEHLKQHCLK+VCP VY P++ E ++VTSDL AYK++L+E++MS+VLF+KL
Sbjct  553  VLIHGSAESTEHLKQHCLKNVCPFVYTPRVGENMNVTSDLNAYKLRLTERIMSSVLFRKL  612

Query  449  GDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAG  270
            GDYE+AWVD E+G+ +  +L LLPL    PPHKTV VGDL+L+DFKQ LA+KG+Q EFAG
Sbjct  613  GDYELAWVDGEIGQNEEDLLPLLPLDGTPPPHKTVFVGDLRLADFKQLLATKGIQAEFAG  672

Query  269  GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
            G LRC + + +RK G             Q +++EG LS++YY +RE LYSQ++
Sbjct  673  GVLRCADNIAVRKSGG------------QQLVIEGSLSDDYYKVRELLYSQYH  713



>ref|XP_006591227.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Glycine max]
Length=132

 Score =   168 bits (426),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/84 (95%), Positives = 83/84 (99%), Gaps = 0/84 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  18   HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  77

Query  470  NVLFKKLGDYEIAWVDAEVGKTDS  399
            NVLFKKLGDYEIAWVDA VGKT++
Sbjct  78   NVLFKKLGDYEIAWVDAVVGKTEN  101



>ref|XP_008374080.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Malus domestica]
Length=122

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 95/116 (82%), Gaps = 2/116 (2%)
 Frame = -2

Query  452  LGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFA  273
            LGDYEIAWVD+  GKT++ MLSL PLS   PPH+ VLVGDLK+++FKQFL+ KGVQVEFA
Sbjct  9    LGDYEIAWVDSGAGKTENEMLSLQPLSTPPPPHEYVLVGDLKMANFKQFLSDKGVQVEFA  68

Query  272  GGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
            GGALRCGEYVTLRKVGDAS +     +  Q I++EGPL E+YY IREYLYSQFY L
Sbjct  69   GGALRCGEYVTLRKVGDASHK--GGGSGTQQIVIEGPLCEDYYKIREYLYSQFYLL  122



>ref|XP_006421947.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
 gb|ESR35187.1| hypothetical protein CICLE_v10004414mg [Citrus clementina]
Length=634

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/68 (94%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLKQHCLKHVCPHVY PQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  560  HVAPLKLVLVHGSAEATEHLKQHCLKHVCPHVYTPQIEETIDVTSDLCAYKVQLSEKLMS  619

Query  470  NVLFKKLG  447
            NVLFKK+ 
Sbjct  620  NVLFKKVS  627



>ref|XP_001955372.1| GF16269 [Drosophila ananassae]
 gb|EDV43933.1| GF16269 [Drosophila ananassae]
Length=756

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 110/200 (55%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  566  QLRPRRVIVIHGTAEGTQVVAKHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  625

Query  470  NVLFKKLGDYEIAWVDAEVG----KTDSGMlsllplsdaapP----------------HK  351
             + F+K  D E+AWVD  +G      D+ M       ++A                  H 
Sbjct  626  QLQFQKGKDAEVAWVDGRLGMRLKAIDAAMDVTAEQDNSAQEAKTLTLETLAEDEIPVHN  685

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + 
Sbjct  686  SVLINELKLSDFKQILMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VA  733

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  734  MEGCLSEEYYKIRELLYEQY  753



>ref|XP_002013649.1| GL24248 [Drosophila persimilis]
 gb|EDW24635.1| GL24248 [Drosophila persimilis]
Length=583

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/203 (36%), Positives = 109/203 (54%), Gaps = 36/203 (18%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++++VHGT E T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  390  QLRPRRVIVVHGTEEGTQVVAKHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  449

Query  470  NVLFKKLGDYEIAWVDAEVG-----------------KTDSGMlsllplsdaapP-----  357
             + F+K  D E+AWVD  +G                 + D+ M     L+          
Sbjct  450  QLQFQKGKDAEVAWVDGRLGMRLKAIDAPPTAMDVTVEQDAAMQEGKTLTLETLEEDEIP  509

Query  356  -HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQ  183
             H +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +          
Sbjct  510  VHNSVLINELKLSDFKQILLRNNINSEFSGGVLWCTNGTLALRRV-DAGK----------  558

Query  182  HIILEGPLSEEYYTIREYLYSQF  114
             + +EG LSEEYY IRE LY Q+
Sbjct  559  -VAMEGCLSEEYYKIRELLYEQY  580



>ref|NP_651658.1| cleavage and polyadenylation specificity factor 100 [Drosophila 
melanogaster]
 sp|Q9V3D6.1|CPSF2_DROME RecName: Full=Probable cleavage and polyadenylation specificity 
factor subunit 2; AltName: Full=Cleavage and polyadenylation 
specificity factor 100 kDa subunit; Short=CPSF 100 kDa subunit 
[Drosophila melanogaster]
 gb|AAD46873.1|AF160933_1 LD14168p [Drosophila melanogaster]
 gb|AAF56844.1| cleavage and polyadenylation specificity factor 100 [Drosophila 
melanogaster]
Length=756

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/200 (37%), Positives = 108/200 (54%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVTS++  Y+V+L+E L+S
Sbjct  566  QLRPRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEIIDVTSEIHIYQVRLTEGLVS  625

Query  470  NVLFKKLGDYEIAWVDAEVG--------------------KTDSGMlsllplsdaapPHK  351
             + F+K  D E+AWVD  +G                    +    +       D  P H 
Sbjct  626  QLQFQKGKDAEVAWVDGRLGMRVKAIEAPMDVTVEQDASVQEGKTLTLETLADDEIPIHN  685

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + 
Sbjct  686  SVLINELKLSDFKQTLMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VA  733

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  734  MEGCLSEEYYKIRELLYEQY  753



>ref|XP_002098643.1| GE26465, isoform A [Drosophila yakuba]
 gb|EDW98355.1| GE26465, isoform A [Drosophila yakuba]
Length=756

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  566  QLRPRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  625

Query  470  NVLFKKLGDYEIAWVDAEVG--------------------KTDSGMlsllplsdaapPHK  351
             + F+K  D E+AWVD  +G                    +    +       D  P H 
Sbjct  626  QLQFQKGKDAEVAWVDGRLGMRVKAIEAPMDVTVEQDASVQEGKTLTLETLADDEIPIHN  685

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + 
Sbjct  686  SVLINELKLSDFKQILMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VA  733

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  734  MEGCLSEEYYKIRELLYEQY  753



>ref|XP_002054797.1| GJ24636 [Drosophila virilis]
 gb|EDW68317.1| GJ24636 [Drosophila virilis]
Length=693

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/202 (36%), Positives = 109/202 (54%), Gaps = 35/202 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++++VHGTAE T+ + +HC ++V   V+APQ  E IDVT+++  Y+V+L+E L+S
Sbjct  501  QLRPRRVIVVHGTAEGTQVVAKHCEQNVGARVFAPQKGEIIDVTTEIHIYQVRLTEGLVS  560

Query  470  NVLFKKLGDYEIAWVDAEVG----------------------KTDSGMlsllplsdaapP  357
             + F+K  D E+AW+D  +G                      +    +       D  P 
Sbjct  561  QLQFQKGKDAEVAWIDGRLGMRLQAIDAPNQSEVTVEQDVAAQEGKTLTLETLEEDEIPV  620

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQH  180
            H +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           
Sbjct  621  HNSVLINELKLSDFKQVLMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------  668

Query  179  IILEGPLSEEYYTIREYLYSQF  114
            + +EG LSE+YY IRE LY Q+
Sbjct  669  VAMEGCLSEDYYKIRELLYEQY  690



>ref|XP_001981406.1| GG11633 [Drosophila erecta]
 gb|EDV53276.1| GG11633 [Drosophila erecta]
Length=756

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  566  QLRPRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  625

Query  470  NVLFKKLGDYEIAWVDAEVG--------------------KTDSGMlsllplsdaapPHK  351
             + F+K  D E+AWVD  +G                    +    +       D  P H 
Sbjct  626  QLQFQKGKDAEVAWVDGRLGMRVKAIEAPMDVTVEQDASVQEGKTLTLETLDDDEIPIHN  685

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + 
Sbjct  686  SVLINELKLSDFKQILMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VA  733

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  734  MEGCLSEEYYKIRELLYEQY  753



>ref|XP_002105288.1| GD21403 [Drosophila simulans]
 gb|EDX14791.1| GD21403 [Drosophila simulans]
Length=664

 Score =   119 bits (298),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 72/197 (37%), Positives = 109/197 (55%), Gaps = 33/197 (17%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S + 
Sbjct  477  PRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVSQLQ  536

Query  461  FKKLGDYEIAWVDAEVG--------------KTDSGMlsllplsdaapP------HKTVL  342
            F+K  D E+AWVD  +G              + D+ +     L+           H +VL
Sbjct  537  FQKGKDAEVAWVDGRLGMRVKAIEAPMDVTVEQDASVQEGKTLTLETLADDEIPIHNSVL  596

Query  341  VGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHIILEG  165
            + +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + +EG
Sbjct  597  INELKLSDFKQTLMRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VAMEG  644

Query  164  PLSEEYYTIREYLYSQF  114
             LSEEYY IRE LY Q+
Sbjct  645  CLSEEYYKIRELLYEQY  661



>ref|XP_002037143.1| GM12754 [Drosophila sechellia]
 gb|EDW53302.1| GM12754 [Drosophila sechellia]
Length=743

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +++++HGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  553  QLRPRRVIVIHGTAEGTQVVARHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  612

Query  470  NVLFKKLGDYEIAWVDAEVG--------------------KTDSGMlsllplsdaapPHK  351
             + F+K  D E+AWVD  +G                    +    +       D  P H 
Sbjct  613  QLQFQKGKDAEVAWVDGRLGMRVKAIEAPMDVTVEQDASVQEGKTLTLETLADDEIPIHN  672

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR+V DA +           + 
Sbjct  673  SVLINELKLSDFKQTLLRNNINSEFSGGVLWCSNGTLALRRV-DAGK-----------VA  720

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  721  MEGCLSEEYYKIRELLYEQY  740



>ref|XP_011203816.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Bactrocera dorsalis]
Length=745

 Score =   119 bits (298),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 105/199 (53%), Gaps = 31/199 (16%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++++VHG+ EAT  + +HC +++   V+ PQ  ETID T++   Y+V+L+E L++
Sbjct  555  QLRPRRVIVVHGSEEATSVVAKHCQQNIGARVFTPQKGETIDATTESHIYQVRLTEGLVA  614

Query  470  NVLFKKLGDYEIAWVDAEVG---------KTDSG-----------MlsllplsdaapPHK  351
             + F+K  D E+AWVDA +G          TD G           +      +D  P H 
Sbjct  615  QLQFQKGKDAEVAWVDARIGVRTQAIDSRATDDGDMEVEVSEDKTLTLETLETDDIPVHN  674

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIIL  171
             VL+ +LKLSDFKQ L    +  EF+GG L C       +  DA +           + +
Sbjct  675  AVLINELKLSDFKQVLMRNNISSEFSGGVLWCANGTLALRRMDAGK-----------VTM  723

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG +SEEYY IRE LY Q+
Sbjct  724  EGCVSEEYYKIRELLYEQY  742



>gb|EEE70266.1| hypothetical protein OsJ_30409 [Oryza sativa Japonica Group]
Length=1073

 Score =   119 bits (298),  Expect = 7e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            HVAPLKLVLVHG+AEATEHLK HC K+   HVYAPQIEETIDVTSDLCAYKVQLSEKLMS
Sbjct  561  HVAPLKLVLVHGSAEATEHLKMHCSKNSDLHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  620

Query  470  NVLFKK  453
            NV+ KK
Sbjct  621  NVISKK  626



>ref|XP_002071979.1| GK22564 [Drosophila willistoni]
 gb|EDW82965.1| GK22564 [Drosophila willistoni]
Length=757

 Score =   117 bits (293),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 69/196 (35%), Positives = 106/196 (54%), Gaps = 32/196 (16%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHGTAE T+ + +HC ++V   V+ P   E IDVT+++  Y+V+L+E L+S + 
Sbjct  571  PRRVIVVHGTAEGTKAVARHCEQNVGARVFTPNKGEIIDVTTEIHIYQVRLTEGLVSQLQ  630

Query  461  FKKLGDYEIAWVDAEVG-------------------KTDSGMlsllplsdaapPHKTVLV  339
            F+K  + E+AWVD  +G                   +    +       D  P H +VL+
Sbjct  631  FQKAKNAEVAWVDGRLGMRLKAIDGATNPTEQEVSIQEGQTLTLETLEEDEIPVHNSVLI  690

Query  338  GDLKLSDFKQFLASKGVQVEFAGGALRCG-EYVTLRKVGDASQRggaaaaAIQHIILEGP  162
             +LKLSDFKQ L    +  EF+GG L C    + LR++ DA +           + +EG 
Sbjct  691  NELKLSDFKQILMRNNINSEFSGGVLWCSNNTLALRRI-DAGK-----------VSMEGC  738

Query  161  LSEEYYTIREYLYSQF  114
            LSE+YY IRE LY Q+
Sbjct  739  LSEDYYKIRELLYEQY  754



>ref|XP_001994270.1| GH10247 [Drosophila grimshawi]
 gb|EDV95006.1| GH10247 [Drosophila grimshawi]
Length=754

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 105/202 (52%), Gaps = 35/202 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++++VHGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S
Sbjct  562  QLRPRRVIVVHGTAEGTQVVAKHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVS  621

Query  470  NVLFKKLGDYEIAWVDAEVG----------------------KTDSGMlsllplsdaapP  357
             + F+K  D E+AW+D  +G                      +    +       D  P 
Sbjct  622  QLQFQKGKDAEVAWIDGRLGMRLQAIDAPNQSEITVEQDVAAQEGKTLTLETLAEDEIPV  681

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQH  180
            H +VL+ +LKLSDFKQ L    +  EF+GG L  C   + LR+V                
Sbjct  682  HNSVLINELKLSDFKQVLMRNSINSEFSGGVLWCCNGTLALRRVDTGK------------  729

Query  179  IILEGPLSEEYYTIREYLYSQF  114
            + +EG +SEEYY IRE LY Q+
Sbjct  730  VAMEGCISEEYYKIRELLYEQY  751



>ref|XP_001999467.1| GI23051 [Drosophila mojavensis]
 gb|EDW14928.1| GI23051 [Drosophila mojavensis]
Length=754

 Score =   116 bits (290),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 71/199 (36%), Positives = 107/199 (54%), Gaps = 35/199 (18%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHGTAE T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S + 
Sbjct  565  PRRVIVVHGTAEGTQIVAKHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVSQLQ  624

Query  461  FKKLGDYEIAWVDAEVG--------KTDS--------------GMlsllplsdaapPHKT  348
            F+K  D E+AW+D  +G         T S               +   +   D  P H +
Sbjct  625  FQKGKDAEVAWIDGRLGMRLQAIDAPTQSEVTVEQDVAALEGKTLTLEMLEEDEIPVHNS  684

Query  347  VLVGDLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIIL  171
            VL+ +LKLSDFKQ L    +  EF+GG L  C   + LR+V             +  + +
Sbjct  685  VLINELKLSDFKQVLMRNNINSEFSGGVLWCCNGTLALRRVD------------VGKVAM  732

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG LSE+YY IRE LY Q+
Sbjct  733  EGCLSEDYYKIRELLYEQY  751



>ref|XP_004519762.1| PREDICTED: LOW QUALITY PROTEIN: probable cleavage and polyadenylation 
specificity factor subunit 2-like [Ceratitis capitata]
Length=765

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 67/198 (34%), Positives = 103/198 (52%), Gaps = 34/198 (17%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHGT +AT  + +HC +++   V+ PQ  ETID T++   Y+V+L+E L++ + 
Sbjct  577  PRRVIVVHGTQDATNIVAKHCQQNIGARVFTPQKGETIDATTESHIYQVRLTEGLVAQLQ  636

Query  461  FKKLGDYEIAWVDAEVG---------------------KTDSGMlsllplsdaapPHKTV  345
            F+K  D E+AWVDA +G                       D  +      +D  P H  V
Sbjct  637  FQKGKDAEVAWVDARIGVRTQAIDTRAQSDVENMEVEISEDKTLTLETLETDEIPVHNAV  696

Query  344  LVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHIILE  168
            L+ +LKLSDFKQ L    +  EF+GG L C    + LR++                + +E
Sbjct  697  LINELKLSDFKQVLMRNNISSEFSGGVLWCANGTLALRRMDTGK------------VTME  744

Query  167  GPLSEEYYTIREYLYSQF  114
            G +SEEYY IR+ LY Q+
Sbjct  745  GCVSEEYYKIRDLLYEQY  762



>ref|XP_005178538.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Musca domestica]
Length=752

 Score =   114 bits (285),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 65/202 (32%), Positives = 102/202 (50%), Gaps = 38/202 (19%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHG  EAT  + +HC +++   V+AP   ET+DVT++   Y+V+L+E L++ + 
Sbjct  560  PRRVIVVHGVEEATMAVARHCEQNIGARVFAPHKGETVDVTTETHIYQVRLTEGLVAQLQ  619

Query  461  FKKLGDYEIAWVDAEVGKTDSGMlsllplsdaap-------------------------P  357
            F+K  D E+AW+DA +G     + +     +                             
Sbjct  620  FQKGKDAEVAWIDARIGMRTQAIDAAATNQNNEADNDVTETTTEERTLTLESLETDEIPV  679

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQH  180
            H +VL+ +LKLSDFKQ L    +  EF+GG L C    + LR++                
Sbjct  680  HNSVLINELKLSDFKQILMRNNINSEFSGGVLWCSNGSLALRRIDTGK------------  727

Query  179  IILEGPLSEEYYTIREYLYSQF  114
            + +EG LSEEYY IRE LY Q+
Sbjct  728  VTMEGCLSEEYYKIRELLYEQY  749



>ref|XP_011184046.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Bactrocera cucurbitae]
Length=747

 Score =   114 bits (284),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 68/197 (35%), Positives = 101/197 (51%), Gaps = 32/197 (16%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHGT EAT  + +HC  ++   V+ PQ  ETID T++   Y+V+L+E L++ + 
Sbjct  559  PRRVIVVHGTEEATNVVAKHCQLNIGARVFTPQKGETIDATTESHIYQVRLTEGLVAQLQ  618

Query  461  FKKLGDYEIAWVDAEVG---------------------KTDSGMlsllplsdaapPHKTV  345
            F+K  D E+AWVDA +G                       +  +      +D  P H  V
Sbjct  619  FQKGKDAEVAWVDALIGMRTQAIDSRAPSDGENMEVEVSEEKTLTLETLETDDIPVHNAV  678

Query  344  LVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEG  165
            L+ +LKLSDFKQ L    +  EF+GG L C       +  DA +           + +EG
Sbjct  679  LINELKLSDFKQVLMRNNISSEFSGGVLWCANGTLALRRMDAGK-----------VTMEG  727

Query  164  PLSEEYYTIREYLYSQF  114
             +SEEYY IRE LY Q+
Sbjct  728  CVSEEYYKIRELLYEQY  744



>emb|CDS10120.1| hypothetical protein LRAMOSA02797 [Absidia idahoensis var. thermophila]
Length=780

 Score =   109 bits (273),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 100/184 (54%), Gaps = 18/184 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG    TE L Q C  + H    V+ P I E ++V++    Y+V+L++ L
Sbjct  605  QIAPRKLIIVHGLQGPTEELAQACRNMDHFTKEVFTPSIGEVLNVSAATNIYRVKLTDAL  664

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQF  306
            +S++ F KL DYE+A V   +     + +  L +      +    +V VGD++LS+FK+ 
Sbjct  665  VSSLRFSKLDDYELARVSGRIHFPSDSTTPSLDVDTSEKPSKWEPSVFVGDIRLSEFKRI  724

Query  305  LASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
            L ++G+  EF G G L C + V +RK G               +++EG LS +YY IR  
Sbjct  725  LQNEGISAEFKGEGVLVCNDRVAVRKTGTG------------QLLVEGLLSPDYYKIRSL  772

Query  128  LYSQ  117
            LYSQ
Sbjct  773  LYSQ  776



>gb|EPB87138.1| hypothetical protein HMPREF1544_06064 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=741

 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 104/184 (57%), Gaps = 18/184 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG+  +TE L   C  + H    ++ P + E ++V++    Y+V+L++ +
Sbjct  566  QIAPRKLIIVHGSQSSTEDLATACQGMDHFTKEIFTPSVSEVLNVSAATNIYRVKLTDSM  625

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHK---TVLVGDLKLSDFKQF  306
            +S++ F KL DYE+A V   +   D      L ++ +  P K   +V VGD++L++FK+ 
Sbjct  626  VSSLRFSKLDDYELARVVGRIHFPDDSTTPSLDVAVSDGPTKWEPSVFVGDVRLTEFKKI  685

Query  305  LASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
            L ++G+Q EF G G L C + V +RK G               +++EG +S +YY IR  
Sbjct  686  LQAEGIQAEFKGEGILVCNDQVAVRKTGTG------------QLLVEGAISMDYYKIRSL  733

Query  128  LYSQ  117
            LYSQ
Sbjct  734  LYSQ  737



>emb|CDH57001.1| cleavage and polyadenylation specificity factorsubunit 2 [Lichtheimia 
corymbifera JMRC:FSU:9682]
Length=783

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 100/184 (54%), Gaps = 18/184 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG    T+ L Q C  + H    V+ P I E ++V++    Y+V+L++ L
Sbjct  608  QIAPRKLIIVHGLQGPTQELAQACRNMDHFTKEVFTPSIGEVLNVSAATNIYRVKLTDAL  667

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQF  306
            +S++ F KL DYE+A V   +     + +  L +      +    +V VGD++LS+FK+ 
Sbjct  668  VSSLQFSKLDDYELARVSGRIHFPSDSTTPSLDVDTSEKPSKWEPSVFVGDIRLSEFKRI  727

Query  305  LASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
            L ++G+  EF G G L C + V +RK G               +++EG LS +YY IR  
Sbjct  728  LQNEGISAEFKGEGVLVCNDRVAVRKTGTG------------QLLVEGLLSPDYYKIRSL  775

Query  128  LYSQ  117
            LYSQ
Sbjct  776  LYSQ  779



>ref|XP_001657690.1| AAEL000118-PA [Aedes aegypti]
 gb|EAT48881.1| AAEL000118-PA [Aedes aegypti]
Length=744

 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 100/200 (50%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++V++ G+ + T H+ +HC  ++   V+ P   E ID T++   Y+V+L+E L+S
Sbjct  554  QLRPRRVVVIRGSPQNTAHIAEHCQLNIGARVFTPNRGEIIDATTETHIYQVRLTEALIS  613

Query  470  NVLFKKLGDYEIAWVDAEV----------------GKTDSG----MlsllplsdaapPHK  351
             + F+K  D E+AW+DA++                G  D      +      +D  P H 
Sbjct  614  QLEFQKGKDAEVAWIDAQIVIPAASDTPMDVDQVEGNDDKSDRQILTLEPMKNDELPAHH  673

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHII  174
            +V + +LKL DFKQ L    +  EF+GG L C    V LR+V                + 
Sbjct  674  SVFINELKLIDFKQVLMKANISSEFSGGVLWCNNGTVALRRVDTGK------------VT  721

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSEEYY IRE LY Q+
Sbjct  722  VEGCLSEEYYKIRELLYEQY  741



>emb|CEJ03741.1| hypothetical protein RMCBS344292_17719 [Rhizopus microsporus]
Length=325

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 103/189 (54%), Gaps = 28/189 (15%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG+  +T+ L+  C  +++    ++ P + E ++V++    Y+V+L++ +
Sbjct  150  QIAPRKLIIVHGSKSSTQDLESACQGIEYFTKEIFTPSVGEVLNVSAATNIYRVKLTDSM  209

Query  476  MSNVLFKKLGDYEIAWV--------DAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLS  321
            +S++ F KL +YE+A V        D+     D  M       + A     V VGD++LS
Sbjct  210  VSSLQFSKLDEYELARVVGRIHFPEDSTTPSLDVSM-----ADEPAQYEPPVFVGDVRLS  264

Query  320  DFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYY  144
            +F++ L ++G+Q EF G G L C E V +RK G               +++EG LS +YY
Sbjct  265  EFRKVLQAEGIQAEFKGEGILVCNERVAVRKTGTG------------QLLVEGVLSADYY  312

Query  143  TIREYLYSQ  117
             +R  LYSQ
Sbjct  313  KVRSLLYSQ  321



>ref|XP_011409895.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Amphimedon queenslandica]
Length=603

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 98/185 (53%), Gaps = 19/185 (10%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQ--HCLKHVCPH-VYAPQIEETIDVTSDLCAYKVQLSEKL  477
            + P +L+L+HG+ E+T+ L    H +  + P  V+AP + ETID T++   Y V+L++ L
Sbjct  428  MKPRQLILIHGSLESTKCLVDFSHSVLGMDPKKVFAPAVGETIDATTESQLYIVKLTDAL  487

Query  476  MSNVLFKKLGDYEIAWVDAEV----GKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQ  309
            MS   F    D E+AWVD ++      TDS  +  +  +     HK V +   +LSDFK 
Sbjct  488  MSGTRFAPGKDAELAWVDGQIRLSSDGTDSIPVLDVFHNKQVADHKNVFINPPRLSDFKN  547

Query  308  FLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
             L   G+Q EF GGAL C   V +++                 I +EG +S++YY IR+ 
Sbjct  548  TLTKAGIQAEFCGGALICNGVVAIKRTEGGK------------ISIEGSVSDDYYLIRKL  595

Query  128  LYSQF  114
            LY QF
Sbjct  596  LYEQF  600



>ref|XP_005649512.1| hypothetical protein COCSUDRAFT_83661 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24968.1| hypothetical protein COCSUDRAFT_83661 [Coccomyxa subellipsoidea 
C-169]
Length=731

 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 98/185 (53%), Gaps = 17/185 (9%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            VAP  LVLVHGT +AT+ L+  C   L  V   V+ P   ET+DV++   +++V LS+ L
Sbjct  554  VAPRHLVLVHGTPQATQVLRDACGDDLYSVNGQVHCPANGETVDVSAGTSSFQVGLSDGL  613

Query  476  MSNVLFKKLG-DYEIAWVDAEVGKTDSGMls---llplsdaapPHKTVLVGDLKLSDFKQ  309
            ++ +  +++G +Y +AWV   V   +SG L        S        V +GD KLSD K 
Sbjct  614  LAQLRMRQMGSEYALAWVHGVVASVNSGALPEVLPASASAGEALEGGVFIGDAKLSDLKT  673

Query  308  FLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
             L  +G+   F  G L+C   V++++                 IILEGPLS++YY IR  
Sbjct  674  ALEKEGIAAVFVEGNLQCSGSVSVKRT----------VPEDGGIILEGPLSDDYYRIRTV  723

Query  128  LYSQF  114
            LYSQ+
Sbjct  724  LYSQY  728



>ref|XP_008193780.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Tribolium castaneum]
 gb|EFA07272.1| hypothetical protein TcasGA2_TC014506 [Tribolium castaneum]
Length=733

 Score =   103 bits (258),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 62/200 (31%), Positives = 105/200 (53%), Gaps = 33/200 (17%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++V G+ E+T  +K HC +++   V+AP   E +D T++   Y+V+L++ L+S + 
Sbjct  546  PRRVIIVRGSPESTNTIKNHCQENLDARVFAPVRGEVVDATTETHIYQVRLTDALVSQLN  605

Query  461  FKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapP--------------------HKTVL  342
            F+K  D E+AW++A++   +S + +     D  P                     H TV 
Sbjct  606  FQKAKDAEVAWLNAQIVVRESQLDARRMNVDNEPMEVDEEESKILTLEPYGDNIPHDTVF  665

Query  341  VGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHIILEG  165
            + +LKLS+FKQ LA   +  EF+GG L C    + +R+V                +ILEG
Sbjct  666  INELKLSEFKQILAKSNINSEFSGGVLWCSNGTLAIRRVETG------------RVILEG  713

Query  164  PLSEEYYTIREYLYSQFYSL  105
             +SE+YY ++E LY Q+  L
Sbjct  714  CISEDYYKVKELLYEQYAVL  733



>emb|CEF96643.1| Beta-lactamase-like [Ostreococcus tauri]
Length=800

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 105/209 (50%), Gaps = 39/209 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLK-QHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
              AP ++VLVHG A+ T+ LK Q  L      +Y P   +T++ TS +  YK++LS+ L 
Sbjct  604  QAAPRQIVLVHGNAKETKLLKDQLVLTLPGVDIYTPNAGKTVECTSSMATYKIRLSDALF  663

Query  473  SNVLFKKLGDYEIAWVDAEVGKT-------------------DSGMlsllplsdaapPHK  351
                 + +  Y + WV+  VGK                    D+G L     ++ A   +
Sbjct  664  QKAKMRDMSGYRVGWVNGIVGKALEEGGAPMLLPMSTLSTKADAGALVTTTSNEMAIMKR  723

Query  350  ------TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaa  192
                  +V +GDL+L DF+Q LA +G+  EF+GG L C +  VT+RK  D          
Sbjct  724  AAAQPGSVFLGDLRLVDFRQALAQEGITAEFSGGVLVCADGRVTIRKDSD----------  773

Query  191  AIQHIILEGPLSEEYYTIREYLYSQFYSL  105
              + +++EG LS++++ IR+ LYSQ+  L
Sbjct  774  --EKLVIEGALSQDFFEIRQILYSQYQIL  800



>ref|XP_004205466.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like, partial [Hydra vulgaris]
Length=568

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/201 (33%), Positives = 97/201 (48%), Gaps = 35/201 (17%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            V P +L+L+HG+  ATE L ++C    +     VY P   E +D T +   Y+V+L + L
Sbjct  377  VKPRQLILIHGSPAATEALSRYCQTSTQFNVSKVYTPYTNEMVDATRESHIYQVKLKDSL  436

Query  476  MSNVLFKKLGDYEIAWVDAE--------------------VGKTDSGMlsllplsdaapP  357
            +S++ F    D E+AWVD +                    V K D   +      +  P 
Sbjct  437  VSSLKFAVARDTELAWVDGQLVMEARGEKFNQIEQENSEKVEKQDVVPVLEQLPPEMIPG  496

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H TV + + +LSDFKQ L   G+Q EF GG L C   V +R+ G+  +           I
Sbjct  497  HATVFIDEPRLSDFKQVLTKAGIQAEFTGGVLVCNNVVAVRR-GEQGK-----------I  544

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             +EG L EEYY IR+ LY Q+
Sbjct  545  SIEGGLCEEYYVIRQLLYDQY  565



>ref|XP_003074308.1| polyadenylation cleavage/specificity factor 100 kDa subunit (ISS) 
[Ostreococcus tauri]
Length=807

 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 105/209 (50%), Gaps = 39/209 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLK-QHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
              AP ++VLVHG A+ T+ LK Q  L      +Y P   +T++ TS +  YK++LS+ L 
Sbjct  611  QAAPRQIVLVHGNAKETKLLKDQLVLTLPGVDIYTPNAGKTVECTSSMATYKIRLSDALF  670

Query  473  SNVLFKKLGDYEIAWVDAEVGKT-------------------DSGMlsllplsdaapPHK  351
                 + +  Y + WV+  VGK                    D+G L     ++ A   +
Sbjct  671  QKAKMRDMSGYRVGWVNGIVGKALEEGGAPMLLPMSTLSTKADAGALVTTTSNEMAIMKR  730

Query  350  ------TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaa  192
                  +V +GDL+L DF+Q LA +G+  EF+GG L C +  VT+RK  D          
Sbjct  731  AAAQPGSVFLGDLRLVDFRQALAQEGITAEFSGGVLVCADGRVTIRKDSD----------  780

Query  191  AIQHIILEGPLSEEYYTIREYLYSQFYSL  105
              + +++EG LS++++ IR+ LYSQ+  L
Sbjct  781  --EKLVIEGALSQDFFEIRQILYSQYQIL  807



>ref|XP_008913556.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETI34753.1| hypothetical protein, variant [Phytophthora parasitica P1569]
 gb|ETK75050.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL28471.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETL81726.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETM34932.1| hypothetical protein, variant [Phytophthora parasitica]
 gb|ETN01229.1| hypothetical protein, variant [Phytophthora parasitica INRA-310]
 gb|ETO63506.1| hypothetical protein, variant [Phytophthora parasitica P1976]
 gb|ETP04604.1| hypothetical protein, variant [Phytophthora parasitica CJ01A1]
 gb|ETP32741.1| hypothetical protein, variant [Phytophthora parasitica P10297]
Length=732

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 19/186 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT + T  LKQ     +  C  V+ P + E ID+ SD   YK+ + E L
Sbjct  556  NVKPRKLILVHGTEKTTSELKQFVESSIPMCEAVFTPNVMECIDIESDTNVYKLSVKESL  615

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLVGD--LKLSDFK  312
             ++ +F+K+G +E+A+V  ++     +   +L  L  +     H+ +L+ D  +KL   K
Sbjct  616  YTSAVFRKVGSHEVAYVTGQLVLPENSSVPVLQPLNENGGQTTHEPILLSDGKMKLDVMK  675

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
            Q L   G Q +F GG L C + V L++  +              I++EG LS  YY IR 
Sbjct  676  QVLGKAGFQAKFRGGMLVCNDGVVLKRAMN------------NEIVMEGTLSRNYYRIRA  723

Query  131  YLYSQF  114
             LY QF
Sbjct  724  LLYEQF  729



>ref|XP_008913555.1| hypothetical protein PPTG_17632 [Phytophthora parasitica INRA-310]
 gb|ETI34752.1| hypothetical protein F443_18817 [Phytophthora parasitica P1569]
 gb|ETK75049.1| hypothetical protein L915_18285 [Phytophthora parasitica]
 gb|ETL28470.1| hypothetical protein L916_18194 [Phytophthora parasitica]
 gb|ETL81725.1| hypothetical protein L917_18009 [Phytophthora parasitica]
 gb|ETM34931.1| hypothetical protein L914_18092 [Phytophthora parasitica]
 gb|ETN01228.1| hypothetical protein PPTG_17632 [Phytophthora parasitica INRA-310]
 gb|ETO63505.1| hypothetical protein F444_18803 [Phytophthora parasitica P1976]
 gb|ETP04603.1| hypothetical protein F441_18669 [Phytophthora parasitica CJ01A1]
 gb|ETP32740.1| hypothetical protein F442_18628 [Phytophthora parasitica P10297]
Length=736

 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 96/186 (52%), Gaps = 19/186 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT + T  LKQ     +  C  V+ P + E ID+ SD   YK+ + E L
Sbjct  560  NVKPRKLILVHGTEKTTSELKQFVESSIPMCEAVFTPNVMECIDIESDTNVYKLSVKESL  619

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLVGD--LKLSDFK  312
             ++ +F+K+G +E+A+V  ++     +   +L  L  +     H+ +L+ D  +KL   K
Sbjct  620  YTSAVFRKVGSHEVAYVTGQLVLPENSSVPVLQPLNENGGQTTHEPILLSDGKMKLDVMK  679

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
            Q L   G Q +F GG L C + V L++  +              I++EG LS  YY IR 
Sbjct  680  QVLGKAGFQAKFRGGMLVCNDGVVLKRAMN------------NEIVMEGTLSRNYYRIRA  727

Query  131  YLYSQF  114
             LY QF
Sbjct  728  LLYEQF  733



>gb|KFM58192.1| Cleavage and polyadenylation specificity factor subunit 2, partial 
[Stegodyphus mimosarum]
Length=749

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 98/205 (48%), Gaps = 39/205 (19%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCP-HVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            + P +L++V G  EATE L  +C+  V    V+ P + E +D T++   Y+V+L + L+S
Sbjct  554  IKPRRLIIVRGPPEATESLATYCVSGVVQGKVFTPHLLEMVDATTESHIYQVKLKDSLVS  613

Query  470  NVLFKKLGDYEIAWVDAEV--------------------------GKTDSGMlsllplsd  369
            ++ F K  D E+AWVD E+                             +   +     ++
Sbjct  614  SLDFVKSKDVELAWVDGEIILEEDIDEIVAKDAEKEKDEDEIKEEAAIERIPVLQPLPAN  673

Query  368  aapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaA  189
                H T+ + ++KLSDFKQ L   G+  EF+GG L C + V LRK              
Sbjct  674  QIIGHPTIFINEVKLSDFKQVLMRHGINAEFSGGVLYCNDVVALRKNESG----------  723

Query  188  IQHIILEGPLSEEYYTIREYLYSQF  114
              HI  EG L+E+Y+ +RE LY Q+
Sbjct  724  --HIHFEGCLTEDYFKVRELLYEQY  746



>dbj|GAN08051.1| cleavage and polyadenylation specificity factor subunit 2 isoform 
X2 [Mucor ambiguus]
Length=783

 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 102/187 (55%), Gaps = 21/187 (11%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG+  +TE L   C  + H    ++ P + E ++V++    Y+V+L++ +
Sbjct  605  QIAPRKLIIVHGSQSSTEDLATACQGMDHFTKEIFTPSVSEVLNVSAATNIYRVKLTDSM  664

Query  476  MSNVLFKK---LGDYEIAWVDAEVGKTDSGMlsllplsda---apPHKTVLVGDLKLSDF  315
            +S++ F K   L DYE+A V   +   D      L ++ +        +V VGD++L++F
Sbjct  665  VSSLRFSKNIQLDDYELARVVGRIHFPDDSTTPSLDVAVSDGPTQWEPSVFVGDVRLTEF  724

Query  314  KQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTI  138
            K+ L ++G+Q EF G G L C + V +RK G               +++EG +S +YY I
Sbjct  725  KKILQAEGIQAEFKGEGILVCNDQVAVRKTGTG------------QLLVEGAISMDYYKI  772

Query  137  REYLYSQ  117
            R  LYSQ
Sbjct  773  RSLLYSQ  779



>emb|CCA21717.1| cleavage and polyadenylation specificity factor subunit putative 
[Albugo laibachii Nc14]
 emb|CCA21858.1| cleavage and polyadenylation specificity factor subunit putative 
[Albugo laibachii Nc14]
Length=731

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/185 (35%), Positives = 92/185 (50%), Gaps = 18/185 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQ--HCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  LKQ      ++C  ++ P++ E ID+ SD   YK+ L E L
Sbjct  556  NVKPRKLILVHGTEETTADLKQFVESTINLCEAIFTPKVMECIDIESDTSIYKLALKESL  615

Query  476  MSNVLFKKLGDYEIAWVDAEVGK--TDSGMlsllplsdaapPHKTVLVGD--LKLSDFKQ  309
             + + F K+G++++A+V  +V    T S              HK +L+ D  LKL   KQ
Sbjct  616  YTAMNFHKVGNHDVAYVTGQVSTSATSSIPTLQPRSDSNMTEHKPLLLSDGKLKLDIMKQ  675

Query  308  FLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
             L   G   +F  G L C + V L++  +              I++EG LS  YY IR  
Sbjct  676  VLGRAGFDAKFRSGMLICNDGVVLKRAHN------------NEIVVEGVLSASYYRIRSL  723

Query  128  LYSQF  114
            LY QF
Sbjct  724  LYEQF  728



>gb|ENN73673.1| hypothetical protein YQE_09718, partial [Dendroctonus ponderosae]
 gb|ERL88780.1| hypothetical protein D910_06162 [Dendroctonus ponderosae]
Length=736

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 102/201 (51%), Gaps = 35/201 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++++VHG+ E TE + +HC + +   V+ P   E IDVTS+   Y+V+L++ L+S
Sbjct  546  QLRPRRVIVVHGSPEKTEIIAKHCREKIEARVFTPHRGEVIDVTSENHIYQVRLTDALVS  605

Query  470  NVLFKKLGDYEIAWVDA---------------------EVGKTDSGMlsllplsdaapPH  354
             + F+K  D E+A+++A                     EV + D+G    L        H
Sbjct  606  QLDFQKAKDAEVAYINAQILIRESQADAKRLSADNELMEVEEEDAG-ELTLEPHSEEEDH  664

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRC-GEYVTLRKVGDASQRggaaaaAIQHI  177
            + V V ++KL DF+  LA   +  EF+GG L C    V +RK+                I
Sbjct  665  EPVFVNEVKLLDFRNVLAKANLPSEFSGGVLWCCNGTVAVRKLDTGK------------I  712

Query  176  ILEGPLSEEYYTIREYLYSQF  114
            +LEG +SEEYY ++E LY QF
Sbjct  713  VLEGCISEEYYKVKELLYEQF  733



>ref|XP_001638458.1| predicted protein [Nematostella vectensis]
 gb|EDO46395.1| predicted protein [Nematostella vectensis]
Length=737

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/207 (31%), Positives = 99/207 (48%), Gaps = 41/207 (20%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHV---YAPQIEETIDVTSDLCAYKVQLSEKL  477
            V P KLVLVHG +++T+HL  +C       V   + P + ET++ T +   Y+V+L + L
Sbjct  540  VNPRKLVLVHGDSKSTQHLADYCQSSSSIQVSQVFTPAVGETVEATGERHIYQVKLRDAL  599

Query  476  MSNVLFKKLGDYEIAWVDAEVGKT--------------------------DSGMlsllpl  375
            +S++ F +  D E+AW+D ++                             D+  +     
Sbjct  600  VSSLQFAQARDAELAWIDGQLDMKLAPANQDLMGDKPGEEKMETDQDEALDTVPVLEQNT  659

Query  374  sdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaa  195
            S     H +V + + +LSDFKQ L   G+Q EFAGG L C   V +R+            
Sbjct  660  SSKIAGHVSVFINEPRLSDFKQVLNKAGIQAEFAGGVLICNNVVCVRR------------  707

Query  194  aAIQHIILEGPLSEEYYTIREYLYSQF  114
                 + LEG + E+YYTIR+ LYSQ+
Sbjct  708  NETGRVGLEGTVCEDYYTIRDLLYSQY  734



>ref|XP_001415490.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93782.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=715

 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/206 (33%), Positives = 100/206 (49%), Gaps = 37/206 (18%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVY--APQIEETIDVTSDLCAYKVQLSEKL  477
              AP ++VLVHG A+ T+ LK   L    P V   AP   +TI+ TS    YK+++S+ L
Sbjct  523  QAAPRRVVLVHGDAKETKTLKD-ALTAGLPGVQIDAPDAGKTIECTSASATYKIRVSDAL  581

Query  476  MSNVLFKKLGDYEIAWVDAEVGK------------------TDSGMlsllplsdaapPHK  351
                  + +  Y++ WV+  VGK                     GM      +       
Sbjct  582  FQKANMRDMAGYKVGWVNGVVGKALEEGGAPMLLPVSALNSNADGMALAPSNATMTKVSA  641

Query  350  ---TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQ  183
               +V +GDL+LSDF+Q LA +G+  EFA G L C    VT+RK GD            +
Sbjct  642  QPGSVFLGDLRLSDFRQALAQEGIIAEFADGVLVCANGRVTVRKDGD------------E  689

Query  182  HIILEGPLSEEYYTIREYLYSQFYSL  105
             +++EG LS++Y+ +R+ LYSQ+  L
Sbjct  690  KLVVEGALSQDYFEVRQILYSQYSIL  715



>gb|ELU12868.1| hypothetical protein CAPTEDRAFT_155355 [Capitella teleta]
Length=728

 Score = 99.0 bits (245),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 69/194 (36%), Positives = 101/194 (52%), Gaps = 29/194 (15%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP---HVYAPQIEETIDVTSDLCAYKVQLSEK  480
             V P +L+LV G+ E+TE L   C     P    VY P++ E +D T++   ++V+L + 
Sbjct  546  QVRPRQLILVRGSRESTESLAAFCRD--APDIGKVYTPRLNELVDATTESKIFQVRLKDS  603

Query  479  LMSNVLFKKLGDYEIAWVDA----------EVGKT--DSGMlsllplsdaapPHKTVLVG  336
            ++S + F K  D EIAW+DA          E G+   D   + ++  +    PH  V V 
Sbjct  604  VVSALNFSKARDAEIAWIDAMLDLNQAEAMEDGENPEDEEAVPVVIPTSQIRPHGAVFVN  663

Query  335  DLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLS  156
            + KLSDFKQ L + GVQ EF+ G L C   V +RK  +A +           + LEG L 
Sbjct  664  EPKLSDFKQTLVNLGVQAEFSAGVLICNSVVAVRK-NEAGR-----------LQLEGTLC  711

Query  155  EEYYTIREYLYSQF  114
            ++YY IR+ LY QF
Sbjct  712  DDYYRIRQLLYEQF  725



>gb|EFA82503.1| beta-lactamase domain-containing protein [Polysphondylium pallidum 
PN500]
Length=738

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 100/187 (53%), Gaps = 19/187 (10%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            +AP KL+LV G  +    L+ H  +++    +Y P I +TID+TS+   Y V L + L+S
Sbjct  559  IAPSKLILVRGNQDCIAELETHVKQNMRVKGLYKPIINQTIDLTSETNVYNVVLKDSLIS  618

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMls----llplsdaapPHKTVLVGDLKLSDFKQFL  303
            ++   KL DY+IA++ A+V   ++ M +     L   +   PH +  +GD+KLS+FKQ L
Sbjct  619  SLASSKLMDYDIAYIQAKVILNETNMKAPPVLELLAEEEIEPHNSSFIGDIKLSEFKQLL  678

Query  302  ASKGVQVEFAGGALRCGEYVTL----RKVGDASQRggaaaaAIQHIILEGPLSEEYYTIR  135
               G QV+F  G +      TL    R+  D +            I ++G LS+EYY +R
Sbjct  679  IDSGYQVQFDQGIIAVSMKTTLIYIWREEVDGN----------SSIQIDGILSDEYYQVR  728

Query  134  EYLYSQF  114
            E LY QF
Sbjct  729  ELLYQQF  735



>ref|XP_003737143.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like isoform 2 [Metaseiulus occidentalis]
Length=745

 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 98/199 (49%), Gaps = 32/199 (16%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEA-TEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEK  480
            + P +LV+V G  EA T     +C+   C     V+AP+  E +D T++   Y+V+L E 
Sbjct  555  MKPKRLVIVRGGDEANTAAFYDYCVNSGCVQDNRVFAPKAHEVVDATTESHIYQVKLKES  614

Query  479  LMSNVLFKKLGDYEIAWVDAE----------VGKTDSG-------MlsllplsdaapPHK  351
            L++ + F+K  + E+AW+DAE          VGK D         +  L   +    PH 
Sbjct  615  LLARLRFRKAKNAELAWLDAEIAEPEEDNDLVGKGDEETKEKLMVLQPLGDSNRVVAPHN  674

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIIL  171
             + + DLKLSDFKQ L   G+  EF+GG L C       K  +  +           + +
Sbjct  675  PLFINDLKLSDFKQVLVKSGISAEFSGGVLYCNNCSVAVKRNETGR-----------LSV  723

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG L+++Y+ IRE LY Q+
Sbjct  724  EGALTDDYFRIRELLYDQY  742



>ref|XP_003737144.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like isoform 3 [Metaseiulus occidentalis]
Length=754

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 98/199 (49%), Gaps = 32/199 (16%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEA-TEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEK  480
            + P +LV+V G  EA T     +C+   C     V+AP+  E +D T++   Y+V+L E 
Sbjct  564  MKPKRLVIVRGGDEANTAAFYDYCVNSGCVQDNRVFAPKAHEVVDATTESHIYQVKLKES  623

Query  479  LMSNVLFKKLGDYEIAWVDAE----------VGKTDSG-------MlsllplsdaapPHK  351
            L++ + F+K  + E+AW+DAE          VGK D         +  L   +    PH 
Sbjct  624  LLARLRFRKAKNAELAWLDAEIAEPEEDNDLVGKGDEETKEKLMVLQPLGDSNRVVAPHN  683

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIIL  171
             + + DLKLSDFKQ L   G+  EF+GG L C       K  +  +           + +
Sbjct  684  PLFINDLKLSDFKQVLVKSGISAEFSGGVLYCNNCSVAVKRNETGR-----------LSV  732

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG L+++Y+ IRE LY Q+
Sbjct  733  EGALTDDYFRIRELLYDQY  751



>ref|XP_003737142.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like isoform 1 [Metaseiulus occidentalis]
Length=741

 Score = 98.2 bits (243),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 98/199 (49%), Gaps = 32/199 (16%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEA-TEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEK  480
            + P +LV+V G  EA T     +C+   C     V+AP+  E +D T++   Y+V+L E 
Sbjct  551  MKPKRLVIVRGGDEANTAAFYDYCVNSGCVQDNRVFAPKAHEVVDATTESHIYQVKLKES  610

Query  479  LMSNVLFKKLGDYEIAWVDAE----------VGKTDSG-------MlsllplsdaapPHK  351
            L++ + F+K  + E+AW+DAE          VGK D         +  L   +    PH 
Sbjct  611  LLARLRFRKAKNAELAWLDAEIAEPEEDNDLVGKGDEETKEKLMVLQPLGDSNRVVAPHN  670

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIIL  171
             + + DLKLSDFKQ L   G+  EF+GG L C       K  +  +           + +
Sbjct  671  PLFINDLKLSDFKQVLVKSGISAEFSGGVLYCNNCSVAVKRNETGR-----------LSV  719

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG L+++Y+ IRE LY Q+
Sbjct  720  EGALTDDYFRIRELLYDQY  738



>ref|XP_312464.4| AGAP002474-PA [Anopheles gambiae str. PEST]
 gb|EAA08192.4| AGAP002474-PA [Anopheles gambiae str. PEST]
Length=745

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 61/189 (32%), Positives = 90/189 (48%), Gaps = 33/189 (17%)
 Frame = -2

Query  617  GTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKLGDYE  438
            G+   T H+ +HC +++   V+ P   E ID T++   Y+V+L+E L+S + F+K  D E
Sbjct  566  GSPANTSHIAEHCQQNIGARVFTPNRGEIIDATTETHIYQVRLTEALVSQLEFQKGKDAE  625

Query  437  IAWVDAE---------------VGKTDSGMlsllplsdaapP-----HKTVLVGDLKLSD  318
            +AWVDA+               V   D  M   +   +         H  V + +LKL D
Sbjct  626  VAWVDAQIVIRNKRIDTMEVDDVDTIDDKMDKQILTLEPLAQEDLPPHNPVFINELKLID  685

Query  317  FKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYT  141
            FKQ L    +  EF+GG L C    V LR+V                + +EG +SE+YY 
Sbjct  686  FKQILMKSNIASEFSGGVLWCSNGTVALRRVDTG------------RVTIEGCISEDYYK  733

Query  140  IREYLYSQF  114
            IRE LY Q+
Sbjct  734  IRELLYEQY  742



>ref|XP_001850949.1| cleavage and polyadenylation specificity factor subunit 2 [Culex 
quinquefasciatus]
 gb|EDS32836.1| cleavage and polyadenylation specificity factor subunit 2 [Culex 
quinquefasciatus]
Length=747

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 97/192 (51%), Gaps = 36/192 (19%)
 Frame = -2

Query  617  GTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKLGDYE  438
            G+++ T H+ +HC  ++   V++P   E ID T++   Y+V+L+E L+S + F+K  D E
Sbjct  565  GSSQNTSHISEHCQLNIGARVFSPNRGEIIDATTETHIYQVRLTEALVSQLEFQKGKDAE  624

Query  437  IAWVDAEV----------------------GKTDSG-MlsllplsdaapPHKTVLVGDLK  327
            +AWVDA++                       K+D   +     L+D  P H +V + +LK
Sbjct  625  VAWVDAQIVIRNKQFTSDQPMDVDQVEITEDKSDKQILTLDPLLNDQLPAHNSVFINELK  684

Query  326  LSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVGDASQRggaaaaAIQHIILEGPLSEE  150
            L DFKQ L    +  EF+GG L C    + LR++                + +EG LSE+
Sbjct  685  LIDFKQVLMKANIASEFSGGVLWCSNGTLALRRIDTGK------------VTIEGCLSED  732

Query  149  YYTIREYLYSQF  114
            YY IRE LY Q+
Sbjct  733  YYRIRELLYEQY  744



>ref|XP_011305603.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Fopius arisanus]
Length=729

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 103/197 (52%), Gaps = 31/197 (16%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+++  + L QH  ++V   V+ P   ET+D T++   Y+++L++ L+S
Sbjct  543  QLRPRRVVLVRGSSQDCDILAQHA-QNVGARVFIPGRGETLDATTETHIYQIRLTDALVS  601

Query  470  NVLFKKL-GDYEIAWVDAEVG----------------KTDSGMlsllplsdaapPHKTVL  342
             + F+K+ G Y++AWVDA +                   +  +          P H+ + 
Sbjct  602  GLNFQKVRGGYDVAWVDATITAREQVCRDAVVDESEQTAEKILTLEPLGVSQVPGHQAIF  661

Query  341  VGDLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIILEG  165
            + +LKLSDFKQ L    +  E +GG L  CG+ + +RK  DA +           ++ EG
Sbjct  662  INELKLSDFKQILTKHNIPSELSGGVLWCCGDTIAVRK-EDAGK-----------VVFEG  709

Query  164  PLSEEYYTIREYLYSQF  114
             +SE+YY +RE LY QF
Sbjct  710  AVSEDYYRVRELLYEQF  726



>ref|XP_005112434.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like, partial [Aplysia californica]
Length=191

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 95/200 (48%), Gaps = 40/200 (20%)
 Frame = -2

Query  629  VLVHGTAEATEHLKQHCLK--HVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFK  456
            +LVHG  EAT+ L ++C     V   V+ P I + ID T++   Y+V+L ++L+S++ F 
Sbjct  1    ILVHGPDEATKSLGEYCQNTGFVEGSVFCPNIGDVIDATTERHIYQVRLRDQLVSSLSFA  60

Query  455  KLGDYEIAWVD--------------------------AEVGKTDSGMlsllplsdaapPH  354
            +  D E+AWVD                          AE     +         +  PPH
Sbjct  61   RARDMELAWVDGQLDIPPVDSVEEDEEMPDDEAAKKRAESQLNTNPPTLESLPPNMVPPH  120

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
             +V + + KLSDFK  L + GV  EFA G L C   V +R+  DA+ +            
Sbjct  121  MSVFINEPKLSDFKVVLINAGVTCEFASGVLVCNNLVAVRR--DAAGKMK----------  168

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG L E+Y+ IR  LYSQ+
Sbjct  169  LEGTLCEDYFKIRNLLYSQY  188



>emb|CEG66667.1| hypothetical protein RMATCC62417_03206 [Rhizopus microsporus]
 emb|CEI98390.1| hypothetical protein RMCBS344292_12499 [Rhizopus microsporus]
Length=179

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 97/182 (53%), Gaps = 28/182 (15%)
 Frame = -2

Query  629  VLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFK  456
            ++VHG+  +T+ L+  C  +++    ++ P + E ++V++    Y+V+L++ ++S++ F 
Sbjct  11   IIVHGSKSSTQDLESACQGIEYFTKEIFTPSVGEVLNVSAATNIYRVKLTDSMVSSLQFS  70

Query  455  KLGDYEIAWV--------DAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLA  300
            KL +YE+A V        D+     D  M       + A     V VGD++LS+F++ L 
Sbjct  71   KLDEYELARVVGRIHFPEDSTTPSLDVSM-----ADEPAQYEPPVFVGDVRLSEFRKVLQ  125

Query  299  SKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLY  123
            ++G+  EF G G L C E V +RK G               +++EG LS +YY +R  LY
Sbjct  126  AEGIHAEFKGEGILVCNERVAVRKTGTG------------QLLVEGVLSADYYKVRSLLY  173

Query  122  SQ  117
            SQ
Sbjct  174  SQ  175



>ref|XP_011500980.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Ceratosolen solmsi marchali]
Length=737

 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 99/200 (50%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   ++V   V+ P   ET+D T++   Y+V+L++ L++
Sbjct  547  QLRPRRIVLVRGSPKDTELLAQQA-QNVGARVFIPARGETLDATTETHIYQVRLTDALVT  605

Query  470  NVLFKK-LGDYEIAWVDAEV--------------------GKTDSGMlsllplsdaapPH  354
             + F +  GD E+AWVDA V                     + +  +       +  P H
Sbjct  606  GLNFSRGKGDSEVAWVDALVTAREQVCRDVFMNKENEDFISRAEKILTLEPLPLNEIPSH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           II
Sbjct  666  QTAFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------II  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG LSE+YY +RE LY Q+
Sbjct  715  LEGCLSEDYYRVRELLYEQY  734



>ref|XP_009061638.1| hypothetical protein LOTGIDRAFT_234977 [Lottia gigantea]
 gb|ESO87748.1| hypothetical protein LOTGIDRAFT_234977 [Lottia gigantea]
Length=431

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/196 (31%), Positives = 99/196 (51%), Gaps = 29/196 (15%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P +LVLV GT EAT+ L ++C     +   ++ P++  TID T++   ++ +L + L
Sbjct  245  RVKPRQLVLVRGTPEATDTLAEYCTTSSLIQGTIFKPRVGHTIDATTESRIFQAKLRDHL  304

Query  476  MSNVLFKKLGDYEIAWVDAEVG---------------KTDSGMlsllplsdaapPHKTVL  342
            ++++ F K  D E+AW+DA++                +TD   L      +  P H +V 
Sbjct  305  VTSLNFAKAKDIELAWIDAQLTYSQHDEDSMEDGQNRETDMVPLLDCLPPNKVPTHNSVF  364

Query  341  VGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGP  162
            + + KLSDFK  L  +G+  EF  G L C   V +++  +A +           I LEG 
Sbjct  365  INEPKLSDFKLVLLQEGIPCEFVAGVLICNNMVAVKR-NEAGR-----------IQLEGT  412

Query  161  LSEEYYTIREYLYSQF  114
            L  EY+ +RE LY Q+
Sbjct  413  LCNEYFRVRELLYQQY  428



>ref|XP_002431330.1| Cleavage and polyadenylation specificity factor 100 kDa subunit, 
putative [Pediculus humanus corporis]
 gb|EEB18592.1| Cleavage and polyadenylation specificity factor 100 kDa subunit, 
putative [Pediculus humanus corporis]
Length=731

 Score = 96.3 bits (238),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 61/200 (31%), Positives = 102/200 (51%), Gaps = 32/200 (16%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIE-ETIDVTSDLCAYKVQLSEKLM  474
             + P +L+L+ GT E+T+ L     K     ++APQ + E +D T++   Y+++L+++L+
Sbjct  540  QIRPRRLILIRGTGESTKSLVNIVSKSTDAKIFAPQKKSEVVDATTETYIYQIRLTDQLI  599

Query  473  SNVLFKKLGDYEIAWVDAEV--------------------GKTDSGMlsllplsdaapPH  354
            S++ F+K  + E+AW+DA+V                       D  +   L   +  P H
Sbjct  600  SSLYFQKGKEAEVAWLDAQVLTKNRSADARPSEEEMEIDEELKDEILTLDLLPVEDIPGH  659

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG LRC       +  +A +           +I
Sbjct  660  ETSYINELKLSDFKQILNKNNINCEFSGGVLRCCHGSVAVRRHEAGR-----------VI  708

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG LSE+YY ++E L  Q+
Sbjct  709  LEGCLSEDYYKVKELLCQQY  728



>gb|ETN63991.1| cleavage and polyadenylation specificity factor [Anopheles darlingi]
Length=772

 Score = 95.9 bits (237),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 65/226 (29%), Positives = 98/226 (43%), Gaps = 62/226 (27%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++V G+A  T H+ +HC +++   V+ P   E ID T++   Y+V+L+E L+S + 
Sbjct  556  PRRVIVVRGSAANTAHIAEHCQQNIGARVFTPNRGEIIDATTETHIYQVRLTEALVSQLE  615

Query  461  FKKLGDYEIAWVDAEVG--------------------------------KTDSGMlsllp  378
            F+K  D E+AWVDA++                                  TDS M     
Sbjct  616  FQKGKDAEVAWVDAQIVIRNKRIDTVAEKDASGTGAALSANPVTGAASIATDSAMDVDEV  675

Query  377  lsdaapPHKTVL-----------------VGDLKLSDFKQFLASKGVQVEFAGGALRCGE  249
                    K +L                 + +LKL DFKQ L    +  EF+GG L C  
Sbjct  676  DVLEDKLDKRILTLEPMVPEELPPHNPVFINELKLIDFKQVLMRSNITSEFSGGVLWCSN  735

Query  248  -YVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
              V LR+V                + +EG +SE+YY IRE LY Q+
Sbjct  736  GTVALRRVDTG------------RVTIEGCISEDYYKIRELLYEQY  769



>ref|XP_008869265.1| hypothetical protein H310_06119 [Aphanomyces invadans]
 gb|ETW02660.1| hypothetical protein H310_06119 [Aphanomyces invadans]
Length=748

 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 93/186 (50%), Gaps = 25/186 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  L+++    +  C  VY PQ  E ID+ SD   YK+ L E L
Sbjct  578  NVKPRKLILVHGTPETTAGLQEYVQSTMEQCEAVYTPQANERIDIESDTTVYKLSLKESL  637

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLV--GDLKLSDFK  312
             S+  F+K+G +++A++++     G T       +        H  +L+  G + L+  K
Sbjct  638  YSSAYFQKVGSHDVAYINSTAEFHGAT------CILDVAEQEYHTPMLLSQGKVTLATLK  691

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
              LA  G +  F GG L C + V L++  +              +++EG LS  YY IR+
Sbjct  692  TLLARAGFEANFYGGMLVCDDGVVLKRSRN------------NEVVMEGTLSTSYYRIRD  739

Query  131  YLYSQF  114
             LY Q+
Sbjct  740  ILYQQY  745



>ref|XP_009826607.1| hypothetical protein H257_03975 [Aphanomyces astaci]
 gb|ETV83177.1| hypothetical protein H257_03975 [Aphanomyces astaci]
Length=776

 Score = 95.5 bits (236),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 92/186 (49%), Gaps = 25/186 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  L+++    +  C  VY P   E ID+ SD   YK+ L E L
Sbjct  606  NVKPRKLILVHGTPETTTELQEYVQTTIEQCEAVYTPHANECIDIESDTTVYKLSLKESL  665

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLV--GDLKLSDFK  312
             S+  F+K+G +++A+++A     G T       +        H  +L+  G + L+  K
Sbjct  666  YSSAFFQKVGSHDVAYINATAEFHGAT------CIVDVAEQEYHTPMLLSQGKVTLAMLK  719

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
              LA  G +  F GG L C + V L++  +              +++EG LS  YY IR+
Sbjct  720  TLLARAGFEANFYGGMLVCDDGVVLKRSRN------------NEVVMEGTLSSSYYRIRD  767

Query  131  YLYSQF  114
             LY Q+
Sbjct  768  ILYQQY  773



>ref|XP_009826616.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV83178.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=743

 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 92/186 (49%), Gaps = 25/186 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  L+++    +  C  VY P   E ID+ SD   YK+ L E L
Sbjct  573  NVKPRKLILVHGTPETTTELQEYVQTTIEQCEAVYTPHANECIDIESDTTVYKLSLKESL  632

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLV--GDLKLSDFK  312
             S+  F+K+G +++A+++A     G T       +        H  +L+  G + L+  K
Sbjct  633  YSSAFFQKVGSHDVAYINATAEFHGAT------CIVDVAEQEYHTPMLLSQGKVTLAMLK  686

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
              LA  G +  F GG L C + V L++  +              +++EG LS  YY IR+
Sbjct  687  TLLARAGFEANFYGGMLVCDDGVVLKRSRN------------NEVVMEGTLSSSYYRIRD  734

Query  131  YLYSQF  114
             LY Q+
Sbjct  735  ILYQQY  740



>ref|XP_002137430.2| GA26549 [Drosophila pseudoobscura pseudoobscura]
 gb|EDY67988.2| GA26549 [Drosophila pseudoobscura pseudoobscura]
Length=731

 Score = 95.1 bits (235),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 64/199 (32%), Positives = 94/199 (47%), Gaps = 60/199 (30%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P ++++VHGT E T+ + +HC ++V   V+ PQ  E IDVT+++  Y+V+L+E L+S + 
Sbjct  567  PRRVIVVHGTEEGTQVVAKHCEQNVGARVFTPQKGEIIDVTTEIHIYQVRLTEGLVSQLQ  626

Query  461  FKKLGDYEIAWVDAEVG-----------------KTDSGMlsllplsdaap------PHK  351
            F+K  D E+AWVD  +G                 + D+ M     L+           H 
Sbjct  627  FQKGKDAEVAWVDGRLGMRLKAIDAPPTAMDVTVEQDAAMQEGKTLTLETLEEDEIPVHN  686

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIIL  171
            +VL+ +LKLSDFKQ L         AG                              + +
Sbjct  687  SVLINELKLSDFKQIL--------LAG-----------------------------KVAM  709

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG LSEEYY IRE LY Q+
Sbjct  710  EGCLSEEYYKIRELLYEQY  728



>ref|XP_006613635.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like [Apis dorsata]
Length=737

 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 97/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+   TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSQRDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AWVDA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWVDAMITARDQICRDAVAGTESNDSIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>ref|XP_003701904.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like [Megachile rotundata]
Length=737

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSPKDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWIDAMITARDQVCRDAVADTEPDSTIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>gb|EFN82620.1| Probable cleavage and polyadenylation specificity factor subunit 
2 [Harpegnathos saltator]
Length=685

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 99/201 (49%), Gaps = 34/201 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+++ TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  494  QLRPRRVVLVRGSSKDTEILAQQA-QSAGARVFIPARGETLDATTETHIYQVRLTDALVS  552

Query  470  NVLFKK-LGDYEIAWVDAEV---------------------GKTDSGMlsllplsdaapP  357
             + F K  GD E+AW+DA +                      ++D  +       +  P 
Sbjct  553  GLNFSKGKGDSEVAWIDAMITARDQICRDAIADTEPEDAIMDESDKILTLEPLPLNEVPG  612

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +
Sbjct  613  HQTTFINELKLSDFKQVLNKSNISSEFSGGVLWCCNNTIAVRRHEAGK-----------V  661

Query  176  ILEGPLSEEYYTIREYLYSQF  114
            ILEG +SE+YY +RE LY Q+
Sbjct  662  ILEGCISEDYYKVRELLYEQY  682



>ref|XP_011170847.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Solenopsis invicta]
 gb|EFZ10838.1| hypothetical protein SINV_80021 [Solenopsis invicta]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSPKDTEILAQQA-QSTGARVFVPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWIDAMITARDQICRDAIADTESENAIDESDKILTLEPLPINEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQVLNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>ref|XP_003696322.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like [Apis florea]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 97/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+   TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSQRDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AWVDA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWVDAMITARDQICRDAVAGTEPNDAIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>ref|XP_011142384.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Harpegnathos saltator]
Length=738

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 99/201 (49%), Gaps = 34/201 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+++ TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSSKDTEILAQQA-QSAGARVFIPARGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDAEV---------------------GKTDSGMlsllplsdaapP  357
             + F K  GD E+AW+DA +                      ++D  +       +  P 
Sbjct  606  GLNFSKGKGDSEVAWIDAMITARDQICRDAIADTEPEDAIMDESDKILTLEPLPLNEVPG  665

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +
Sbjct  666  HQTTFINELKLSDFKQVLNKSNISSEFSGGVLWCCNNTIAVRRHEAGK-----------V  714

Query  176  ILEGPLSEEYYTIREYLYSQF  114
            ILEG +SE+YY +RE LY Q+
Sbjct  715  ILEGCISEDYYKVRELLYEQY  735



>ref|XP_006561139.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 isoform X1 [Apis mellifera]
 ref|XP_006561140.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 isoform X2 [Apis mellifera]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 97/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+   TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSQRDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AWVDA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWVDAMITARDQICRDAVAGTESNDAIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>ref|XP_003485880.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like [Bombus impatiens]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSQKDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDAEV--------------------GKTDSGMlsllplsdaapPH  354
             + F K  GD E+AWVDA +                     ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWVDAMITARDQICRDAVAGTESDDVIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>dbj|GAM28904.1| hypothetical protein SAMD00019534_120800, partial [Acytostelium 
subglobosum LB1]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 61/185 (33%), Positives = 99/185 (54%), Gaps = 14/185 (8%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            +AP KL+L+ G  ++ + L+ H   ++     YAP  E+TID+TS+   +KV L + L++
Sbjct  563  IAPSKLILIRGDKDSIDELETHAKNNMRLKANYAPINEQTIDLTSETNVFKVVLKDSLVN  622

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGM--lsllplsdaapPHKTVLVGDLKLSDFKQFLAS  297
            ++   +L DY+I++V A V   +     +  +   +    H +  +GD+K+S+FKQ L  
Sbjct  623  SLATSRLMDYDISYVQARVHVNEDSRVPVLDIVPENEVLAHNSSFIGDIKMSEFKQQLLD  682

Query  296  KGVQVEFAGGALRC-GEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYS  120
             G QV+F  G L C G     R+  D +            I ++G LSEEYY +R+ LY 
Sbjct  683  AGFQVQFDQGVLSCNGMVYVWREEVDGNSS----------IQMDGVLSEEYYHVRDLLYK  732

Query  119  QFYSL  105
            QF  L
Sbjct  733  QFQIL  737



>ref|XP_003395491.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like isoform 1 [Bombus terrestris]
 ref|XP_003395492.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like isoform 2 [Bombus terrestris]
Length=737

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSQKDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDAEV--------------------GKTDSGMlsllplsdaapPH  354
             + F K  GD E+AWVDA +                     ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWVDAMITARDQICRDAVAGTESDDVIDQSDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQILNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>ref|XP_011049258.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Acromyrmex echinatior]
 gb|EGI68691.1| Putative cleavage and polyadenylation specificity factor subunit 
2 [Acromyrmex echinatior]
Length=737

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSPKDTEILAQQA-QSTGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWIDAMITARDQICRDAIADTESENAIDESDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQVLNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>emb|CCI40993.1| unnamed protein product [Albugo candida]
Length=970

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 93/187 (50%), Gaps = 18/187 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT + T  LK      +  C  ++ P+  E ID+ SD   YK+ L E L
Sbjct  561  NVKPRKLILVHGTEQTTADLKHFVENTITLCEAIFTPKAMECIDIESDTSIYKLALKESL  620

Query  476  MSNVLFKKLGDYEIAWVDAEV--GKTDSGMlsllplsdaapPHKTVLVGD--LKLSDFKQ  309
             + + F K+G++++A+V  +V    T S  +  L        HK +L+ D  LKL   KQ
Sbjct  621  YTAMKFHKVGNHDVAYVTGQVSISATSSIPMLQLRSDSTKTEHKPLLLSDGKLKLDIMKQ  680

Query  308  FLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
             L   G   +F  G L C + V L++  +              II+EG LS  YY IR  
Sbjct  681  VLGRAGFDAKFRSGMLICNDGVVLKRALN------------NEIIVEGVLSASYYRIRSL  728

Query  128  LYSQFYS  108
            L+++F +
Sbjct  729  LFARFVA  735



>ref|XP_011258461.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Camponotus floridanus]
 ref|XP_011258467.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Camponotus floridanus]
 gb|EFN74154.1| Probable cleavage and polyadenylation specificity factor subunit 
2 [Camponotus floridanus]
Length=737

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSPKDTEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDSEVAWIDAMITARDQICRDAVADTESENAINESDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQVLNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE L+ Q+
Sbjct  715  LEGCISEDYYKVRELLFEQY  734



>gb|EZA60898.1| putative cleavage and polyadenylation specificity factor subunit 
[Cerapachys biroi]
Length=731

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + +E L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  541  QLRPRRVVLVRGSPKDSEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  599

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  600  GLNFSKGKGDAEVAWIDAMITARNHVCRDAIADKESENAIAESDKILTLEPLPLNEVPGH  659

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  660  QTTFINELKLSDFKQVLNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  708

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  709  LEGCISEDYYKVRELLYEQY  728



>ref|XP_011351985.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Cerapachys biroi]
Length=737

 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 61/200 (31%), Positives = 98/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + +E L Q   +     V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  547  QLRPRRVVLVRGSPKDSEILAQQA-QSAGARVFIPGRGETLDATTETHIYQVRLTDALVS  605

Query  470  NVLFKK-LGDYEIAWVDA--------------------EVGKTDSGMlsllplsdaapPH  354
             + F K  GD E+AW+DA                     + ++D  +       +  P H
Sbjct  606  GLNFSKGKGDAEVAWIDAMITARNHVCRDAIADKESENAIAESDKILTLEPLPLNEVPGH  665

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           +I
Sbjct  666  QTTFINELKLSDFKQVLNKSNIPSEFSGGVLWCCNNTIAVRRHEAGK-----------VI  714

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +SE+YY +RE LY Q+
Sbjct  715  LEGCISEDYYKVRELLYEQY  734



>gb|KDR21766.1| putative cleavage and polyadenylation specificity factor subunit 
2 [Zootermopsis nevadensis]
Length=744

 Score = 93.2 bits (230),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 96/205 (47%), Gaps = 37/205 (18%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P +L+LV GT E+T  +   C +     V+AP   E +D T++   Y+V+L++ L+S
Sbjct  548  QLRPRRLILVRGTPESTHAMLNLCRQWSGARVFAPSRGEIVDATTETHIYQVRLTDALVS  607

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllpls--------------------------d  369
             +  KK  + E+AW+DA++   D    +   +                           +
Sbjct  608  ALELKKGKEAELAWLDAQIMVRDMSKDAKPVIMGVDDDGKDEEDKMEIDKIYTLEPLPLN  667

Query  368  aapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaA  189
                H+T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +        
Sbjct  668  QVAGHQTAFINELKLSDFKQVLNKNNIPSEFSGGVLWCCNGTVAVRRHEAGR--------  719

Query  188  IQHIILEGPLSEEYYTIREYLYSQF  114
               +ILEG LS++YY +RE LY Q+
Sbjct  720  ---VILEGCLSDDYYRVRELLYEQY  741



>ref|XP_002997000.1| cleavage and polyadenylation specificity factor subunit, putative 
[Phytophthora infestans T30-4]
 gb|EEY70241.1| cleavage and polyadenylation specificity factor subunit, putative 
[Phytophthora infestans T30-4]
Length=513

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 94/186 (51%), Gaps = 23/186 (12%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT + T  LKQ     +  C  V+ P + E ID+ SD   YK+ + E L
Sbjct  341  NVKPRKLILVHGTEKTTSELKQFVESSIPMCEAVFTPDVMECIDIESDTNVYKLSVKESL  400

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSG---MlsllplsdaapPHKTVLVGD--LKLSDFK  312
             ++     +G +E+++V  ++  +++    +L  L  +     H+ +L+ D  +KL   K
Sbjct  401  YTSA----VGSHEVSYVTGQLVLSENSSVPVLQPLNENGGQATHEPILLSDGKMKLDVMK  456

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
            Q L   G Q +F GG L C + V L++  +              I++EG LS  YY IR 
Sbjct  457  QVLGKAGFQAKFRGGMLVCNDGVVLKRAMN------------NEIVMEGTLSRNYYRIRA  504

Query  131  YLYSQF  114
             LY QF
Sbjct  505  LLYEQF  510



>ref|XP_009516751.1| hypothetical protein PHYSODRAFT_552782 [Phytophthora sojae]
 gb|EGZ29476.1| hypothetical protein PHYSODRAFT_552782 [Phytophthora sojae]
Length=513

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 92/186 (49%), Gaps = 23/186 (12%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT   T  LK+     +  C  V+ P + E ID+ SD   YK+ + E L
Sbjct  341  NVKPRKLILVHGTETTTNELKKFVESSIPLCEAVFTPNVMECIDIESDTNVYKLSVKESL  400

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSG---MlsllplsdaapPHKTVLVGD--LKLSDFK  312
             ++     +G +E+A+V  ++   ++    +L  L  +     H+ +L+ D  +KL   K
Sbjct  401  YTSA----VGSHEVAYVTGQLALPENSSVPVLQPLNENGGQTTHEPILLSDGKMKLDVMK  456

Query  311  QFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
            Q L   G Q +F GG L C + V L++  +              I++EG LS  YY IR 
Sbjct  457  QVLGKAGFQAKFRGGMLVCNDGVVLKRAMN------------NEIVMEGTLSRNYYRIRA  504

Query  131  YLYSQF  114
             LY QF
Sbjct  505  LLYEQF  510



>ref|XP_004340269.1| cleavage and polyadenylation specificity factor subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
 gb|ELR18249.1| cleavage and polyadenylation specificity factor subunit 2, putative 
[Acanthamoeba castellanii str. Neff]
Length=799

 Score = 92.4 bits (228),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 17/152 (11%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            HVAP K+VL H      EHLK++C   + VC  VY P   ET+D+TSD   Y+V++ E L
Sbjct  544  HVAPRKMVLFH-----VEHLKEYCADTRTVCNSVYTPDDNETLDLTSDTNIYRVKVKEAL  598

Query  476  MSNVL--FKKLGDYEIAWVDAEVGKTD------SGMlsllplsdaa--pPHKTVLVGDLK  327
            + ++   F K+GD E+A+V+  +  T        GM   L  +     PPH  V VG+++
Sbjct  599  LKSLEEEFMKVGDREVAYVNGVLNPTGFAPRRGEGMELELEQAPEEIIPPHDPVFVGEVR  658

Query  326  LSDFKQFLASKGVQVEFAGGALRCGEYVTLRK  231
            LSDFK  L   G + EFA G L C   V L+K
Sbjct  659  LSDFKDILTQHGFRTEFAAGVLICNGVVMLKK  690


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 9/85 (11%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDA-SQRggaaaaAIQH  180
            H  V VG+++LSDFK  L   G + EFA G L C   V L+K  +  S R          
Sbjct  723  HDPVFVGEVRLSDFKDILTQHGFRTEFAAGVLICNGVVMLKKETEGLSGR--------SK  774

Query  179  IILEGPLSEEYYTIREYLYSQFYSL  105
            I + G L ++Y+ +R+ LYSQF+ L
Sbjct  775  ISVNGALCDDYFAVRDLLYSQFHIL  799



>ref|XP_008216190.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Nasonia vitripennis]
Length=738

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 97/200 (49%), Gaps = 33/200 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLV G+ + TE L     ++V   V+ P   ET+D T++   Y+V+L++ L+S
Sbjct  548  QLRPRRIVLVRGSPKDTELLAAQA-RNVGARVFIPSRGETLDATTETHIYQVRLTDALVS  606

Query  470  NVLFKK-LGDYEIAWVDAEV--------------------GKTDSGMlsllplsdaapPH  354
             + F +  GD E+AWVDA +                     +T+  +       +     
Sbjct  607  GLNFSRGKGDSEVAWVDALITARDQVCRDVFMDNENEDLIDRTEKILTLEPLPLNEVXXX  666

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            +T  + +LKLSDFKQ L    +  EF+GG L C       +  +A +           II
Sbjct  667  QTTFINELKLSDFKQILTKANIPSEFSGGVLWCCNNTIAVRRHEAGK-----------II  715

Query  173  LEGPLSEEYYTIREYLYSQF  114
            +EG LSE+YY ++E LY Q+
Sbjct  716  MEGCLSEDYYRVKELLYEQY  735



>emb|CEP08367.1| hypothetical protein [Parasitella parasitica]
Length=755

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 49/147 (33%), Positives = 87/147 (59%), Gaps = 6/147 (4%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             +AP KL++VHG+  +T+ L   C  + H    ++ P + E ++V++    Y+V+L++ +
Sbjct  605  QIAPRKLIIVHGSQSSTDDLATACQGMDHFTNEIFTPSVGEVLNVSAATNIYRVKLTDSM  664

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHK---TVLVGDLKLSDFKQF  306
            +S++ F KL DYE+A V   +   D      L ++ +    K   +V VGD++L++FK+ 
Sbjct  665  VSSLRFSKLDDYELARVIGHIHFPDDSTTPSLDVATSDESTKWEPSVFVGDVRLTEFKKV  724

Query  305  LASKGVQVEFAG-GALRCGEYVTLRKV  228
            L ++G+Q EF G G L C + V +RKV
Sbjct  725  LQTEGIQAEFKGEGILVCNDQVAVRKV  751



>ref|XP_008613583.1| hypothetical protein SDRG_09428 [Saprolegnia diclina VS20]
 gb|EQC32897.1| hypothetical protein SDRG_09428 [Saprolegnia diclina VS20]
Length=739

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 89/180 (49%), Gaps = 14/180 (8%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KL+LVHGT E ++ LK +    +  C  V+ PQ  E +D+ SD    KV L E L 
Sbjct  569  VKPRKLILVHGTPETSDELKTYVDSSIDACEAVFCPQPNECVDIESDTTVCKVSLKEALY  628

Query  473  SNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASK  294
            ++  F+K+G +++A++   +    +  +      DA      +  G + L   KQ LA  
Sbjct  629  TSAHFQKVGVHDVAYIHGHLEFQGTTCVLDKADVDAPHEPMRLSQGKITLDSMKQLLAKA  688

Query  293  GVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            G +  F+GG L C + V L++  +              I++EG LS  YY IR+ LY Q+
Sbjct  689  GFKANFSGGMLVCDDGVVLKRARN------------NEIMVEGTLSASYYRIRDILYGQY  736



>gb|KDO26595.1| hypothetical protein SPRG_07999 [Saprolegnia parasitica CBS 223.65]
Length=737

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 57/180 (32%), Positives = 89/180 (49%), Gaps = 14/180 (8%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KL+LVHGT E ++ LK +    +  C  V+ PQ  E +D+ SD    KV L E L 
Sbjct  567  VKPRKLILVHGTPETSDELKTYVDSSIDACEAVFCPQPNECVDIESDTTVCKVSLKEALY  626

Query  473  SNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASK  294
            ++  F+K+G +++A++   +    +  +      DA      +  G + L   KQ LA  
Sbjct  627  TSAHFQKVGVHDVAYIHGHLEFQGTTCVLDKADFDAPHEPMRLSQGKITLDSMKQLLAKA  686

Query  293  GVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
            G +  F+GG L C + V L++  +              I++EG LS  YY IR+ LY Q+
Sbjct  687  GFKANFSGGMLVCDDGVVLKRARN------------NEIMVEGTLSASYYRIRDILYGQY  734



>ref|XP_011417088.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Crassostrea gigas]
Length=339

 Score = 87.8 bits (216),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 99/219 (45%), Gaps = 52/219 (24%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH---VCPHVYAPQIEETIDVTSDLCAYKVQLSEK  480
             + P +L+LV  T EATE L ++C K+   V   ++ P I E +DVT +   ++V+L + 
Sbjct  130  QIKPRQLILVRATTEATEALAEYCRKNEGVVQGKIFLPHIGEVVDVTRESHIFQVRLRDY  189

Query  479  LMSNVLFKKLGDYEIAWVDA----EVGKTDSGMlsllplsdaapP---------------  357
            ++S + F K  + E+AW+D       GK D+G +      +                   
Sbjct  190  VVSALEFAKAKETELAWIDGILDMSRGKVDTGAMYDAEEGELKEEKARKIQDGVLNGEED  249

Query  356  ------------------HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRK  231
                              HK V + + KLSDFK  L  +G+  EF  G L C   V +R+
Sbjct  250  PMEVVPTVEALPHNQFVGHKAVFINEPKLSDFKLVLLQEGISAEFIAGVLICNNNVAVRR  309

Query  230  VGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
              +A +           I LEG + E+++ IR+ LYSQ+
Sbjct  310  -NEAGR-----------IQLEGTICEDFFKIRQILYSQY  336



>gb|EPZ32528.1| Beta-Casp domain-containing protein [Rozella allomycis CSF55]
Length=742

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 52/187 (28%), Positives = 102/187 (55%), Gaps = 24/187 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            H++P K++L+ G+ EAT  L Q+C     +   V +P++ E ++V+S+   Y+++L++ +
Sbjct  567  HISPKKIILIGGSPEATTALAQYCNFSNDITNDVISPKLLEVVNVSSNTNIYQIKLTDAI  626

Query  476  MSNVLFKKLGDYEIAWVDAEVGK-------TDSGMlsllplsdaapPHKTVLVGDLKLSD  318
            +S++ F+KL  YE+++++  VGK       T   +  +   S  A   + + +GD+KLS+
Sbjct  627  LSSLQFEKLASYELSFINGIVGKKSEEDTSTVPTLDIISDQSKVADVRQPIFIGDVKLSE  686

Query  317  FKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTI  138
            F++     G+  +F  G L C + V      D++ +          + +EG L++ YY +
Sbjct  687  FRKLCNQSGLMTQFYKGDLVCNDSVI-----DSTGK----------LTIEGNLTDAYYKV  731

Query  137  REYLYSQ  117
            R  LY Q
Sbjct  732  RNLLYRQ  738



>ref|XP_002115881.1| hypothetical protein TRIADDRAFT_30006 [Trichoplax adhaerens]
 gb|EDV21733.1| hypothetical protein TRIADDRAFT_30006 [Trichoplax adhaerens]
Length=745

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/209 (29%), Positives = 92/209 (44%), Gaps = 43/209 (21%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV---CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            V P  LVLV G++ A + L   C +        V+ P + +T+D T +   Y+V+L + L
Sbjct  546  VNPRHLVLVRGSSAAVQELGNFCRQSKEMGVRKVFTPVVGQTVDATFESHLYQVRLRDSL  605

Query  476  MSNVLFKKLGDYEIAWVDAEVGKT---------------DSGMlsllplsdaapP-----  357
            +S++ +    D E+AWVD  V  T               D  M +       A       
Sbjct  606  VSSLYYCNAKDAELAWVDGRVTVTAKGHERLLDKNNKNEDEAMDTDNTSITEAVVPILEP  665

Query  356  --------HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRgga  201
                    HK+V + D +LSD KQ L   G+Q EF GG + C + + +R+          
Sbjct  666  LLQSEIPGHKSVFINDPRLSDLKQTLTKAGIQAEFVGGVIVCNDKIAVRRTETGK-----  720

Query  200  aaaAIQHIILEGPLSEEYYTIREYLYSQF  114
                   I LEG +  +YYT+R+ LY Q+
Sbjct  721  -------ITLEGAICNDYYTVRDILYQQY  742



>ref|XP_006812203.1| PREDICTED: LOW QUALITY PROTEIN: cleavage and polyadenylation 
specificity factor subunit 2-like [Saccoglossus kowalevskii]
Length=771

 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 103/223 (46%), Gaps = 57/223 (26%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC-LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            + P ++++VHGT EATE   ++C +      V  P+++ET+D T +   ++V+L + L+S
Sbjct  558  MKPKQVIIVHGTEEATESFGEYCRVTAGISKVLLPRVDETVDATMESHIFQVKLKDALVS  617

Query  470  NVLFKKLGDYEIAWVDAE----VGKTDSGMlsllp-------------------------  378
            ++ F K  D E+AWVD +    V  TD+G+L                             
Sbjct  618  SLEFAKAKDAELAWVDGQLDLMVSATDTGILLEEGELTEENEDTVITTGPKPITETAAKR  677

Query  377  ---------------lsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYV  243
                             + AP H+ V + + +L +FKQ L   G+Q EF GG + C   V
Sbjct  678  RETKSGEGVPILEGLPPNEAPGHQEVFINEPRLMEFKQILLRNGIQAEFVGGVIICNNMV  737

Query  242  TLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
             +++            +    I+LEG L E+Y+ IRE LY Q+
Sbjct  738  AVKR------------SEAGLILLEGSLCEDYFKIRELLYEQY  768



>gb|ESA21701.1| hypothetical protein GLOINDRAFT_119294 [Rhizophagus irregularis 
DAOM 181602]
Length=759

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 100/184 (54%), Gaps = 18/184 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCL--KHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P KL++VH + EAT      CL  + +   +Y P + E ++V+  +  Y+V+L++ L
Sbjct  584  QVQPRKLIVVHASPEATHDFASSCLALQSMTRDIYTPDVGELLNVSEAINFYQVKLTDSL  643

Query  476  MSNVLFKKLGDYEIAWVDAEVG-KTDSG--MlsllplsdaapPHKTVLVGDLKLSDFKQF  306
            +S++   KL DY+I++V  ++    DS   +L ++P+ + A     V VG++KL++ K+ 
Sbjct  644  VSSLRLSKLEDYDISFVSGKIHLPPDSSFPILDVMPIEEYAASDNPVFVGEIKLTELKRV  703

Query  305  LASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
            L  +G+  EF G G L C E V +RK                 + LEG LS++Y+ IR  
Sbjct  704  LQLEGIIAEFKGEGVLVCNEKVAIRKTPTG------------QLTLEGSLSDDYFKIRSI  751

Query  128  LYSQ  117
            +Y Q
Sbjct  752  IYGQ  755



>ref|XP_008555333.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Microplitis demolitor]
Length=738

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 95/201 (47%), Gaps = 34/201 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             + P ++VLVHG+ +  + L Q   + V   V+ P   ET+D+T++   Y+V++++ L+ 
Sbjct  547  QLRPRRVVLVHGSLKDCQVLAQQA-QSVDARVFIPSQGETLDLTTETHIYQVKMTDALLR  605

Query  470  NVLFKKL-GDYEIAWVDAEV---------------------GKTDSGMlsllplsdaapP  357
             + + K  GD E+AWVD  +                      + +          +  P 
Sbjct  606  GLKYSKCHGDNEVAWVDTRIDMRERVCPDASKAIANLRDDEAEEEKIFTFEPLNINEVPG  665

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H  + + ++KLSDFKQ L    +  E +GG L C       + G+A +           +
Sbjct  666  HDFLFINEIKLSDFKQVLTKANIPSEISGGVLWCCNNTLAVRRGEAGK-----------V  714

Query  176  ILEGPLSEEYYTIREYLYSQF  114
            +LEG LSEEYY +RE L+ QF
Sbjct  715  VLEGALSEEYYIVRELLFEQF  735



>gb|KFB52768.1| hypothetical protein ZHAS_00021031 [Anopheles sinensis]
Length=771

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 61/217 (28%), Positives = 90/217 (41%), Gaps = 61/217 (28%)
 Frame = -2

Query  617  GTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLFKKLGDYE  438
            G+A  T H+ +HC  ++   V+ P   E ID T++   Y+V+L+E L+S + F+K  D E
Sbjct  564  GSASNTAHIAEHCQLNIGARVFTPNRGEIIDATTETHIYQVRLTEALVSQLEFQKGKDAE  623

Query  437  IAWVDAEV---------------------------------GKTDSGMlsllplsdaapP  357
            +AWVDA++                                 G  D+ M       +    
Sbjct  624  VAWVDAQIVIRNKRIDTVAGKDTAGAGGDTTTNPTVSGSVGGAGDTAMDVDDVEENKMDK  683

Query  356  HKTVL---------------VGDLKLSDFKQFLASKGVQVEFAGGALRCGE-YVTLRKVG  225
                L               + +LKL DFKQ L    +  EF+GG L C    V LR+V 
Sbjct  684  QILTLEPLQAEDLPPHNPVFINELKLIDFKQILMKNNINSEFSGGVLWCSNGTVALRRVD  743

Query  224  DASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
                           + +EG +SE+YY IRE LY Q+
Sbjct  744  TG------------RVTIEGCISEDYYKIRELLYEQY  768



>gb|KFD52003.1| hypothetical protein M513_07135 [Trichuris suis]
 gb|KFD71382.1| hypothetical protein M514_07135 [Trichuris suis]
Length=768

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 59/206 (29%), Positives = 93/206 (45%), Gaps = 42/206 (20%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P ++++VHG  E+TE L  +C K +      V+ P++ E +D T +   Y+V+LS+ +MS
Sbjct  572  PKQVIIVHGNPESTELLADYCRKSLGLPKEKVFTPKLGEVVDATIESHIYQVKLSDSIMS  631

Query  470  NVLFKKLG-DYEIAWVDAEVGKTDSGMlsllplsdaapP---------------------  357
            ++ F K   D E+AWVDA V   +SG+     + + +                       
Sbjct  632  SLKFAKAKEDVELAWVDARVVIRESGVCEDFTIPEPSVRNESLKMLYATADNTYLDVLHP  691

Query  356  -----HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaa  192
                 HKTV V + KLS+ KQ     G Q EF  G L     + LRK             
Sbjct  692  GEIPPHKTVFVNEPKLSNLKQIFMLNGFQAEFVNGNLIINNAIALRK------------N  739

Query  191  AIQHIILEGPLSEEYYTIREYLYSQF  114
               ++ +EG     Y+ +R+ +Y QF
Sbjct  740  EAGNLCMEGAACSTYFAVRDLIYKQF  765



>gb|EHJ67102.1| putative cleavage and polyadenylation specificity factor 100 
kDa subunit [Danaus plexippus]
Length=818

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 89/186 (48%), Gaps = 22/186 (12%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P  +V +     A   LK+HC       V+ P   +T+D T++   Y+V+L++ +M  + 
Sbjct  549  PRAVVALRAGPTALATLKKHCDSEGIEKVFTPGRGDTVDATTESHIYQVKLTDSVMCGLS  608

Query  461  FKKLGDYEIAWVDAEVGKTDS---------GMlsllplsdaapPHKTVLVGDLKLSDFKQ  309
            ++  GD E+AW+ A V +  +          +  +   +    PH    V  ++LS+ + 
Sbjct  609  WRSAGDAELAWLSAVVAQPRTRDTPSEEVADVEMMSLEAAEGVPHGAWFVNSVRLSELRA  668

Query  308  FLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
             LA  G+  EF+ GAL  C   + +R++ +              + LEG LSEEY+ +RE
Sbjct  669  ALARNGLGAEFSAGALECCNGTIAIRRLENG------------RVALEGVLSEEYFKVRE  716

Query  131  YLYSQF  114
             LY QF
Sbjct  717  LLYDQF  722



>ref|XP_646760.1| beta-lactamase domain-containing protein [Dictyostelium discoideum 
AX4]
 sp|Q55BS1.1|CPSF2_DICDI RecName: Full=Cleavage and polyadenylation specificity factor 
subunit 2; AltName: Full=Cleavage and polyadenylation specificity 
factor 100 kDa subunit; Short=CPSF 100 kDa subunit [Dictyostelium 
discoideum]
 gb|EAL72546.1| beta-lactamase domain-containing protein [Dictyostelium discoideum 
AX4]
Length=784

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 56/213 (26%), Positives = 97/213 (46%), Gaps = 42/213 (20%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
             +AP KLVL+ G+ + ++ ++ +  +++    +Y P I E +D+TSD   Y++ L + L+
Sbjct  577  QIAPTKLVLIRGSEQQSQSIENYVKENIRTKGIYIPSIGEQLDLTSDTNVYELLLKDSLV  636

Query  473  SNVLFKKLGDYEIAWVDAEVGKTDSG---------------------------------M  393
            + +   K+ DYE++++  +V   D                                    
Sbjct  637  NTLKTSKILDYEVSYIQGKVDILDGSNVPVLDLIQSIPINNNNNNNNNNNNNNNNNNNNT  696

Query  392  lsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQ  213
              +   +     H    +GD+KLSD KQ L + G+QV+F  G L CG  V + +  D   
Sbjct  697  TMMTTTTTTTNGHDESFIGDIKLSDLKQVLVNAGIQVQFDQGILNCGGLVYIWRDEDHGG  756

Query  212  RggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
                       I ++G +S+EYY I+E LY QF
Sbjct  757  NSI--------INVDGIISDEYYLIKELLYKQF  781



>ref|XP_005825644.1| hypothetical protein GUITHDRAFT_89302 [Guillardia theta CCMP2712]
 gb|EKX38664.1| hypothetical protein GUITHDRAFT_89302 [Guillardia theta CCMP2712]
Length=770

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 90/203 (44%), Gaps = 34/203 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            H+ P K++++HG+ +ATE L+  C++ V    + +AP + E +  +SD   YK++L + L
Sbjct  581  HLKPAKVIVIHGSEKATEELQNFCIRKVTEPENTFAPPVGEAVMASSDTNIYKIKLDKAL  640

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKT-----------------  348
               + F ++G Y++A++DA +   D   +                               
Sbjct  641  AQGLQFVRVGGYDVAYIDASITCPDENSVDNSSTLPVGQNKDKQMPTLVPRQQEDGGGRK  700

Query  347  --VLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
                +GD+KLSD K  L  +  + E   G L     + +RK G               +I
Sbjct  701  PFAFIGDVKLSDLKVLLEKQKYKTELKAGMLVVNGSIIIRKSG-------------SRMI  747

Query  173  LEGPLSEEYYTIREYLYSQFYSL  105
             EG +  EY  +R  L SQ+++L
Sbjct  748  FEGTICTEYAAVRSLLMSQYHTL  770



>gb|KHJ48938.1| cleavage and polyadenylation specificity factor subunit 2 family 
protein [Trichuris suis]
Length=771

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 59/209 (28%), Positives = 93/209 (44%), Gaps = 45/209 (22%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P ++++VHG  E+TE L  +C K +      V+ P++ E +D T +   Y+V+LS+ +MS
Sbjct  572  PKQVIIVHGNPESTELLADYCRKSLGLPKEKVFTPKLGEVVDATIESHIYQVKLSDSIMS  631

Query  470  NVLFKKLG----DYEIAWVDAEVGKTDSGMlsllplsdaapP------------------  357
            ++ F K      D E+AWVDA V   +SG+     + + +                    
Sbjct  632  SLKFAKAKEVNHDVELAWVDARVVIRESGVCEDFTIPEPSVRNESLKMLYATADNTYLDV  691

Query  356  --------HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRgga  201
                    HKTV V + KLS+ KQ     G Q EF  G L     + LRK          
Sbjct  692  LHPGEIPPHKTVFVNEPKLSNLKQIFMLNGFQAEFVNGNLIINNAIALRK----------  741

Query  200  aaaAIQHIILEGPLSEEYYTIREYLYSQF  114
                  ++ +EG     Y+ +R+ +Y QF
Sbjct  742  --NEAGNLCMEGAACSTYFAVRDLIYKQF  768



>emb|CDJ87806.1| Beta-lactamase and RNA-metabolising metallo-beta-lactamase domain 
containing protein [Haemonchus contortus]
Length=1014

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 83/165 (50%), Gaps = 25/165 (15%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG+A+AT HL Q+C  +     H++AP + E +D T     Y++ LS++L
Sbjct  820  QMKPKQLIIVHGSAQATRHLAQYCYDNNIAQGHIFAPSVGEVVDATVASHIYRILLSDEL  879

Query  476  MSNVLFKKLGDYEIAWVDAEVG--KTDSGMlsllplsdaapP------------------  357
              ++ F K+ D ++AW+DA++    T++GM      +    P                  
Sbjct  880  FESLEFIKVKDADLAWIDAQITARPTETGMDRENGANSDVRPMDIDQHIDKCMLSTLSGD  939

Query  356  ---HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRK  231
                  V V D KLS+ KQ L + G   EF+ G L  G  +++R+
Sbjct  940  APFRDVVYVNDPKLSEMKQLLINMGYSAEFSSGVLYIGGVISIRR  984



>gb|KIH44351.1| RNA-metabolizing metallo-beta-lactamase, partial [Ancylostoma 
duodenale]
Length=223

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 82/164 (50%), Gaps = 27/164 (16%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            P +L+LVHG+A+AT HL QHC  +     H++ P + + +D T     Y++ L+++L  +
Sbjct  49   PKQLILVHGSAQATRHLAQHCYDNNIAQGHIFTPSVGDIVDATVASHIYRILLNDELFES  108

Query  467  VLFKKLGDYEIAWVDA-------EVG-KTDSGMlsllplsd-----------------aa  363
            + F K+ D ++AW+DA       EVG + + GM    P                     A
Sbjct  109  LEFIKVKDADLAWIDAQITARPSEVGVEREDGMEVDQPADAHLSDQHIDKCMLSALSGEA  168

Query  362  pPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRK  231
            P    V V D KLS+ KQ L + G   EF+ G L  G  +++R+
Sbjct  169  PFRDVVYVNDPKLSEMKQLLLNMGFSAEFSSGVLYIGGVISIRR  212



>emb|CDJ83222.1| unnamed protein product [Haemonchus contortus]
Length=871

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 63/207 (30%), Positives = 101/207 (49%), Gaps = 37/207 (18%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG+A+AT HL Q+C  +     H++AP + E +D T     Y++ LS++L
Sbjct  677  QMKPKQLIIVHGSAQATRHLAQYCYDNNIAQGHIFAPSVGEVVDATVASHIYRILLSDEL  736

Query  476  MSNVLFKKLGDYEIAWVDAEVGK--TDSGMl---------------------sllplsda  366
              ++ F K+ D ++AW+DA++    T++GM                       L  LS  
Sbjct  737  FESLEFIKVKDADLAWIDAQITARPTETGMDRENGANSDVRPMDIDQHIDKCMLSTLSGD  796

Query  365  apPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAI  186
            AP    V V D KLS+ KQ L + G   EF+ G L  G  +++R+  + + R        
Sbjct  797  APFRDVVYVNDPKLSEMKQLLINMGYSAEFSSGVLYIGGVISIRR--NEAGRF-------  847

Query  185  QHIILEGPLSEEYYTIREYLYSQFYSL  105
             HI  EG     Y  +R+ +  QF  L
Sbjct  848  -HI--EGCAGPLYLKLRDIILEQFMVL  871



>ref|XP_001949295.2| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Acyrthosiphon pisum]
Length=724

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 56/195 (29%), Positives = 95/195 (49%), Gaps = 29/195 (15%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            + P +L+LV G + +T+ +       +   V+ P+I + ++VT++   Y+V+L++ L+S 
Sbjct  539  LKPRRLILVRGNSYSTKVVYNFAKVFIDGKVFTPRIGQCMNVTTESHIYQVRLTDTLLSK  598

Query  467  VLFKKLGDYEIAWVDAEVG----------------KTDSGMlsllplsdaapPHKTVLVG  336
            + FKK  +  +A+++A++                 K D              PHKTV + 
Sbjct  599  INFKKGPNGNLAYMNAKLKLNSRDTVMEVDNVISEKNDQIFTLEPLADHEIHPHKTVFIN  658

Query  335  DLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIILEGPL  159
             LKLSDFKQ L+ K +  E + G L  C   V +R+                 +++EG +
Sbjct  659  RLKLSDFKQILSKKNIPCELSKGVLWCCNRTVCVRRNSSGK------------VLMEGII  706

Query  158  SEEYYTIREYLYSQF  114
            S +YY IR  LYSQF
Sbjct  707  SRQYYYIRSLLYSQF  721



>ref|XP_002673225.1| predicted protein [Naegleria gruberi]
 gb|EFC40481.1| predicted protein [Naegleria gruberi]
Length=808

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 56/183 (31%), Positives = 95/183 (52%), Gaps = 15/183 (8%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC-LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            + P KL+L+HG+ E+   L  +C  K +   +  P   E +D+T D   +KV+L + L+S
Sbjct  636  INPRKLILIHGSQESIIELSDYCETKKISEQIKTPMDLEVMDMTMDTNMFKVKLKQDLLS  695

Query  470  NVLFKKLG-DYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLASK  294
             + + K G +Y++A+++      +   +  +  +     H T+L+GDLKL+ F + L   
Sbjct  696  QIHYIKSGTNYDMAYIEGIYRVEEGSDIPCIHPNPKPKGHPTMLIGDLKLNQFFKLLKES  755

Query  293  GVQVEF-AGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQ  117
            G+  EF  GG L C + V L+K   + +           I + G LS  Y+ +RE LY +
Sbjct  756  GLSAEFQQGGVLVCNDEVMLQKDKKSGE-----------IQVFGSLSPTYFQVRELLY-K  803

Query  116  FYS  108
            FYS
Sbjct  804  FYS  806



>gb|KHJ99454.1| RNA-metabolizing metallo-beta-lactamase [Oesophagostomum dentatum]
Length=638

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 103/210 (49%), Gaps = 40/210 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L+LVHG+  +T HL QHC  +     H++ P + ET+D T     Y++ L+++L
Sbjct  441  QMKPKQLILVHGSGPSTRHLAQHCYDNNIAQGHIFTPSVGETVDATVASHIYRILLNDEL  500

Query  476  MSNVLFKKLGDYEIAWVDA-------EVG-KTDSGMlsllplsda---------------  366
              ++ F K+ D ++AW+DA       EVG + +SGM    P +DA               
Sbjct  501  FESLEFIKVKDADLAWIDAQITARPSEVGVERESGMEVDEPPADAHLIDQHIDKCMLSGL  560

Query  365  ---apPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaa  195
               APP   V V D KLS+ KQ L + G   EF+ G L  G  +++R+  + + R     
Sbjct  561  SGDAPPRDVVYVNDPKLSEMKQLLLNMGFSAEFSSGVLYIGGVISIRR--NEAGRF----  614

Query  194  aAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
                HI  EG +   Y  +R+ +  QF  L
Sbjct  615  ----HI--EGCVGPLYLKLRDIILEQFMVL  638



>emb|CCJ29043.1| unnamed protein product [Pneumocystis jirovecii]
 emb|CCJ29045.1| unnamed protein product [Pneumocystis jirovecii]
Length=772

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 56/187 (30%), Positives = 95/187 (51%), Gaps = 24/187 (13%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KLVL++ T EA +++   C  L      +Y+P   E + +   L +Y ++LS+ ++
Sbjct  591  VNPRKLVLINSTQEAKDNMMATCRSLTSFTNDIYSPLQGEVLKIGIKLNSYNLKLSDNII  650

Query  473  SNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTV---------LVGDLKLS  321
            + + +KKLGDY ++ V  ++  +     + LP+ +    H  +          VGD+KL+
Sbjct  651  NTLRWKKLGDYNVSHVIGKLKLSADFTETNLPILEILSTHSNIRNIPQSHPLFVGDVKLT  710

Query  320  DFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYY  144
              KQ L  +G   E  G G L C   VT+RK+G               +ILEG +S+E+Y
Sbjct  711  QVKQLLQDQGHVAELIGEGVLLCDGLVTVRKIGGGK------------VILEGGVSQEFY  758

Query  143  TIREYLY  123
             +R+ +Y
Sbjct  759  DVRKIVY  765



>ref|XP_001749611.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ85662.1| predicted protein [Monosiga brevicollis MX1]
Length=770

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 24/187 (13%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            P  LVL+HGT + TE L   C+  +     +  P+  E +D+  +   ++++L + L+S+
Sbjct  594  PRFLVLLHGTEDETEELADSCVHKLRDLERIVMPKRFERVDIAGERNIFQLRLRDALVSS  653

Query  467  VLFKKLGDYEIAWVDAEVGKTDSGMlsllp-------lsdaapPHKTVLVGDLKLSDFKQ  309
            + F + G+Y+IAW+D  +  T+    S           +  A  H  V VGD++LS  K 
Sbjct  654  LKFSEAGEYKIAWIDGVLAHTEGDETSSKRAKLPQLEAATEAAEHNAVFVGDIRLSQLKT  713

Query  308  FLASKGVQVEFAGGALRCGEYVTLRK--VGDASQRggaaaaAIQHIILEGPLSEEYYTIR  135
             L +  V+V +    L C   V + K  +G +               ++GPL E YY +R
Sbjct  714  VLENHQVEVSWWVEKLVCNNQVVVGKDPLGGS-------------FSIDGPLCETYYKVR  760

Query  134  EYLYSQF  114
            E LY QF
Sbjct  761  ELLYQQF  767



>ref|XP_004927215.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2-like [Bombyx mori]
Length=635

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 53/187 (28%), Positives = 90/187 (48%), Gaps = 23/187 (12%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            P  +V +  +  A   LK+HC       V+ P + ET+D T++   Y+V+L++ LM  ++
Sbjct  458  PWAVVGLRASEAALHTLKKHCESEGIEKVFLPSVGETVDATTESHIYQVKLTDGLMRGLV  517

Query  461  FKKLGDYEIAWVDAEVGK----------TDSGMlsllplsdaapPHKTVLVGDLKLSDFK  312
            +++ GD E+AW+ A V             + G  ++   + A  P     V  ++L + +
Sbjct  518  WRQAGDAELAWLSAVVAPRTHARESDAAPEEGGGAVSLEAGAGRPRAAAFVNTVRLHELR  577

Query  311  QFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIR  135
              LA  G+Q +   G L  C   + +R++ +              + LEG LSEEYY +R
Sbjct  578  AALARAGLQPDLGAGTLTCCSGTLAVRRMENG------------QVSLEGVLSEEYYKVR  625

Query  134  EYLYSQF  114
            E LY QF
Sbjct  626  ELLYEQF  632



>ref|XP_007343506.1| hypothetical protein AURDEDRAFT_183466 [Auricularia delicata 
TFB-10046 SS5]
 gb|EJD48587.1| hypothetical protein AURDEDRAFT_183466 [Auricularia delicata 
TFB-10046 SS5]
Length=893

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 56/212 (26%), Positives = 101/212 (48%), Gaps = 47/212 (22%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K++LVH T  AT  LK+ C  ++ +   +Y P + +++ +   + ++ + LSE+L
Sbjct  686  QVNPRKMILVHSTTAATNALKESCSSIRAMTKDIYTPWLGDSVQIGEHINSFSLSLSEEL  745

Query  476  MSNVLFKKLGDYEIAWVDAEV----------------GKTDSGMlsllplsd-----aap  360
            ++++   +  D E+ +V   +                GKT+ G L     +       A 
Sbjct  746  LASIKMSRFEDTEVGYVAGRLVAHASSSIPVLEPLAGGKTEDGALQAAAPAARRQLGVAQ  805

Query  359  PHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEY-----------VTLRKVGDAS  216
              ++ ++GDLKL+  K  LA+ G+  EFAG G L CG++           V +RK+G   
Sbjct  806  LPQSTMIGDLKLTALKARLAAIGIPAEFAGEGVLVCGDFVRDPDADPNAVVAVRKMGRGK  865

Query  215  QRggaaaaAIQHIILEGPLSEEYYTIREYLYS  120
                        +++EG + + YYTIR  +Y+
Sbjct  866  ------------VVIEGGVCDVYYTIRREVYA  885



>ref|XP_004366024.2| cleavage and polyadenylation specificity factor [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE89722.1| cleavage and polyadenylation specificity factor [Capsaspora owczarzaki 
ATCC 30864]
Length=838

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 89/181 (49%), Gaps = 23/181 (13%)
 Frame = -2

Query  635  KLVLVHGTAEATEHLKQHCLKHVCPH--VYAPQIEETIDVTSDLCAYKVQLSEKLMSNVL  462
            +L+LVHG+A ++  L +  L+   P   V    +  TID +S+   Y+V+L + LMS + 
Sbjct  671  QLILVHGSATSSNEL-ESALRVKMPQCKVTIAALNTTIDASSEHNIYQVRLRDSLMSTLK  729

Query  461  FKKLGDYEIAWVDAEV-----GKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLAS  297
            F   G +E+A+   ++     GKT   +   +  +   P H  V VGD KL + K+ L  
Sbjct  730  FSTTGMFELAYFHGQIHVPTGGKTT--LELDVLPAHLVPGHAQVFVGDPKLYEVKEVLIE  787

Query  296  KGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQ  117
             G   EF  G L C + + +RK               Q   +EG LSE+Y+ +R+ LY Q
Sbjct  788  AGFHAEFVQGVLVCNDTIAIRKQD-------------QAFAIEGGLSEDYFAVRDVLYDQ  834

Query  116  F  114
            F
Sbjct  835  F  835



>gb|EFX73157.1| hypothetical protein DAPPUDRAFT_58164 [Daphnia pulex]
Length=735

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 97/200 (49%), Gaps = 34/200 (17%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPH--VYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            + P + ++V G++E+ + L+  CL         +  +  ETID T +   Y+V+L + L+
Sbjct  545  MKPKRTIVVRGSSESCQALQNLCLSTGSSDNKAFIARKGETIDATIESHIYQVRLKDSLL  604

Query  473  SNVLFKKLGDYEIAWVDA----EVGKTD---------------SGMlsllplsdaapPHK  351
            S++ F K  D E+AW+DA    +V  TD                  L         P H+
Sbjct  605  SSLSFGKAKDAEVAWIDARLTYQVNLTDLRDLDDKENNSLRKEQAPLLEPLEPKDIPGHE  664

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHII  174
            T  + +LKLSDFKQ L   G+  EF GG L  C   V LR+  + S R          + 
Sbjct  665  TSYINELKLSDFKQVLVRNGISSEFIGGVLWCCNGNVALRR--NESGR----------VT  712

Query  173  LEGPLSEEYYTIREYLYSQF  114
            LEG +S++YY +RE LY Q+
Sbjct  713  LEGCISDDYYRVRELLYEQY  732



>gb|KIH66261.1| metallo-beta-lactamase domain protein [Ancylostoma duodenale]
Length=834

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 60/209 (29%), Positives = 97/209 (46%), Gaps = 39/209 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L+LVHG+A+AT HL QHC  +     H++ P + + +D T     Y++ L+++L
Sbjct  638  QMKPKQLILVHGSAQATRHLAQHCYDNNIAQGHIFTPSVGDIVDATVASHIYRILLNDEL  697

Query  476  MSNVLFKKLGDYEIAWVDA-------EVG-KTDSGMlsllplsdaapPH-----------  354
              ++ F K+ D ++AW+DA       EVG + + GM    P                   
Sbjct  698  FESLEFIKVKDADLAWIDAQITARPSEVGVEREDGMEVDQPADAHLSDQHIDKCMLSALS  757

Query  353  ------KTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaa  192
                    V V D KLS+ KQ L + G   EF+ G L  G  +++R+  + + R      
Sbjct  758  GEAPFRDVVYVNDPKLSEMKQLLLNMGFSAEFSSGVLYIGGVISIRR--NEAGRF-----  810

Query  191  AIQHIILEGPLSEEYYTIREYLYSQFYSL  105
               HI  EG +   Y  +R+ +  QF  L
Sbjct  811  ---HI--EGCVGPLYLRLRDIILEQFMVL  834



>ref|XP_003375603.1| cleavage and polyadenylation specificity factor subunit 2 [Trichinella 
spiralis]
 gb|EFV54853.1| cleavage and polyadenylation specificity factor subunit 2 [Trichinella 
spiralis]
Length=1188

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 98/211 (46%), Gaps = 47/211 (22%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +++LVHG AE TE L  +C K +      V+ P++ + +D T +   Y+++L++ L++
Sbjct  489  PKQIILVHGMAEQTEKLANYCRKSLNMAEDKVFTPRLGDLVDATIESHMYQLKLTDALLN  548

Query  470  NVLFKKLGDYEIAWVDA-------------------------------EVGKTDSGMlsl  384
            ++ F  + D EIAWV+                                ++G +D+     
Sbjct  549  SLKFIHVKDVEIAWVNGLIKHNCSEEETEDQKIAAMDVDDEKNAENAVDIG-SDNIPYLD  607

Query  383  lplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRgg  204
            L  S   P H  V VGD KLSD KQ L   G Q EF+ G L     +++RK  D      
Sbjct  608  LLPSSEIPSHDAVFVGDPKLSDLKQALMLDGFQAEFSHGVLVVNNVLSIRKRADG-----  662

Query  203  aaaaAIQHIILEGPLSEEYYTIREYLYSQFY  111
                    + +EG + ++YY IR+  ++ ++
Sbjct  663  -------QLHVEGIVCKDYYAIRDQFHANYF  686



>gb|EYC31771.1| hypothetical protein Y032_0003g1227 [Ancylostoma ceylanicum]
Length=855

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 61/210 (29%), Positives = 100/210 (48%), Gaps = 40/210 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L+LVHG+A+AT HL QHC  +     H++ P + + +D T     Y++ L+++L
Sbjct  658  QMKPKQLILVHGSAQATRHLAQHCYDNNIAQGHIFTPSVGDIVDATVASHIYRILLNDEL  717

Query  476  MSNVLFKKLGDYEIAWVDA-------EVG-KTDSGMlsllplsdaapPHK----------  351
              ++ F K+ D ++AW+DA       EVG + + GM      +DA    +          
Sbjct  718  FESLEFIKVKDADLAWIDAQITARPSEVGVEREDGMEVDQQPADAHLNDQHIDKCMLSAL  777

Query  350  --------TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaa  195
                     V V D KLS+ KQ L + G   EF+ G L  G  +++R+  + + R     
Sbjct  778  SGEAPFRDVVYVNDPKLSEMKQLLLNMGFSAEFSSGVLYIGGVISIRR--NEAGRF----  831

Query  194  aAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
                HI  EG +   Y  +R+ +  QF  L
Sbjct  832  ----HI--EGCVGPLYLRLRDIILEQFMVL  855



>emb|CDW57805.1| cleavage and polyadenylation [Trichuris trichiura]
Length=787

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 60/225 (27%), Positives = 94/225 (42%), Gaps = 61/225 (27%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVC---PHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P ++++VHG  E+TE L  +C K +      V+ P++ E +D T +   Y+V+LS+ +MS
Sbjct  572  PKQVIIVHGNPESTEMLADYCRKSLGLPKEKVFTPKLGEVVDATIESHIYQVKLSDSIMS  631

Query  470  NVLFKK--------------------LGDYEIAWVDAEVGKTDSGMlsllplsdaapP--  357
            ++ F K                    L D E+AWVDA V   +SG+     + + +    
Sbjct  632  SLKFAKAKEVNHTCAKLALEGYKLFCLQDVELAWVDARVVIRESGVCEDFTVPEPSVRNE  691

Query  356  ------------------------HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGE  249
                                    HKTV V + KLS+ KQ     G Q EF  G L    
Sbjct  692  SLKMLYATADNTYLDVLHPGEIPPHKTVFVNEPKLSNLKQIFMLNGFQAEFINGNLIINN  751

Query  248  YVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
             + LRK                ++ +EG     Y+ +R+ +Y QF
Sbjct  752  AIALRK------------NEAGNLCMEGSACSTYFAVRDLIYKQF  784



>ref|XP_002174386.1| cleavage factor two Cft2/polyadenylation factor CPSF-73 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB08093.1| cleavage factor two Cft2/polyadenylation factor CPSF-73 [Schizosaccharomyces 
japonicus yFS275]
Length=786

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 55/200 (28%), Positives = 99/200 (50%), Gaps = 36/200 (18%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P +LVL+H T E    +K+ C  L      VY P  +E ++V+ D+ ++ ++LS++L
Sbjct  593  QVNPRRLVLIHATDEERADMKKTCAALTAFTKDVYCPDYKEVVNVSIDVNSFNMKLSDEL  652

Query  476  MSNVLFKKLGDYEIAW----------VDAEVGKTDSGM-----------lsllplsdaap  360
            + ++++KKLG+YE+A           VD E  ++   +           L        AP
Sbjct  653  VKSLIWKKLGNYEVAHLMAKIRMPENVDEEAEESKEPVDPKDNLPILDSLKTQQDFALAP  712

Query  359  PHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQ  183
                + VG+++L+  ++ L  +G+ VE  G G L CG  V +RK+ +             
Sbjct  713  RAAPIFVGNVRLAALRKTLMDQGISVELKGEGVLLCGGIVAIRKLDNG------------  760

Query  182  HIILEGPLSEEYYTIREYLY  123
             I++EG +S  ++ IR+ +Y
Sbjct  761  RIVIEGGISNRFFEIRKTIY  780



>ref|XP_005706067.1| cleavage and polyadenylation specificity factor subunit 2 [Galdieria 
sulphuraria]
 gb|EME29547.1| cleavage and polyadenylation specificity factor subunit 2 [Galdieria 
sulphuraria]
Length=747

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/145 (28%), Positives = 80/145 (55%), Gaps = 13/145 (9%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            VAP ++++VHG+ + T  +K+ C + +   ++ P+  ETID+T+D   +++ L ++L+S+
Sbjct  595  VAPRRVIIVHGSRKETAAIKEFCERGLTKDIFCPRAMETIDITTDTSIFRLTLRDRLLSS  654

Query  467  VLFKKLGDYEIAWVDA-------------EVGKTDSGMlsllplsdaapPHKTVLVGDLK  327
             ++K++GDYE++++D              E   + +    L   S     H  V +G+ K
Sbjct  655  CIWKRIGDYELSFLDGTIRVENESSPKEKETNVSHTQEYVLEQRSSLDSGHPIVFIGEGK  714

Query  326  LSDFKQFLASKGVQVEFAGGALRCG  252
            LSD +  L+  G+  +F G ++  G
Sbjct  715  LSDLRPALSRVGIPSDFIGDSVSNG  739



>gb|ETN79077.1| RNA-metabolizing metallo-beta-lactamase [Necator americanus]
Length=692

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 60/210 (29%), Positives = 99/210 (47%), Gaps = 40/210 (19%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L+LVHG+ ++T HL QHC  +     H++ P + E +D T     Y++ L+++L
Sbjct  495  QMKPKQLILVHGSGQSTRHLAQHCYDNNIAQGHIFTPSVGEVVDATVASHIYRILLNDEL  554

Query  476  MSNVLFKKLGDYEIAWVDA-------EVG-KTDSGMlsllplsdaapPHK----------  351
              ++ F K+ D ++AW+DA       EVG + + GM      +DA    +          
Sbjct  555  FESLEFIKVKDADLAWIDAQITARPSEVGVEREDGMEVDEQAADAHLGDQHVDKCMLSAL  614

Query  350  --------TVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaa  195
                     V V D KLS+ KQ L + G   EF+ G L  G  +++R+  + + R     
Sbjct  615  SGEAPFRDVVYVNDPKLSEMKQLLLNMGFAAEFSSGVLYIGGVISIRR--NEAGRF----  668

Query  194  aAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
                HI  EG +   Y  +R+ +  QF  L
Sbjct  669  ----HI--EGCVGPLYLRLRDIILEQFMVL  692



>gb|KIM25567.1| hypothetical protein M408DRAFT_74190 [Serendipita vermifera MAFF 
305830]
Length=879

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 56/198 (28%), Positives = 89/198 (45%), Gaps = 27/198 (14%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            H+ P ++V+V  + EATE L + C   K +   VYAP I ET+ +  D+  + V LS+ L
Sbjct  678  HINPRRMVIVQASPEATESLIESCKATKSMTTEVYAPSIGETVRIGEDMRNFTVALSDAL  737

Query  476  MSNVLFKKLGDYEIAWVDAEV-------------------GKTDSGMlsllplsdaapPH  354
            MS++      D EIA++   +                   G  D  M +   +++ +   
Sbjct  738  MSSIKMSVYEDSEIAFIKGRISLPTNSGIPVLEPLRISNKGNEDVEMENGDAVTEKSTVP  797

Query  353  KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            + V++GDLKL+  K  L   G+  +FAG G L C        V D              +
Sbjct  798  RAVMIGDLKLTSLKNRLNRLGISADFAGEGILVCRS-----TVDDEEDTVAVRKTRKGQV  852

Query  176  ILEGPLSEEYYTIREYLY  123
             +EG  S  +Y +RE +Y
Sbjct  853  RVEGDASTLFYAVREEIY  870



>ref|XP_002461998.1| hypothetical protein SORBIDRAFT_02g012333 [Sorghum bicolor]
 gb|EER98519.1| hypothetical protein SORBIDRAFT_02g012333 [Sorghum bicolor]
Length=66

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 47/62 (76%), Gaps = 1/62 (2%)
 Frame = -2

Query  485  EKLMSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQF  306
            EKLMSN++ KKLG+ EI+WVDAEVGK D  +  LLP S   PPHK VLVGDLKLSDFKQ 
Sbjct  5    EKLMSNIISKKLGELEISWVDAEVGKEDEKL-ILLPPSSTLPPHKPVLVGDLKLSDFKQI  63

Query  305  LA  300
              
Sbjct  64   FG  65



>emb|CEL63693.1| Cleavage factor two protein 2 OS=Schizosaccharomyces pombe (strain 
972 / ATCC 24843) GN=cft2 PE=1 SV=1 [Rhizoctonia solani 
AG-1 IB]
Length=879

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 54/197 (27%), Positives = 89/197 (45%), Gaps = 25/197 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCL--KHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH   EAT+ LK+ CL  K +   ++AP + E++ +      + V LS++L
Sbjct  679  QVNPRKMIIVHSHREATDGLKESCLSIKAMTRDIHAPDVGESVQIGQQTNVFTVALSDEL  738

Query  476  MSNVLFKKLGDYEIAWVDAEV------------------GKTDSGMlsllplsdaapPHK  351
            +++V   +  D EI +V   V                     DS  L    +       +
Sbjct  739  IASVKMSRFEDNEIGFVHGRVTGNANSTVPTLDPTMPISSNGDSENLPASDVRPVLSLPR  798

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            + ++GDL+L+  K  L   G+  EF G G L CG     R  G           A   ++
Sbjct  799  STMIGDLRLTALKTRLGVLGIAAEFIGEGVLVCGT----RTSGSLDDAVAVRKTARGQVV  854

Query  173  LEGPLSEEYYTIREYLY  123
            +EG +S+ YYT+R  +Y
Sbjct  855  VEGSISDVYYTVRREVY  871



>emb|CCO31905.1| Cleavage factor two protein 2 [Rhizoctonia solani AG-1 IB]
Length=195

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 86/191 (45%), Gaps = 25/191 (13%)
 Frame = -2

Query  632  LVLVHGTAEATEHLKQHCL--KHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSNVLF  459
            +++VH   EAT+ LK+ CL  K +   ++AP + E++ +      + V LS++L+++V  
Sbjct  1    MIIVHSHREATDGLKESCLSIKAMTRDIHAPDVGESVQIGQQTNVFTVALSDELIASVKM  60

Query  458  KKLGDYEIAWVDAEV------------------GKTDSGMlsllplsdaapPHKTVLVGD  333
             +  D EI +V   V                     DS  L    +       ++ ++GD
Sbjct  61   SRFEDNEIGFVHGRVTGNANSTVPTLDPTMPISSNGDSENLPASDVRPVLSLPRSTMIGD  120

Query  332  LKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLS  156
            L+L+  K  L   G+  EF G G L CG     R  G           A   +++EG +S
Sbjct  121  LRLTALKTRLGVLGIAAEFIGEGVLVCGT----RTSGSLDDAVAVRKTARGQVVVEGSIS  176

Query  155  EEYYTIREYLY  123
            + YYT+R  +Y
Sbjct  177  DVYYTVRREVY  187



>gb|EPX74257.1| cleavage factor two Cft2/polyadenylation factor CPSF-73 [Schizosaccharomyces 
octosporus yFS286]
Length=791

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 57/207 (28%), Positives = 98/207 (47%), Gaps = 43/207 (21%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P KLVL+H T E  E +K+ C  L      VY P+ EE ++V+ D+ A+ ++LS+ L
Sbjct  591  QVNPRKLVLIHATDEEREDMKRTCSALSAFTKDVYLPKYEEAVNVSIDVNAFSLKLSDDL  650

Query  476  MSNVLFKKLGDYEIAWV-------------DAEVGKTDSGMlsllplsdaapPHKTV---  345
            + N+++ K+G+ E++ +             D+EV + D+        +D  P    V   
Sbjct  651  IRNLIWTKVGNCEVSHMLAKIEKPLDSETQDSEVNEEDAKRNDSDKEADHLPVLNPVTLR  710

Query  344  ------------LVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRgg  204
                        LVG+ KL++ ++ L  + +  E  G G L CG  V +RK+        
Sbjct  711  SDLARAPRAAPLLVGNTKLAELRKALLDQRISAELKGEGVLLCGGVVAVRKLSGGK----  766

Query  203  aaaaAIQHIILEGPLSEEYYTIREYLY  123
                    I +EG LS +++ +R+ +Y
Sbjct  767  --------ITIEGGLSNQFFEVRKMIY  785



>gb|EPY49380.1| cleavage factor two Cft2/polyadenylation factor CPSF-73 [Schizosaccharomyces 
cryophilus OY26]
Length=791

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 54/208 (26%), Positives = 97/208 (47%), Gaps = 43/208 (21%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P KLVL+H T E  E +K+ C  L      VY P+  E I+V+ D+ A+ ++LS+ L
Sbjct  591  QVNPRKLVLIHATDEEREDMKRTCSALSAFTKDVYLPKYGEDINVSIDVNAFSLKLSDDL  650

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKT-----------------  348
            + N+++ K+G+ E++ + A++   D      L  ++     +                  
Sbjct  651  IRNLIWTKVGNCEVSHMLAKIENPDESETQDLEQNEEDVKQQNTEKEVDHLPVLNPVTLR  710

Query  347  -----------VLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRgg  204
                       +LVG+ +L++ ++ L  +GV  E  G G L CG  V +RK+        
Sbjct  711  SDLARAPRAAPLLVGNTRLAELRKALIDQGVSAELKGEGVLLCGGVVAVRKLSGGK----  766

Query  203  aaaaAIQHIILEGPLSEEYYTIREYLYS  120
                    I +EG LS +++ +R+ +Y+
Sbjct  767  --------ISIEGGLSNQFFEVRKMIYN  786



>ref|XP_003289932.1| hypothetical protein DICPUDRAFT_80682 [Dictyostelium purpureum]
 gb|EGC33550.1| hypothetical protein DICPUDRAFT_80682 [Dictyostelium purpureum]
Length=752

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/185 (26%), Positives = 97/185 (52%), Gaps = 17/185 (9%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
             +AP  LVL+ G  + +++++ +  +++    +++P I E +D+TS    Y++ L + L+
Sbjct  576  QIAPTNLVLIRGKKDQSKNIENYVKENMRTKGIFSPAINEELDLTSGTNVYELVLRDTLV  635

Query  473  SNVLFKKLGDYEIAWVDAEV--GKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLA  300
            + +   K+ D E++++  +V     ++     +  S+    H    +GD+KL+D KQ L 
Sbjct  636  NTLKPSKILDCEVSFIQGKVEYNPENNSSYLDIIPSEQNNGHDESFIGDIKLADLKQVLV  695

Query  299  SKGV-QVEFAGGALRCGE--YVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREY  129
              G+ +V+F  G + C +  Y+    VG  S            I ++G +S+EYY ++E 
Sbjct  696  KAGIKKVQFDQGIINCNDLVYIWREDVGGNSI-----------INVDGIISDEYYLVKEL  744

Query  128  LYSQF  114
            LY QF
Sbjct  745  LYRQF  749



>ref|XP_007875190.1| hypothetical protein PNEG_03132 [Pneumocystis murina B123]
 gb|EMR08658.1| hypothetical protein PNEG_03132 [Pneumocystis murina B123]
Length=298

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 94/193 (49%), Gaps = 28/193 (15%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQ--HCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KLVL+H   E   ++      L      +Y+PQ  E + +   L +Y ++LS+ ++
Sbjct  115  VNPRKLVLIHSNQETRNNMMTIFKALVSFTNDIYSPQQGEILKIGIGLNSYNLKLSDDII  174

Query  473  SNVLFKKLGDYEIAWVDAEV--------GKTD---SGMlsllplsdaapPHKTVLVGDLK  327
            + + +KKLGDY ++ V  ++         +TD     +L +       P    + VGD+K
Sbjct  175  NTLRWKKLGDYNVSHVIGKLKLCTSSVPNETDLPTLDVLPMNSNLKNIPQFHPLFVGDVK  234

Query  326  LSDFKQFLASKGVQVEFAG-GALRCGEYVTLRK-VGDASQRggaaaaAIQHIILEGPLSE  153
            L+  K+ L  +G   EF G G L C   VT++K VGD              +ILEG +S+
Sbjct  235  LAHVKRLLQEQGHVAEFIGEGMLLCDGLVTVKKIVGDK-------------VILEGGISQ  281

Query  152  EYYTIREYLYSQF  114
            E+Y +R+ +Y   
Sbjct  282  EFYDVRKIVYDSI  294



>gb|KIJ56611.1| hypothetical protein M422DRAFT_22765 [Sphaerobolus stellatus 
SS14]
Length=914

 Score = 74.7 bits (182),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 53/206 (26%), Positives = 97/206 (47%), Gaps = 30/206 (15%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P ++++VH ++EAT+ L + C  ++ +   ++AP + +T  +     ++ + LS+++
Sbjct  701  QVNPRRMIIVHASSEATQSLIEACDAVRAMTKEIFAPALGDTCQIGQHTNSFSISLSDEV  760

Query  476  MSNVLFKKLGDYEIAWVDAEV----------------------GKT-----DSGMlsllp  378
            ++++      D E+ +V   V                      G T     +    +   
Sbjct  761  LASLKMSSFEDNEVGFVVGRVASHATSSIPVLEPAPAAAALLAGPTHVTIGEGVPSANAS  820

Query  377  lsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRgga  201
            L   AP  K+ ++GDLKL+  K  LA  G+  EFAG G L CG   +  +  D +Q    
Sbjct  821  LRPIAPLPKSTMIGDLKLTALKARLAKLGIPAEFAGEGVLVCGAAASQSEPQDLTQTVAV  880

Query  200  aaaAIQHIILEGPLSEEYYTIREYLY  123
              +    +I+EG +SE YYT+R  +Y
Sbjct  881  RKSGRGKVIMEGAVSEVYYTVRNEIY  906



>emb|CDS29353.1| cleavage and polyadenylation [Hymenolepis microstoma]
Length=872

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 49/197 (25%), Positives = 89/197 (45%), Gaps = 33/197 (17%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHCLKHVCPH---VYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +++++  T  A   + +HC   +      ++ P   + ++ T +   Y+ ++ + L+ 
Sbjct  685  PHEVIVIGATQAAVNAVVEHCRSDLNLRKELIHTPSGVDVVNCTKESDIYQARMKDSLVR  744

Query  470  NVLFKKLGDYEIAWVDAEVGKTDS------------------GMlsllplsdaapPHKTV  345
             + F K+ +Y++AWVDA++   D                    +  L P +     H TV
Sbjct  745  RLRFTKIREYDLAWVDADISTGDENNTEGGAIGIISEGVSADNLPVLNPPAHLIEDHSTV  804

Query  344  LVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEG  165
             V + +LSD KQ L   G+Q EF  GAL     V++++                 + LEG
Sbjct  805  FVNEPRLSDMKQLLLEMGLQAEFNSGALVVENCVSIKRTETGK------------MTLEG  852

Query  164  PLSEEYYTIREYLYSQF  114
             +S  Y+T+R+ LY QF
Sbjct  853  VISPTYFTVRDLLYRQF  869



>gb|KIY74198.1| hypothetical protein CYLTODRAFT_433892 [Cylindrobasidium torrendii 
FP15055 ss-10]
Length=894

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 55/210 (26%), Positives = 95/210 (45%), Gaps = 48/210 (23%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KL+LVHG++E T+ L Q C  +K++   ++AP   ETI +   + ++ + +S+ L+
Sbjct  690  VEPRKLILVHGSSEDTDALMQSCSTIKNMTKEIFAPASLETIQLGQKINSFAISISDTLL  749

Query  473  SNVLFKKLGDYEIAWVDAEV-----------GKTDSGMlsllplsdaapPHKT-------  348
             +V   +  D E+ ++   V               +G +       A    +T       
Sbjct  750  GSVQMSRFEDNEVGFITGRVVTHQNTSVPTLESLGTGAVMANSPIAAINARQTTRRILGS  809

Query  347  ---------VLVGDLKLSDFKQFLASKGVQVEFAG-GALRCG-----EYVTLRKVGDASQ  213
                      ++G+LKL+  K  L   G+Q E+AG G L CG     E V++RK G    
Sbjct  810  RPAFPLPSSTMIGELKLTALKARLTDIGLQAEYAGEGVLLCGRNAFAESVSVRKTGAG--  867

Query  212  RggaaaaAIQHIILEGPLSEEYYTIREYLY  123
                       + +EG ++E YY +R+ +Y
Sbjct  868  -----------VTIEGSMNEVYYLVRKEIY  886



>ref|XP_001951701.1| PREDICTED: probable cleavage and polyadenylation specificity 
factor subunit 2 [Acyrthosiphon pisum]
Length=729

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 55/199 (28%), Positives = 97/199 (49%), Gaps = 33/199 (17%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            + P +L+LV G   +T+ +       +   V+ P+I + ++VT++   Y+V+L++ L+S 
Sbjct  540  LKPRRLILVRGNPYSTKVVYNFAKVFIDGKVFTPRIGQCLNVTTESHIYQVRLTDALLSK  599

Query  467  VLFKKLGDYEIAWVDAEV--GKTDSGMlsllplsdaa------------------pPHKT  348
            + FKK  + ++A+++A++     D+ M     +S+                     P KT
Sbjct  600  INFKKGPNGDLAYMNAKLKLNSRDTVMEVDNVVSEKMPRIDDQIFTLEPLAEHEIHPRKT  659

Query  347  VLVGDLKLSDFKQFLASKGVQVEFAGGALR-CGEYVTLRKVGDASQRggaaaaAIQHIIL  171
            V +  LKLSDFKQ L+   +  E + G L  C   V +R+                 +++
Sbjct  660  VFINRLKLSDFKQILSKNNIPCELSKGVLWCCNRTVCVRRNSSGK------------VLM  707

Query  170  EGPLSEEYYTIREYLYSQF  114
            EG +S +YY IR  LYSQF
Sbjct  708  EGIISRQYYYIRSLLYSQF  726



>ref|XP_009170171.1| hypothetical protein T265_06603 [Opisthorchis viverrini]
 gb|KER26072.1| hypothetical protein T265_06603 [Opisthorchis viverrini]
Length=1159

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 58/218 (27%), Positives = 93/218 (43%), Gaps = 54/218 (25%)
 Frame = -2

Query  641   PLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
             P +L+LV  +   TE L  +C   +      V+ P     I+ T +   Y+ ++ + L+S
Sbjct  951   PQELILVGNSRADTEQLAVYCRTVMLLASNLVHIPSACSVINCTKEGDIYQARMKDSLVS  1010

Query  470   NVLFKKLGDYEIAWVDAEVGKTDSG-----------------------------------  396
             ++ F K+ DYE+AWV+A +  TD+                                    
Sbjct  1011  SLRFTKIRDYELAWVEANIDLTDNAPADPDHSESASDNLNLPNASGDDNPPSPLKTRSSL  1070

Query  395   ----MlsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKV  228
                 +  L   +     HKTV V + KLSD KQ L + G+  EF  G L     V +++ 
Sbjct  1071  AADRLPVLGLPTGPVGAHKTVFVNEPKLSDLKQLLLANGLVAEFVSGVLVVDNCVAIKR-  1129

Query  227   GDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
              +A +           ++LEG LS  Y+T+R+ LY QF
Sbjct  1130  SEAGK-----------LLLEGLLSRTYFTVRQVLYQQF  1156



>gb|KJA29848.1| hypothetical protein HYPSUDRAFT_31856 [Hypholoma sublateritium 
FD-334 SS-4]
Length=924

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 57/213 (27%), Positives = 94/213 (44%), Gaps = 48/213 (23%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH    A E L + C  ++ +   +YAPQ+ E+I +     ++ + +S++L
Sbjct  717  QVNPRKMIIVHAPRSAAEALIEACNSIRSMTKDIYAPQVGESIQIGQQTNSFSINISDEL  776

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH-------------------  354
            ++++   +  D EIA+V   V    +  +  L    ++                      
Sbjct  777  LASLKISRFEDNEIAYVRGLVAAHATSTIPTLEPISSSAVQIDPAAPVKPLIPRMLGARP  836

Query  353  -----KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGE---------YVTLRKVGDA  219
                  + ++G+LKL+  K  LAS GVQ E  G G L CG           V +RKVG  
Sbjct  837  QVPLPHSTMIGELKLTALKSRLASVGVQAELIGEGVLICGTATSSESFGGSVAVRKVGKG  896

Query  218  SQRggaaaaAIQHIILEGPLSEEYYTIREYLYS  120
                         I LEG +SE YYT+R  +Y+
Sbjct  897  K------------IELEGNVSEVYYTVRREIYN  917



>ref|XP_008869266.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETW02661.1| hypothetical protein, variant [Aphanomyces invadans]
Length=709

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 70/137 (51%), Gaps = 13/137 (9%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  L+++    +  C  VY PQ  E ID+ SD   YK+ L E L
Sbjct  578  NVKPRKLILVHGTPETTAGLQEYVQSTMEQCEAVYTPQANERIDIESDTTVYKLSLKESL  637

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLV--GDLKLSDFK  312
             S+  F+K+G +++A++++     G T       +        H  +L+  G + L+  K
Sbjct  638  YSSAYFQKVGSHDVAYINSTAEFHGAT------CILDVAEQEYHTPMLLSQGKVTLATLK  691

Query  311  QFLASKGVQVEFAGGAL  261
              LA  G +  F GG L
Sbjct  692  TLLARAGFEANFYGGML  708



>gb|EUB58147.1| putative cleavage and polyadenylation specificity factor subunit 
[Echinococcus granulosus]
Length=886

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 93/204 (46%), Gaps = 40/204 (20%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +++LV  T  A + + +HC   L+     ++ P   + ++ T +   Y+ ++ + L++
Sbjct  692  PHEVILVGATRSAIDAMVEHCRSDLQLKDEVIHTPSGLDVVNCTKEGDIYQARMKDSLVT  751

Query  470  NVLFKKLGDYEIAWVDAEVGKTDS-------------------------GMlsllplsda  366
             + F K+ +YE+AWVDA++ + +                           +  L P S  
Sbjct  752  GLRFTKIREYELAWVDADILEAEENANPTNGLEAGADGEASLVTILASDALPVLAPPSGP  811

Query  365  apPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAI  186
               H TV V + KLSD KQ L ++G+Q EF  G L     V++++               
Sbjct  812  VVDHPTVFVNEPKLSDMKQLLLNQGLQAEFVSGVLVVDNCVSIKRTETG-----------  860

Query  185  QHIILEGPLSEEYYTIREYLYSQF  114
              + LEG +S  Y+ +R+ LY QF
Sbjct  861  -RMTLEGVISPTYFVVRDILYRQF  883



>emb|CDS19808.1| cleavage and polyadenylation [Echinococcus granulosus]
Length=908

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 93/204 (46%), Gaps = 40/204 (20%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +++LV  T  A + + +HC   L+     ++ P   + ++ T +   Y+ ++ + L++
Sbjct  714  PHEVILVGATRSAIDAMVEHCRSDLQLKDEVIHTPSGLDVVNCTKEGDIYQARMKDSLVT  773

Query  470  NVLFKKLGDYEIAWVDAEVGKTDS-------------------------GMlsllplsda  366
             + F K+ +YE+AWVDA++ + +                           +  L P S  
Sbjct  774  GLRFTKIREYELAWVDADILEAEENANPTNGLEAGADGEASLVTILASDALPVLAPPSGP  833

Query  365  apPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAI  186
               H TV V + KLSD KQ L ++G+Q EF  G L     V++++               
Sbjct  834  VVDHPTVFVNEPKLSDMKQLLLNQGLQAEFVSGVLVVDNCVSIKRTETG-----------  882

Query  185  QHIILEGPLSEEYYTIREYLYSQF  114
              + LEG +S  Y+ +R+ LY QF
Sbjct  883  -RMTLEGVISPTYFVVRDILYRQF  905



>gb|KDQ20588.1| hypothetical protein BOTBODRAFT_100390 [Botryobasidium botryosum 
FD-172 SS1]
Length=925

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 55/211 (26%), Positives = 93/211 (44%), Gaps = 47/211 (22%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K++LVH + EATE L   C  ++ +   V+AP   E+I +  +   + + LS++L
Sbjct  719  QVNPRKMILVHASPEATEALLTSCRSIRSMTKDVFAPAAGESITIGQNTTTFAISLSDEL  778

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGM----------------lsllplsdaapPH---  354
            +++V   +  D+E+ ++   V    S                    +     +A  H   
Sbjct  779  LTSVKMSRFEDHEVGYIHGRVTSHPSSTIPILEPASPAAPLAIAPPVSQDPRSAHQHTRP  838

Query  353  -----KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCG--------EYVTLRKVGDAS  216
                 ++ ++GDLKL+  K  L++ G+  EFAG G L C         + V +RK G   
Sbjct  839  IAPLPRSTMIGDLKLTVLKTRLSALGISAEFAGEGVLVCSVNSDEDIQDQVAVRKTGKG-  897

Query  215  QRggaaaaAIQHIILEGPLSEEYYTIREYLY  123
                        ++LEG +   YYTIR  +Y
Sbjct  898  -----------QVMLEGSVCNTYYTIRREIY  917



>emb|CCA69065.1| hypothetical protein PIIN_02923 [Piriformospora indica DSM 11827]
Length=887

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 59/214 (28%), Positives = 96/214 (45%), Gaps = 50/214 (23%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P +L++V  T+EATE L + C  +K +   +Y P++ ETI +  ++  Y + LS+ L
Sbjct  677  QVNPRRLIIVQATSEATESLAEACKAIKSMSAEIYTPRVGETIRIGENMENYTIALSDAL  736

Query  476  MSNVLFKKLGDYEIAWV--------------------------DAEVGKTDSGMlsllpl  375
            M+++      D EIA+V                          D E+ + ++G+ +    
Sbjct  737  MNSLKMATYEDNEIAFVRGRLSNPTSTGIYVLEPPRLGMQRTTDVEMAEKENGVAAAKDS  796

Query  374  sdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRC---------GEYVTLRKVG  225
            S AA   + +++GDLKL+  K  L   G+  EFAG G L C          + V +RK  
Sbjct  797  STAAVIPRAIMIGDLKLTALKIRLNRLGIAAEFAGEGFLVCRSKPIDDDEEDTVAVRKTR  856

Query  224  DASQRggaaaaAIQHIILEGPLSEEYYTIREYLY  123
                R            +EG  S  +Y +RE +Y
Sbjct  857  KGEVR------------VEGDASPLFYMVREEIY  878



>ref|XP_009826610.1| hypothetical protein, variant 4 [Aphanomyces astaci]
 gb|ETV83181.1| hypothetical protein, variant 4 [Aphanomyces astaci]
Length=706

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/137 (34%), Positives = 69/137 (50%), Gaps = 13/137 (9%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV--CPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            +V P KL+LVHGT E T  L+++    +  C  VY P   E ID+ SD   YK+ L E L
Sbjct  573  NVKPRKLILVHGTPETTTELQEYVQTTIEQCEAVYTPHANECIDIESDTTVYKLSLKESL  632

Query  476  MSNVLFKKLGDYEIAWVDAEV---GKTDSGMlsllplsdaapPHKTVLV--GDLKLSDFK  312
             S+  F+K+G +++A+++A     G T       +        H  +L+  G + L+  K
Sbjct  633  YSSAFFQKVGSHDVAYINATAEFHGAT------CIVDVAEQEYHTPMLLSQGKVTLAMLK  686

Query  311  QFLASKGVQVEFAGGAL  261
              LA  G +  F GG L
Sbjct  687  TLLARAGFEANFYGGML  703



>gb|KEP55348.1| cleavage and polyadenylation specificity factor subunit 2 [Rhizoctonia 
solani 123E]
Length=882

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 55/197 (28%), Positives = 91/197 (46%), Gaps = 25/197 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCL--KHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH   EAT+ LK+ CL  K +   ++AP + E++ +      + V LS++L
Sbjct  682  QVNPRKMIIVHSHREATDALKESCLSIKAMTRDIHAPDVGESVQIGQQTNVFTVALSDEL  741

Query  476  MSNVLFKKLGDYEIAWVDAEV-GKTDSGMlsllplsdaapPHK-----------------  351
            +++V   +  D EI +V   V G  +S +  L P    +                     
Sbjct  742  IASVKMSRFEDNEIGFVHGRVTGNANSTVPVLEPTMPVSSTGDAENVSTPDVRPVLSLPW  801

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            + ++GDL+L+  K  L   G+  EF G G L CG     R  G           A   ++
Sbjct  802  STMIGDLRLTALKTRLGVLGIAAEFIGEGVLVCGT----RTSGTLDDVVAVRKTARGQVV  857

Query  173  LEGPLSEEYYTIREYLY  123
            +EG +S+ YYT+R  +Y
Sbjct  858  VEGSISDVYYTVRREVY  874



>gb|EUC66413.1| cleavage and polyadenylation specificity factor subunit 2 [Rhizoctonia 
solani AG-3 Rhs1AP]
Length=882

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 55/197 (28%), Positives = 91/197 (46%), Gaps = 25/197 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCL--KHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH   EAT+ LK+ CL  K +   ++AP + E++ +      + V LS++L
Sbjct  682  QVNPRKMIIVHSHREATDALKESCLSIKAMTRDIHAPDVGESVQIGQQTNVFTVALSDEL  741

Query  476  MSNVLFKKLGDYEIAWVDAEV-GKTDSGMlsllplsdaapPHK-----------------  351
            +++V   +  D EI +V   V G  +S +  L P    +                     
Sbjct  742  IASVKMSRFEDNEIGFVHGRVTGNANSTVPVLEPTMPVSSTGDAENVSTPDVRPVLSLPW  801

Query  350  TVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQHII  174
            + ++GDL+L+  K  L   G+  EF G G L CG     R  G           A   ++
Sbjct  802  STMIGDLRLTALKTRLGVLGIAAEFIGEGVLVCGT----RTSGTLDDVVAVRKTARGQVV  857

Query  173  LEGPLSEEYYTIREYLY  123
            +EG +S+ YYT+R  +Y
Sbjct  858  VEGSISDVYYTVRREVY  874



>ref|XP_005715060.1| Cleavage and polyadenylation specificity factor, 100kDa variant 
[Chondrus crispus]
 emb|CDF35241.1| Cleavage and polyadenylation specificity factor, 100kDa variant 
[Chondrus crispus]
Length=833

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/229 (26%), Positives = 96/229 (42%), Gaps = 63/229 (28%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKH------------------VCPHVYAPQIEETIDV  522
            V P  + LV GT E T HL+Q    +                  V   V AP   ET+++
Sbjct  613  VEPRHVTLVAGTEEETAHLQQFLFSNLYSATNLRSAGKEKNSTDVRSVVVAPARLETVEI  672

Query  521  TSDLCAYKVQLSEKLMSNVLFKKLGDYEIAWVDAEVGKTDSG------------------  396
            TS      V+L + +++ + + ++G  +IA++DA V   ++G                  
Sbjct  673  TSHTFVRAVRLQDAMVAELAWSQVGFSDIAFLDARVDADNNGEGQLILRDPKASVLDHDD  732

Query  395  ----------MlsllplsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGAL-----  261
                         +  ++     H TV VG + L+  K  L+  G++ EFAGGAL     
Sbjct  733  SMEIDHPQVTSNEIRSINVQFAGHPTVFVGTIMLNRLKDVLSKAGMKAEFAGGALCVENA  792

Query  260  RCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
              G  V L+K               Q +++EG LSEEY+++R+ LY + 
Sbjct  793  ETGAVVLLKKTS------------AQQVVMEGALSEEYFSVRDLLYEEL  829



>emb|CDI98145.1| cleavage and polyadenylation [Echinococcus multilocularis]
Length=908

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 93/204 (46%), Gaps = 40/204 (20%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +++LV  T  A + + +HC   L+     ++ P   + ++ T +   Y+ ++ + L++
Sbjct  714  PHEVILVGATRSAIDAMVEHCRSDLQLKDEVIHTPLGLDVVNCTKEGDIYQARMKDSLVT  773

Query  470  NVLFKKLGDYEIAWVDAEVGKTDS-------------------------GMlsllplsda  366
             + F K+ +YE+AWVDA++ + +                           +  L P S  
Sbjct  774  GLRFTKIREYELAWVDADILEAEENANPTNGLEAGADGEASLVTILASDALPVLAPPSGP  833

Query  365  apPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAI  186
               H TV V + KLSD KQ L ++G+Q EF  G L     V++++               
Sbjct  834  VVDHPTVFVNEPKLSDMKQLLLNQGLQAEFVSGVLVVDNCVSIKRTETG-----------  882

Query  185  QHIILEGPLSEEYYTIREYLYSQF  114
              + LEG +S  Y+ +R+ LY QF
Sbjct  883  -RMTLEGVISPTYFVVRDILYRQF  905



>dbj|GAA43367.2| cleavage and polyadenylation specificity factor subunit 2, partial 
[Clonorchis sinensis]
Length=995

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 57/218 (26%), Positives = 91/218 (42%), Gaps = 54/218 (25%)
 Frame = -2

Query  641  PLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            P +L+LV  +   TE L  +C   +      V+ P     I+ T +   Y+ ++ + L+S
Sbjct  672  PQELILVGNSRADTEQLATYCRTVMLLASNLVHTPSACSVINCTKEGDIYQARMKDSLVS  731

Query  470  NVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaap-----------------------  360
            ++ F K+ DYE+AWV+A +  TD+          A+                        
Sbjct  732  SLRFTKIRDYELAWVEANIDLTDNASSDPDHSESASDDLNMPNASGDDNPPSPPKTRSSL  791

Query  359  ----------------PHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKV  228
                             HKTV V + KLSD KQ L + G+  EF  G L     V +++ 
Sbjct  792  AADRLPVLGLPTGPVGAHKTVFVNEPKLSDLKQLLLANGLVAEFVSGVLVVDNCVAIKR-  850

Query  227  GDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
             +A +           ++LEG LS  Y+T+R+ LY Q 
Sbjct  851  SEAGK-----------LLLEGLLSRTYFTVRQVLYQQL  877



>gb|KIP10693.1| hypothetical protein PHLGIDRAFT_33762 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=935

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 52/202 (26%), Positives = 96/202 (48%), Gaps = 25/202 (12%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH  A AT+HL + C  ++ +   ++AP + E+I +     ++ + LS++L
Sbjct  727  QVNPRKMIVVHAPAAATDHLLESCAGIRAMTKDIFAPAVGESIQIGQHTNSFSISLSDEL  786

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH-------------------  354
            ++++   +  D E+A+V   V    +  + +L    ++                      
Sbjct  787  LASLKMSRFEDNEVAYVTGRVANLATSTIPILEPVASSAVRAQAGSAPRARMLGARATRS  846

Query  353  --KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaAIQ  183
              +  +VG+LKL+  K  LA+ GVQ E  G G L CG         DA +   A     +
Sbjct  847  LPQNTMVGELKLTALKTRLATVGVQAELVGEGVLICGAAAKKGSSWDALEDSVAVKKTGK  906

Query  182  -HIILEGPLSEEYYTIREYLYS  120
              + LEG +S+ YY +R+ +Y+
Sbjct  907  GRVELEGAVSDIYYKVRQEVYN  928



>ref|XP_007364154.1| hypothetical protein DICSQDRAFT_135076 [Dichomitus squalens LYAD-421 
SS1]
 gb|EJF62808.1| hypothetical protein DICSQDRAFT_135076 [Dichomitus squalens LYAD-421 
SS1]
Length=943

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 57/209 (27%), Positives = 96/209 (46%), Gaps = 35/209 (17%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K++LVH    AT+ L + C  +K +   +YAP   ETI +     ++ + LS++L
Sbjct  731  QVNPRKMILVHAPQAATDALIESCASIKAMTKEIYAPPQGETIQIGQHTNSFSISLSDEL  790

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH-------------------  354
            ++++   +  D E+A+V   V    S  + +L  +                         
Sbjct  791  LASLKMSRFEDNEVAYVSGRVSSLASSTIPVLEPAAITHFQPASAPHQPLRGRMLGSRPT  850

Query  353  ----KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEY------VTLRKVGDASQRg  207
                ++ ++G+LKL+  K  LAS GVQ E  G G L CG        V L  +GD+    
Sbjct  851  QALPQSTMIGELKLTALKTRLASIGVQAELVGEGVLICGAAAKKGAGVGLDSLGDSVAVR  910

Query  206  gaaaaAIQHIILEGPLSEEYYTIREYLYS  120
              A   ++   +EG +S+ Y+T+R  +YS
Sbjct  911  KTARGRVE---VEGSVSDVYHTVRREVYS  936



>ref|XP_002606625.1| hypothetical protein BRAFLDRAFT_209615 [Branchiostoma floridae]
 gb|EEN62635.1| hypothetical protein BRAFLDRAFT_209615, partial [Branchiostoma 
floridae]
Length=607

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 62/241 (26%), Positives = 98/241 (41%), Gaps = 74/241 (31%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLK---HVCPHVYAPQIEETIDVTSDLCAYKVQLSEK  480
             + P +LV+VHG +E+T  L + C      V   V+ P++ ET+D T +   Y+V+L + 
Sbjct  376  QLKPRQLVIVHGNSESTLLLAEVCRSTAGMVQEKVFTPRLNETVDATMESHIYQVKLKDS  435

Query  479  LMSNVLFKKLG--------------------------------------------DYEIA  432
            L+S++ F K                                              D E+A
Sbjct  436  LVSSLQFYKARDTELAWVDGQLDLTTPTTDTSALLEEGEVQEMEDLEEEQFFKARDTELA  495

Query  431  WVD------------AEVGKTDSGMlsllplsdaapP---HKTVLVGDLKLSDFKQFLAS  297
            WVD            A+    +S        +        H+ V +   +LSD KQ L  
Sbjct  496  WVDGPLLTLPFTCKSAKAAAEESRETVPTLEALPISQIPGHEAVFINKPRLSDIKQVLQK  555

Query  296  KGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQ  117
            +G+Q EF+GG L C   V L++  + S R          I +EG + E+YY +R+ LY Q
Sbjct  556  EGIQAEFSGGVLICNNVVALKR--NESGR----------IGMEGCICEDYYKVRKLLYEQ  603

Query  116  F  114
            +
Sbjct  604  Y  604



>ref|XP_007391806.1| hypothetical protein PHACADRAFT_249539 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM59238.1| hypothetical protein PHACADRAFT_249539 [Phanerochaete carnosa 
HHB-10118-sp]
Length=951

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 52/204 (25%), Positives = 93/204 (46%), Gaps = 27/204 (13%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K+++VH    AT+HL + C  ++ +   +YAP + E++ +     ++ + LS++L
Sbjct  741  QVNPRKMIIVHAPQAATDHLIEACAGIRAMTKDIYAPAVGESVQIGQHTNSFSISLSDEL  800

Query  476  MSNVLFKKLGDYEIAWVDAE--------------VGKTDSGMlsllplsd---------a  366
            ++++   +  D E+A+V                 VG +  G       +           
Sbjct  801  LASLKMSRFEDNEVAYVTGRVSSLATSTIPILESVGSSSVGRAVTARHTARGRILGSRPT  860

Query  365  apPHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaaA  189
                ++ ++G+LKL+  K  LA+ GVQ E  G G L CG         DA Q   A    
Sbjct  861  RALPQSTMIGELKLTALKARLAAVGVQAELVGEGVLICGAAARRGSAPDALQESVAVKKT  920

Query  188  IQ-HIILEGPLSEEYYTIREYLYS  120
             +  + LEG +S+ YY +R  +Y+
Sbjct  921  GRGKLELEGAVSDVYYKVRREVYN  944



>gb|KII61653.1| putative cleavage and polyadenylation specificity factor subunit 
2 [Thelohanellus kitauei]
Length=696

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 46/181 (25%), Positives = 88/181 (49%), Gaps = 15/181 (8%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            ++P  L++++G+ E  E LK + +     + + P++ + I +  D    +V   E L S+
Sbjct  525  ISPRNLIVINGSQEDNEKLKNYAISQQI-NTFTPEVIKKIRIVDDKKLLQVSFQEPLASS  583

Query  467  VLFKKLGDYEIAWVDAEVGK---TDSGMlsllplsdaapPHKTVLVGDLKLSDFKQFLAS  297
            + F +   ++++W+D  + K   +++     L  ++    H ++ + ++KLS+  Q L  
Sbjct  584  LNFVECKGHQVSWIDFMIKKSSRSNTATSFALQCTNDNATHSSLFLNEIKLSELSQLLIQ  643

Query  296  KGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQ  117
             G  V F  G L       L K G  + R   +      I L G LS+EY+ IR+ +YSQ
Sbjct  644  HGYNVRFKNGIL-------LYKNGKVAIRKKKSG----DISLSGTLSKEYFEIRKLIYSQ  692

Query  116  F  114
             
Sbjct  693  L  693



>ref|XP_007268417.1| cleavage and polyadenylation specificity factor subunit [Fomitiporia 
mediterranea MF3/22]
 gb|EJD01140.1| cleavage and polyadenylation specificity factor subunit [Fomitiporia 
mediterranea MF3/22]
Length=922

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 53/216 (25%), Positives = 90/216 (42%), Gaps = 52/216 (24%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
            HV P KL++VH +++  + L + C  ++ +   +YAP I E + +     +Y + LSE+L
Sbjct  711  HVNPRKLIIVHSSSDGAQSLIEACGAVRALTKEIYAPDIGEQVQIGQHTNSYSISLSEEL  770

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH-------------------  354
            +++V      D E+ ++   +    S  + +L                            
Sbjct  771  LASVRMSNFEDNEVGFIQGCIASLASSTIPILEPVSNLTSRLEDVPMESEQLVKPARLGS  830

Query  353  -------KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRC-----------GEYVTLRK  231
                   ++ ++GDLKL+  K  L+  GV  EFAG G L C              V +RK
Sbjct  831  RPATKLPRSTMIGDLKLTALKARLSKMGVHTEFAGEGVLLCRNSSSDEDVSTESIVAVRK  890

Query  230  VGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLY  123
              D              + LEG ++E YYT+R  +Y
Sbjct  891  KADGK------------VELEGTVTEVYYTVRRAIY  914



>gb|KHN82608.1| putative cleavage and polyadenylation specificity factor subunit 
2 [Toxocara canis]
Length=841

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/83 (36%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPH--VYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG+A AT HL Q+  +  C    ++ P++ E +D T +   Y+V LS+ L
Sbjct  618  QIKPKQLIIVHGSAAATRHLAQYAAESGCVQGKIFTPRLGEIVDATIESHIYQVTLSDAL  677

Query  476  MSNVLFKKLGDYEIAWVDAEVGK  408
            MS+++F+ + D E++W+DA + K
Sbjct  678  MSSLIFQTVKDAELSWLDARISK  700


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 42/81 (52%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+ V V D KLSD KQ L + G   EF+ G L      ++R+  + + R         H+
Sbjct  770  HQAVFVNDPKLSDMKQLLMANGFHAEFSSGVLYINNVASIRR--NEAGRF--------HV  819

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG   E+YY IR+ +Y+QF
Sbjct  820  --EGCACEDYYKIRDIVYAQF  838



>ref|XP_002129804.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Ciona intestinalis]
Length=784

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+T  + +L+LSDFKQ L  +G Q EF GG L C   + +R+                HI
Sbjct  713  HQTCFINELRLSDFKQVLTKEGYQAEFIGGVLVCNNMLAIRRNQQG------------HI  760

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             LEG L+EEYY IR+ LY Q+
Sbjct  761  DLEGTLTEEYYAIRDLLYQQY  781



>ref|XP_004352034.1| beta-lactamase domain-containing protein [Dictyostelium fasciculatum]
 gb|EGG15314.1| beta-lactamase domain-containing protein [Dictyostelium fasciculatum]
Length=768

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 94/222 (42%), Gaps = 61/222 (27%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLMS  471
            +AP  L+LV G  +  + L     K +    +++P I   ID+TS       +  + L+ 
Sbjct  561  IAPTNLILVRGNQQCVDELLDFAKKSLRVKGLFSPAISNQIDLTS-------ETHDSLIK  613

Query  470  NVLFKKLGDYEIAWVDAEV--------GKTDSGMlsll----------------------  381
            ++   KL DYEIA+++A+V        G T++     +                      
Sbjct  614  SLNTSKLMDYEIAYIEAKVHIEDIILNGATNAATPLAITSPTTSTAITTTNDSKALTVVQ  673

Query  380  ------------plsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTL  237
                           + +  H    VGD+KLS+FK  L  +G QV+F  G L C   V L
Sbjct  674  PKEKKIIPLLDIMPVEESKGHNVSFVGDVKLSEFKDVLTREGFQVQFDKGILSCNGLVYL  733

Query  236  -RKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQF  114
             R+  D +            I ++G +SEEYY ++E LYSQF
Sbjct  734  WREEVDGN----------SCINIDGVMSEEYYLVKELLYSQF  765



>ref|XP_009021832.1| hypothetical protein HELRODRAFT_113444 [Helobdella robusta]
 gb|ESO00058.1| hypothetical protein HELRODRAFT_113444 [Helobdella robusta]
Length=772

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 90/231 (39%), Gaps = 62/231 (27%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCP--HVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P +L+LV G  + T  L      HV     V  P+  E +D T+D   Y+V+L + ++
Sbjct  554  VKPRQLILVRGNKKNTTRLVDEWQSHVMQGGRVLIPRTNEVLDATTDRHIYQVKLKDSVV  613

Query  473  SNVLF----------------------------------KKLGDYEIAWVDAEVGKTDSG  396
            S + F                                  K+  D +   +D + G  D  
Sbjct  614  SALKFSHVKDVEITWLDAQLDMTKYQSDTTTTSINIKKEKRRDDSDNRDMDVDDGSNDPM  673

Query  395  Mlsllp--------------lsdaapPHKTVLVGDLKLSDFKQFLASKGVQVEFAGGALR  258
             +                    +    H  + +   +LSDFKQ++ S+GVQ E +GG L 
Sbjct  674  DVDDDGRDVDDDVMPALVPLAPNLVEKHSAIFINIPRLSDFKQYVISQGVQAEMSGGVLI  733

Query  257  CGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYSQFYSL  105
            C   V ++K              +  I+LEG + ++YY +R+ LY QF  L
Sbjct  734  CNNKVAVKK------------NELGMILLEGTVCDDYYKVRQCLYEQFIIL  772



>gb|ERG80852.1| putative cleavage and polyadenylation specificity factor subunit 
2 [Ascaris suum]
Length=841

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/83 (37%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P +LV+VHG+A AT HL Q+  +   V   ++ P++ E +D T +   Y+V LS+ L
Sbjct  622  QVKPKQLVIVHGSAAATRHLAQYASETGIVQGKIFTPRLGEIVDATIESHIYQVTLSDAL  681

Query  476  MSNVLFKKLGDYEIAWVDAEVGK  408
            MS+++F+ + D E++W+DA + +
Sbjct  682  MSSLIFQTVKDAELSWLDARIAR  704


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 43/81 (53%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+ V V D KLSD KQ L + G   EF+ G L      ++R+  + + R         H+
Sbjct  770  HQAVFVNDPKLSDMKQLLMANGFHAEFSSGVLYINNVASIRR--NEAGRF--------HV  819

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG  SE+YY IR+ +Y+QF
Sbjct  820  --EGCASEDYYKIRDIVYAQF  838



>gb|KIL00069.1| hypothetical protein PAXRUDRAFT_822086 [Paxillus rubicundulus 
Ve08.2h10]
Length=925

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 53/204 (26%), Positives = 94/204 (46%), Gaps = 29/204 (14%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K++LVH + +A + L + C  ++ +   +YAP+  E++ +     ++ + LS++L
Sbjct  715  QVNPRKMILVHASGDAAQVLIESCGQIRAMTKDIYAPEAGESVQIGQQTNSFSISLSDEL  774

Query  476  MSNVLFKKLGDYEIAWV------------------------DAEVGKTDSGMlsllplsd  369
            ++ +   +  D E+ +V                        DA V +TD     +L    
Sbjct  775  LNTLKMSRFEDNEVGYVTGRVVNHFSSTIPVLEPSASSVPADANV-RTDVSRNRVLGSRL  833

Query  368  aapPHKTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCGEYVTLRKVGDASQRggaaaa  192
            A P  ++ ++G+LKL+  K  LAS G+  E  G G L CG      +  D  +   A   
Sbjct  834  AQPLPRSTMIGELKLTALKARLASIGIPSELIGEGVLICGAGARRHQSADNIEETVAVRK  893

Query  191  AIQ-HIILEGPLSEEYYTIREYLY  123
              +  I LEG +S  YY +R+ +Y
Sbjct  894  TARGKIELEGNVSNVYYAVRKEIY  917



>ref|XP_005986658.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Latimeria chalumnae]
Length=782

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 45/81 (56%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H +V + + +LSDFKQ L  +G+Q EFAGG L C   V +R+                 I
Sbjct  711  HHSVFINEPRLSDFKQVLLREGIQAEFAGGVLICNNIVAVRRTEAG------------RI  758

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             LEGP+ E+YY IR+ LY Q+
Sbjct  759  GLEGPVCEDYYKIRDLLYRQY  779


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 54/93 (58%), Gaps = 10/93 (11%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCL----KHVCPHVYAPQIEETIDVTSDLCAYKVQLSE  483
             + P +LV+VHG  +A++ L + C     K +   VY P++ ET+D TS+   Y+V+L E
Sbjct  555  QMKPRQLVIVHGPPDASQDLAEACRAFGGKDI--KVYTPKLLETVDATSETHIYQVRLKE  612

Query  482  KLMSNVLFKKLGDYEIAWVDA----EVGKTDSG  396
             L+S++ F K  D E+AW+D      V K D G
Sbjct  613  SLVSSLQFCKARDAELAWIDGLLDMRVSKVDLG  645



>ref|XP_011395741.1| Cleavage and polyadenylation specificity factor subunit 2 [Auxenochlorella 
protothecoides]
 gb|KFM22875.1| Cleavage and polyadenylation specificity factor subunit 2 [Auxenochlorella 
protothecoides]
Length=684

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 49/187 (26%), Positives = 89/187 (48%), Gaps = 21/187 (11%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCP---HVYAP-QIEETIDVTSDLCA--YKVQL  489
            H A L         +A E LK+  +  + P    ++ P    E +D+    CA   +V++
Sbjct  510  HCALLGRAQTESGRQALETLKRQMVDDLAPLHGKIHGPLSPGENLDIP---CAPSVRVEM  566

Query  488  SEKLMSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPHKTVLVGDLKLSDFKQ  309
              +L++++    +   ++AW+ A     D G+L              V +GD+KLS+ ++
Sbjct  567  EGRLVASLETHAVSGCKLAWLRARRSAADPGLLEPAEDEAQHATLGGVFIGDVKLSEVRK  626

Query  308  FLASKGVQVEFAGGALRC-GEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYYTIRE  132
             L    +  EF+GGAL C G  V  R  G+ +            + LEGPLSE+Y+ +++
Sbjct  627  ALLKASIPAEFSGGALYCEGPLVIRRSEGEGAG-----------LSLEGPLSEQYHRVQQ  675

Query  131  YLYSQFY  111
             +Y+Q++
Sbjct  676  VIYAQYH  682



>ref|XP_006680263.1| hypothetical protein BATDEDRAFT_12823 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79032.1| hypothetical protein BATDEDRAFT_12823 [Batrachochytrium dendrobatidis 
JAM81]
Length=719

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 87/187 (47%), Gaps = 30/187 (16%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             VAP KL+ VHG   +T    ++C  +  +   VY P   E ++V+S    ++V L++ L
Sbjct  548  QVAPRKLLFVHGDKASTMAFAEYCRTNESLTNEVYDPVQGECVNVSSATNLFRVVLTDTL  607

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDS------GMlsllplsdaapPHKTVLVGDLKLSDF  315
            M         +Y ++++   +   DS       ML ++P+         ++VG+ KLS  
Sbjct  608  MD--------EYSLSYITGVIKLQDSVTGGTRAMLEVVPVETQLTRQHVMVVGEAKLSQV  659

Query  314  KQFLASKGVQVEFAGGALRCGEYVTL--RKVGDASQRggaaaaAIQHIILEGPLSEEYYT  141
            ++ L S+G +  FA G L   E   L  R   D S            + LEG +S +YY 
Sbjct  660  RKVLDSQGFRTAFASGVLVVNEGKALIKRSGTDGS------------LALEGSISRDYYK  707

Query  140  IREYLYS  120
            IRE LYS
Sbjct  708  IRELLYS  714



>ref|XP_007255534.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2 [Astyanax mexicanus]
Length=787

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 8/93 (9%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHVCPH---VYAPQIEETIDVTSDLCAYKVQLSEK  480
             + P +LV+VHG  EA++ L   C K  C     VY P+++ET+D TS+   Y+V+L + 
Sbjct  556  QMKPRQLVIVHGPPEASQDLADSC-KAFCGKDIKVYTPKLQETVDATSETHIYQVRLKDS  614

Query  479  LMSNVLFKKLGDYEIAWVDA----EVGKTDSGM  393
            L+S++ F K  D E+AW+D      V K D+G+
Sbjct  615  LVSSLQFCKARDTELAWIDGVLDMRVVKVDTGV  647


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 42/81 (52%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+ V + + +LSDFKQ L  +G+Q EF GG L C   V +R+                 I
Sbjct  716  HQAVFINEPRLSDFKQVLLREGIQAEFVGGVLVCNNLVAVRRTEAG------------RI  763

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             LEG   E+YY IRE LY Q+
Sbjct  764  GLEGCQCEDYYRIRELLYQQY  784



>ref|XP_008035425.1| hypothetical protein TRAVEDRAFT_162694 [Trametes versicolor FP-101664 
SS1]
 gb|EIW61467.1| hypothetical protein TRAVEDRAFT_162694 [Trametes versicolor FP-101664 
SS1]
Length=943

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 51/216 (24%), Positives = 95/216 (44%), Gaps = 51/216 (24%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             V P K++L+H    AT+ L + C  ++ +   +YAP   ET+ +     ++ + LS++L
Sbjct  733  QVNPRKMILIHAPQAATDALIESCANIRAMTKEIYAPAQGETVQIGQQTNSFSISLSDEL  792

Query  476  MSNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH-------------------  354
            ++++   +  D E+ +V   +    + M+ +L  + +A                      
Sbjct  793  LASIKMSRFEDNEVGYVAGRIASLATSMIPVLQPASSASLQTQAASLQPVQVRMLGSRPK  852

Query  353  ----KTVLVGDLKLSDFKQFLASKGVQVEFAG-GALRCG-------------EYVTLRKV  228
                ++ ++G+LKL+  K  LA  GVQ E  G G L CG             + V +RK 
Sbjct  853  QPLPQSTMIGELKLTSLKARLAQVGVQAELVGEGVLICGAAAKKGASADALEDSVAVRKT  912

Query  227  GDASQRggaaaaAIQHIILEGPLSEEYYTIREYLYS  120
            G               + LEG +S+ YY +R+ +Y+
Sbjct  913  GRG------------RVELEGSISDIYYKVRKEIYA  936



>emb|CCG81055.1| Cleavage factor two Cft2/polyadenylation factor CPSF-73 [Taphrina 
deformans PYCC 5710]
Length=789

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 48/190 (25%), Positives = 88/190 (46%), Gaps = 24/190 (13%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHC--LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            V P KLV++HGTA   E +K  C  +K     +  P++  +++V+ D  A+ V+LS+   
Sbjct  606  VNPRKLVIIHGTAADKEEMKSACEKMKAFTKAIIVPELRVSVEVSLDTNAFDVRLSDAFS  665

Query  473  SNVLFKKLGDYEIAWVDAEVGKTDSGMlsllplsdaapPH---------KTVLVGDLKLS  321
            +++ ++KL +  +A V  ++           P+ D              + + VGD++L+
Sbjct  666  ASLHWQKLYEQTVAHVTGKLIPQSEAESKEPPVLDVLASKEDFDNAPRIQALFVGDIRLA  725

Query  320  DFKQFLASKGVQVEF-AGGALRCGEYVTLRKVGDASQRggaaaaAIQHIILEGPLSEEYY  144
            D ++ L  KG   E   GG L C   V++ K                 ++LEG  ++ +Y
Sbjct  726  DLRRLLIEKGHSAELRGGGVLFCDGCVSVTKASAG------------EVLLEGLGTDHFY  773

Query  143  TIREYLYSQF  114
             +RE +Y   
Sbjct  774  GVRESVYQSL  783



>emb|CAG03550.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=765

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H++V + + +LSDFKQ L  +G+Q EF GG L C   V +R+                 I
Sbjct  694  HQSVFINEPRLSDFKQVLLREGIQAEFVGGVLVCNNMVAVRRTEAG------------RI  741

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             LEG L E+YY IRE LY Q+
Sbjct  742  SLEGCLCEDYYKIRELLYQQY  762


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 9/93 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEK  480
             + P +LV+VHG  EA+  L + C    K +   VY P+++ETID TS+   Y+V+L + 
Sbjct  534  QMKPRQLVIVHGPPEASLDLAESCKAFSKDI--KVYTPKLQETIDATSETHIYQVRLKDS  591

Query  479  LMSNVLFKKLGDYEIAWVDA----EVGKTDSGM  393
            L+S++ F K  D E+AW+D      V K D+G+
Sbjct  592  LVSSLQFCKAKDTELAWIDGVLDMRVVKVDTGV  624



>ref|XP_004996313.1| hypothetical protein PTSG_02804 [Salpingoeca rosetta]
 gb|EGD82130.1| hypothetical protein PTSG_02804 [Salpingoeca rosetta]
Length=630

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 71/162 (44%), Gaps = 35/162 (22%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKHV-CPHVYAPQIEETIDVTSDLCAYKVQLSEKLM  474
            HV P  LVLV G    T+   + C   +   ++  P     +++TS    ++V+L E L+
Sbjct  468  HVKPRNLVLVQGPPAETKTFAEFCQSKLGIENIVTPAFGRPVEITSGRNIFQVKLREALV  527

Query  473  SNVLFKKLGDYEIAWVDAEVGK------------------------TDSGMlsllplsda  366
            S +  ++ GDYE+AWVD  + K                         D+G L+     DA
Sbjct  528  SALDLRRAGDYEVAWVDGVMAKGIKPAAPEGEGGDGEGGNGEGGEDADAGSLTSNIDMDA  587

Query  365  ----------apPHKTVLVGDLKLSDFKQFLASKGVQVEFAG  270
                        PH  V VGDL+LSDFK+ L  +G +  F+ 
Sbjct  588  GVPELGVDEEPEPHDVVFVGDLRLSDFKRLLIDEGYEPPFSS  629



>gb|EJW84982.1| cleavage and polyadenylation specificity factor subunit 2 [Wuchereria 
bancrofti]
Length=809

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG++ AT HL Q+  ++  V   ++ P++ E +D T +   Y+V LS+ +
Sbjct  589  QIKPKQLIIVHGSSAATRHLAQYAQQNGIVQGKIFTPRLGEIVDATIESHIYQVTLSDAV  648

Query  476  MSNVLFKKLGDYEIAWVDAEV  414
            MS+++F+ + D E++W+DA +
Sbjct  649  MSSLIFQTVKDAELSWLDARI  669


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+ V V D KLSD KQ LAS G + EF+ G L      ++R+  + + R         H+
Sbjct  738  HQAVFVNDPKLSDMKQLLASNGFRAEFSSGVLYINNIASIRR--NEAGRF--------HV  787

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG   E+YY IR+ +Y+QF
Sbjct  788  --EGYACEDYYKIRDIVYAQF  806



>ref|XP_005538034.1| cleavage and polyadenylation specific factor 2, 100kD subunit 
[Cyanidioschyzon merolae strain 10D]
 dbj|BAM81998.1| cleavage and polyadenylation specific factor 2, 100kD subunit 
[Cyanidioschyzon merolae strain 10D]
Length=884

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/82 (32%), Positives = 51/82 (62%), Gaps = 1/82 (1%)
 Frame = -2

Query  647  VAPLKLVLVHGTAEATEHLKQHCLKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEKLMSN  468
            +AP +++++HG+   T  L ++  K     +YAP+  E +DV+SD   Y+++L + L+  
Sbjct  659  MAPQRVIIIHGSERETAALTEYLGKKNFTRLYAPRAREMVDVSSDTSVYRIKLDDSLLRR  718

Query  467  VLFKKLGDYEIAWVDAEVGKTD  402
              ++++ DYE+AW D  + +TD
Sbjct  719  CFWRRMQDYELAWFDGYI-QTD  739


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 34/90 (38%), Positives = 47/90 (52%), Gaps = 20/90 (22%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGAL-----RCGEYVTLRKVGDASQRggaaaa  192
            H  V VGDL+LSD K+ +    +  EFAGGAL     R    V +RK             
Sbjct  809  HLNVFVGDLRLSDLKEIMTKSLMPAEFAGGALCVENDRPPSIVLVRKR------------  856

Query  191  AIQH-IILEGPLSEEYYTIREYLYSQFYSL  105
              QH +++EG LS EY+ +R+ +YSQ+  L
Sbjct  857  --QHDLVIEGSLSAEYFDVRDLVYSQYMIL  884



>ref|XP_001895540.1| cleavage and polyadenylation specificity factor [Brugia malayi]
 emb|CDQ03156.1| Protein BM-CPSF-2 [Brugia malayi]
Length=831

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG++ AT HL Q+  ++  V   ++ P++ E +D T +   Y+V LS+ +
Sbjct  611  QIKPKQLIIVHGSSAATRHLAQYAQQNGIVQGKIFTPRLGEIVDATIESHIYQVTLSDAV  670

Query  476  MSNVLFKKLGDYEIAWVDAEV  414
            MS+++F+ + D E++W+DA +
Sbjct  671  MSSLIFQTVKDAELSWLDARI  691


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+ V V D KLSD KQ LAS G + EF+ G L      ++R+  + + R         H+
Sbjct  760  HQAVFVNDPKLSDMKQLLASNGFRAEFSSGVLYINNIASIRR--NEAGRF--------HV  809

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG   E+YY IR+ +Y+QF
Sbjct  810  --EGCACEDYYKIRDIVYAQF  828



>ref|XP_003144223.1| cleavage and polyadenylation specificity factor subunit 2 [Loa 
loa]
Length=837

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG++ AT HL Q+  ++  V   ++ P++ E +D T +   Y+V LS+ +
Sbjct  619  QIKPKQLIIVHGSSAATRHLAQYAQQNGIVQGKIFTPRLGEIVDATIESHIYQVTLSDAV  678

Query  476  MSNVLFKKLGDYEIAWVDAEV  414
            MS+++F+ + D E++W+DA +
Sbjct  679  MSSLIFQTVKDAELSWLDARI  699


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+TV V D KLSD KQ LAS G + EF+ G L      ++R+  + + R         H+
Sbjct  766  HQTVFVNDPKLSDVKQLLASNGFRAEFSSGILYINNIASIRR--NEAGRF--------HV  815

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG   E+YY IR+ +Y+QF
Sbjct  816  --EGCACEDYYKIRDIVYAQF  834



>gb|EFO19846.2| cleavage and polyadenylation specificity factor subunit 2 [Loa 
loa]
Length=828

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 54/81 (67%), Gaps = 2/81 (2%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHCLKH--VCPHVYAPQIEETIDVTSDLCAYKVQLSEKL  477
             + P +L++VHG++ AT HL Q+  ++  V   ++ P++ E +D T +   Y+V LS+ +
Sbjct  610  QIKPKQLIIVHGSSAATRHLAQYAQQNGIVQGKIFTPRLGEIVDATIESHIYQVTLSDAV  669

Query  476  MSNVLFKKLGDYEIAWVDAEV  414
            MS+++F+ + D E++W+DA +
Sbjct  670  MSSLIFQTVKDAELSWLDARI  690


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 32/81 (40%), Positives = 45/81 (56%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H+TV V D KLSD KQ LAS G + EF+ G L      ++R+  + + R         H+
Sbjct  757  HQTVFVNDPKLSDVKQLLASNGFRAEFSSGILYINNIASIRR--NEAGRF--------HV  806

Query  176  ILEGPLSEEYYTIREYLYSQF  114
              EG   E+YY IR+ +Y+QF
Sbjct  807  --EGCACEDYYKIRDIVYAQF  825



>ref|XP_003971833.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 
2-like [Takifugu rubripes]
Length=787

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -2

Query  356  HKTVLVGDLKLSDFKQFLASKGVQVEFAGGALRCGEYVTLRKVGDASQRggaaaaAIQHI  177
            H++V + + +LSDFKQ L  +G+Q EF GG L C   V +R+                 I
Sbjct  716  HQSVFINEPRLSDFKQVLLREGIQAEFVGGVLVCNNMVAVRRTEAG------------RI  763

Query  176  ILEGPLSEEYYTIREYLYSQF  114
             LEG L E+YY IRE LY Q+
Sbjct  764  GLEGCLCEDYYKIRELLYQQY  784


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 56/93 (60%), Gaps = 9/93 (10%)
 Frame = -2

Query  650  HVAPLKLVLVHGTAEATEHLKQHC---LKHVCPHVYAPQIEETIDVTSDLCAYKVQLSEK  480
             + P +LV+VHG  EA+  L + C    K +   VY P+++ETID TS+   Y+V+L + 
Sbjct  556  QMKPRQLVIVHGPPEASLDLAESCKAFSKDI--KVYTPKLQETIDATSETHIYQVRLKDS  613

Query  479  LMSNVLFKKLGDYEIAWVDA----EVGKTDSGM  393
            L+S++ F K  D E+AW+D      V K D+G+
Sbjct  614  LVSSLQFCKAKDTELAWIDGVLDMRVVKVDTGV  646



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1001432574250