BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMSF030A14

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802845.1|  PREDICTED: ras-related protein Rab11D              257   2e-82   Nicotiana sylvestris
sp|Q40522.1|RB11D_TOBAC  RecName: Full=Ras-related protein Rab11D       256   6e-82   Nicotiana tabacum [American tobacco]
ref|XP_009591756.1|  PREDICTED: ras-related protein Rab11D              256   8e-82   Nicotiana tomentosiformis
ref|XP_006353216.1|  PREDICTED: ras-related protein Rab11D-like         254   4e-81   Solanum tuberosum [potatoes]
ref|XP_004250110.1|  PREDICTED: ras-related protein Rab11D              254   6e-81   
ref|XP_009620681.1|  PREDICTED: ras-related protein Rab11D-like         252   3e-80   Nicotiana tomentosiformis
ref|XP_009798472.1|  PREDICTED: ras-related protein Rab11D-like         252   3e-80   Nicotiana sylvestris
sp|Q40520.1|RB11C_TOBAC  RecName: Full=Ras-related protein Rab11C       251   8e-80   Nicotiana tabacum [American tobacco]
ref|XP_008381984.1|  PREDICTED: ras-related protein Rab11D              250   2e-79   
ref|XP_011100043.1|  PREDICTED: ras-related protein Rab11D              250   2e-79   Sesamum indicum [beniseed]
ref|XP_011097540.1|  PREDICTED: ras-related protein Rab11D-like         249   5e-79   Sesamum indicum [beniseed]
gb|EPS65006.1|  hypothetical protein M569_09770                         248   1e-78   Genlisea aurea
emb|CDP01498.1|  unnamed protein product                                248   2e-78   Coffea canephora [robusta coffee]
ref|XP_006346741.1|  PREDICTED: ras-related protein Rab11D-like         246   4e-78   Solanum tuberosum [potatoes]
ref|XP_006404948.1|  hypothetical protein EUTSA_v10000315mg             246   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010319241.1|  PREDICTED: ras-related protein Rab11D-like         245   2e-77   Solanum lycopersicum
ref|XP_007047879.1|  RAB GTPase A4A                                     244   3e-77   
ref|XP_004288173.1|  PREDICTED: ras-related protein Rab11D              244   4e-77   Fragaria vesca subsp. vesca
ref|XP_010106271.1|  Ras-related protein Rab11D                         243   9e-77   Morus notabilis
emb|CDX81274.1|  BnaC09g06850D                                          243   2e-76   
ref|XP_009112174.1|  PREDICTED: ras-related protein RABA4a              242   2e-76   Brassica rapa
gb|KJB44099.1|  hypothetical protein B456_007G234300                    242   3e-76   Gossypium raimondii
ref|XP_006394054.1|  hypothetical protein EUTSA_v10004873mg             242   3e-76   Eutrema salsugineum [saltwater cress]
gb|KHN29041.1|  Ras-related protein Rab11A                              242   3e-76   Glycine soja [wild soybean]
gb|KHG10894.1|  Ras-related protein Rab11A                              242   3e-76   Gossypium arboreum [tree cotton]
ref|XP_006426348.1|  hypothetical protein CICLE_v10026427mg             242   4e-76   Citrus clementina [clementine]
ref|XP_002273530.1|  PREDICTED: ras-related protein Rab11D              241   4e-76   Vitis vinifera
gb|KHG10895.1|  Ras-related protein Rab11A                              242   4e-76   Gossypium arboreum [tree cotton]
sp|Q40191.1|RB11A_LOTJA  RecName: Full=Ras-related protein Rab11A...    241   5e-76   Lotus japonicus
ref|XP_008440577.1|  PREDICTED: ras-related protein Rab11A              241   6e-76   
dbj|BAA02110.1|  GTP-binding protein                                    241   7e-76   Pisum sativum [garden pea]
ref|XP_007159716.1|  hypothetical protein PHAVU_002G261400g             241   8e-76   Phaseolus vulgaris [French bean]
gb|KFK28209.1|  hypothetical protein AALP_AA8G486600                    241   9e-76   Arabis alpina [alpine rockcress]
ref|XP_003525046.1|  PREDICTED: ras-related protein Rab11A              241   9e-76   
gb|AAB97114.1|  small GTP-binding protein                               241   9e-76   Glycine max [soybeans]
ref|XP_007205846.1|  hypothetical protein PRUPE_ppa011070mg             240   1e-75   Prunus persica
ref|NP_201330.1|  RAB GTPase homolog A4A                                240   1e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344449.1|  PREDICTED: ras-related protein Rab11D              240   1e-75   Pyrus x bretschneideri [bai li]
ref|XP_004502410.1|  PREDICTED: ras-related protein Rab11A-like         240   1e-75   Cicer arietinum [garbanzo]
ref|XP_004143457.1|  PREDICTED: ras-related protein Rab11A-like         240   2e-75   Cucumis sativus [cucumbers]
ref|XP_006281052.1|  hypothetical protein CARUB_v10027070mg             240   2e-75   Capsella rubella
ref|XP_008235004.1|  PREDICTED: ras-related protein Rab11A              240   2e-75   Prunus mume [ume]
ref|XP_010267206.1|  PREDICTED: ras-related protein Rab11A              240   2e-75   Nelumbo nucifera [Indian lotus]
gb|KJB44100.1|  hypothetical protein B456_007G234300                    240   3e-75   Gossypium raimondii
gb|ACJ84079.1|  unknown                                                 239   3e-75   Medicago truncatula
gb|KEH20797.1|  RAB GTPase-like protein A1D                             239   3e-75   Medicago truncatula
ref|XP_010680988.1|  PREDICTED: ras-related protein Rab11D              239   5e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003552040.1|  PREDICTED: ras-related protein Rab11A-like         239   5e-75   Glycine max [soybeans]
ref|XP_010027921.1|  PREDICTED: ras-related protein Rab11A              239   5e-75   Eucalyptus grandis [rose gum]
ref|XP_011022819.1|  PREDICTED: ras-related protein Rab11D              239   5e-75   Populus euphratica
ref|XP_006466254.1|  PREDICTED: ras-related protein Rab11A-like         238   6e-75   Citrus sinensis [apfelsine]
ref|XP_004504100.1|  PREDICTED: ras-related protein Rab11A-like         238   8e-75   Cicer arietinum [garbanzo]
ref|XP_002864949.1|  hypothetical protein ARALYDRAFT_919858             238   8e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_010484385.1|  PREDICTED: ras-related protein RABA4a-like         238   1e-74   Camelina sativa [gold-of-pleasure]
gb|ACU16457.1|  unknown                                                 238   1e-74   Glycine max [soybeans]
ref|XP_002310552.1|  GTP-BINDING protein 3                              238   1e-74   Populus trichocarpa [western balsam poplar]
gb|AFK49375.1|  unknown                                                 237   2e-74   Medicago truncatula
ref|XP_009129562.1|  PREDICTED: ras-related protein RABA4b              237   2e-74   Brassica rapa
ref|XP_002531672.1|  protein with unknown function                      237   2e-74   Ricinus communis
ref|XP_010450968.1|  PREDICTED: ras-related protein RABA4b-like         235   2e-74   
ref|XP_002866902.1|  hypothetical protein ARALYDRAFT_490786             237   3e-74   
ref|XP_006426349.1|  hypothetical protein CICLE_v10026427mg             235   3e-74   
ref|XP_010463230.1|  PREDICTED: ras-related protein RABA4a-like         236   4e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006284416.1|  hypothetical protein CARUB_v10005586mg             237   5e-74   
ref|XP_010523299.1|  PREDICTED: ras-related protein RABA4a-like         236   5e-74   Tarenaya hassleriana [spider flower]
gb|KDP29718.1|  hypothetical protein JCGZ_18653                         236   9e-74   Jatropha curcas
ref|XP_010431983.1|  PREDICTED: ras-related protein RABA4b-like         236   9e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010446581.1|  PREDICTED: ras-related protein RABA4b-like         235   1e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010519373.1|  PREDICTED: ras-related protein RABA4a              235   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_010437126.1|  PREDICTED: ras-related protein RABA4b              235   1e-73   Camelina sativa [gold-of-pleasure]
gb|KJB40355.1|  hypothetical protein B456_007G060000                    235   2e-73   Gossypium raimondii
ref|XP_003601931.1|  GTP-binding protein                                234   2e-73   Medicago truncatula
ref|XP_007163663.1|  hypothetical protein PHAVU_001G253300g             234   2e-73   Phaseolus vulgaris [French bean]
gb|KFK30576.1|  hypothetical protein AALP_AA7G279800                    234   2e-73   Arabis alpina [alpine rockcress]
ref|NP_001237375.1|  uncharacterized protein LOC100527786               234   3e-73   
gb|KHN44351.1|  Ras-related protein Rab11A                              234   4e-73   Glycine soja [wild soybean]
ref|XP_006827843.1|  hypothetical protein AMTR_s00008p00026380          233   5e-73   Amborella trichopoda
ref|XP_002307071.1|  GTP-BINDING protein 3                              233   8e-73   
ref|XP_010555372.1|  PREDICTED: ras-related protein RABA4b              233   1e-72   Tarenaya hassleriana [spider flower]
emb|CDY69836.1|  BnaAnng31680D                                          233   1e-72   Brassica napus [oilseed rape]
gb|KJB18227.1|  hypothetical protein B456_003G040900                    233   1e-72   Gossypium raimondii
ref|XP_010926325.1|  PREDICTED: ras-related protein Rab11D-like i...    232   2e-72   Elaeis guineensis
ref|XP_006404694.1|  hypothetical protein EUTSA_v10000314mg             232   3e-72   Eutrema salsugineum [saltwater cress]
emb|CDX69843.1|  BnaA10g21920D                                          231   3e-72   
ref|NP_195709.1|  GTP-binding protein ATGB3                             231   4e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273010.1|  PREDICTED: ras-related protein Rab11A-like         231   4e-72   Nelumbo nucifera [Indian lotus]
gb|KHG00253.1|  Ras-related Rab11A                                      231   4e-72   Gossypium arboreum [tree cotton]
ref|XP_006399529.1|  hypothetical protein EUTSA_v10014596mg             231   5e-72   Eutrema salsugineum [saltwater cress]
ref|XP_010917311.1|  PREDICTED: ras-related protein Rab11D-like         231   5e-72   Elaeis guineensis
gb|AAA87884.1|  ATGB3                                                   231   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122063.1|  PREDICTED: ras-related protein RABA4a-like         231   6e-72   Brassica rapa
gb|AAM66946.1|  GTP-binding protein GB3                                 229   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|EYU30990.1|  hypothetical protein MIMGU_mgv1a0261472mg               225   6e-71   Erythranthe guttata [common monkey flower]
ref|XP_010453062.1|  PREDICTED: ras-related protein RABA4a-like         228   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010491702.1|  PREDICTED: ras-related protein RABA4a-like         228   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010422850.1|  PREDICTED: ras-related protein RABA4a-like i...    228   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_009390909.1|  PREDICTED: ras-related protein Rab11D-like         227   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008804800.1|  PREDICTED: ras-related protein Rab11A-like         225   3e-70   
ref|XP_002871417.1|  hypothetical protein ARALYDRAFT_325580             226   3e-70   Arabidopsis lyrata subsp. lyrata
gb|KFK25337.1|  hypothetical protein AALP_AA8G099600                    226   4e-70   Arabis alpina [alpine rockcress]
ref|XP_006290108.1|  hypothetical protein CARUB_v10003752mg             226   6e-70   Capsella rubella
gb|KHG08307.1|  Ras-related Rab11A                                      225   8e-70   Gossypium arboreum [tree cotton]
gb|KJB40356.1|  hypothetical protein B456_007G060000                    224   2e-69   Gossypium raimondii
ref|XP_009413627.1|  PREDICTED: ras-related protein Rab11D-like         222   1e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001149604.1|  LOC100283230                                       222   2e-68   Zea mays [maize]
ref|XP_009393549.1|  PREDICTED: ras-related protein Rab11D-like         222   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004983071.1|  PREDICTED: ras-related protein Rab11D-like         221   2e-68   Setaria italica
gb|ABK22282.1|  unknown                                                 221   3e-68   Picea sitchensis
ref|NP_001064476.1|  Os10g0377400                                       221   3e-68   
emb|CDX69367.1|  BnaC01g00860D                                          220   4e-68   
ref|XP_003573862.1|  PREDICTED: ras-related protein Rab11D-like         221   4e-68   
ref|XP_006662306.1|  PREDICTED: ras-related protein Rab11D-like         221   5e-68   Oryza brachyantha
ref|XP_008782165.1|  PREDICTED: ras-related protein Rab11D-like         220   9e-68   Phoenix dactylifera
ref|XP_002489255.1|  hypothetical protein SORBIDRAFT_0012s021070        219   2e-67   Sorghum bicolor [broomcorn]
ref|XP_004985399.1|  PREDICTED: ras-related protein Rab11D-like         218   3e-67   Setaria italica
ref|XP_010422851.1|  PREDICTED: ras-related protein RABA4a-like i...    218   1e-66   Camelina sativa [gold-of-pleasure]
dbj|BAJ93377.1|  predicted protein                                      217   1e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465727.1|  hypothetical protein SORBIDRAFT_01g044550          217   1e-66   Sorghum bicolor [broomcorn]
ref|NP_001151068.1|  ras-related protein Rab11D                         216   2e-66   
ref|NP_001151560.1|  ras-related protein Rab11D                         215   6e-66   Zea mays [maize]
gb|EMT25488.1|  Ras-related protein Rab11D                              213   7e-66   
emb|CDX69369.1|  BnaC01g00840D                                          220   1e-65   
gb|AAM08543.1|AC079935_15  Putative Ras-related protein Rab             213   3e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EMS58443.1|  Ras-related protein Rab11D                              212   9e-65   Triticum urartu
emb|CBI33135.3|  unnamed protein product                                211   1e-64   Vitis vinifera
ref|XP_003532818.1|  PREDICTED: ras-related protein Rab11A-like         211   1e-64   
ref|XP_006660497.1|  PREDICTED: ras-related protein RGP1-like           211   3e-64   Oryza brachyantha
emb|CDP07731.1|  unnamed protein product                                211   3e-64   Coffea canephora [robusta coffee]
ref|XP_006366509.1|  PREDICTED: ras-related protein RGP1-like           210   7e-64   Solanum tuberosum [potatoes]
ref|XP_004229604.1|  PREDICTED: ras-related protein RGP1                209   2e-63   Solanum lycopersicum
ref|XP_010265793.1|  PREDICTED: ras-related protein RGP1-like           208   4e-63   Nelumbo nucifera [Indian lotus]
gb|ABK25126.1|  unknown                                                 207   8e-63   Picea sitchensis
ref|XP_010695403.1|  PREDICTED: ras-related protein RABA4d              207   1e-62   Beta vulgaris subsp. vulgaris [field beet]
sp|P25766.2|RLGP1_ORYSJ  RecName: Full=Ras-related protein RGP1; ...    206   3e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004956465.1|  PREDICTED: ras-related protein RGP1-like           206   3e-62   Setaria italica
ref|XP_009399667.1|  PREDICTED: ras-related protein RGP1-like           206   4e-62   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA41966.1|  GTP-binding protein                                    205   6e-62   Oryza sativa [red rice]
ref|XP_010102630.1|  Ras-related protein RGP1                           205   6e-62   Morus notabilis
ref|XP_010067891.1|  PREDICTED: ras-related protein RABA4c-like         205   7e-62   Eucalyptus grandis [rose gum]
ref|XP_006421492.1|  hypothetical protein CICLE_v10005824mg             205   1e-61   Citrus clementina [clementine]
ref|XP_002459958.1|  hypothetical protein SORBIDRAFT_02g018890          204   1e-61   Sorghum bicolor [broomcorn]
ref|XP_009391884.1|  PREDICTED: ras-related protein RGP1-like           204   1e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010257365.1|  PREDICTED: ras-related protein RABA4d              204   2e-61   Nelumbo nucifera [Indian lotus]
ref|XP_011087327.1|  PREDICTED: ras-related protein RGP1                204   2e-61   Sesamum indicum [beniseed]
ref|XP_008787280.1|  PREDICTED: ras-related protein RGP1                204   2e-61   Phoenix dactylifera
ref|XP_008461787.1|  PREDICTED: ras-related protein RABA4c              204   2e-61   Cucumis melo [Oriental melon]
ref|XP_002532404.1|  protein with unknown function                      203   3e-61   Ricinus communis
ref|XP_002282798.1|  PREDICTED: ras-related protein RABA4d              203   3e-61   Vitis vinifera
ref|XP_006850119.1|  hypothetical protein AMTR_s00022p00227570          203   4e-61   Amborella trichopoda
ref|XP_009612391.1|  PREDICTED: ras-related protein RGP1-like           203   4e-61   Nicotiana tomentosiformis
ref|XP_006395225.1|  hypothetical protein EUTSA_v10004881mg             203   4e-61   Eutrema salsugineum [saltwater cress]
ref|XP_010928849.1|  PREDICTED: ras-related protein RGP1                203   5e-61   Elaeis guineensis
ref|XP_003577923.1|  PREDICTED: ras-related protein RGP1                203   5e-61   
gb|ABK23331.1|  unknown                                                 202   7e-61   Picea sitchensis
ref|XP_010913931.1|  PREDICTED: ras-related protein RGP1-like           202   8e-61   Elaeis guineensis
gb|EYU27083.1|  hypothetical protein MIMGU_mgv1a013266mg                202   9e-61   Erythranthe guttata [common monkey flower]
ref|XP_002513185.1|  protein with unknown function                      202   1e-60   Ricinus communis
ref|XP_004149604.1|  PREDICTED: ras-related protein RABA4c-like         201   1e-60   Cucumis sativus [cucumbers]
ref|XP_008783089.1|  PREDICTED: ras-related protein RGP1-like           199   2e-60   
ref|XP_010422852.1|  PREDICTED: ras-related protein RABA4a-like i...    201   2e-60   
ref|XP_009799541.1|  PREDICTED: ras-related protein RGP1-like           200   5e-60   Nicotiana sylvestris
ref|XP_010442212.1|  PREDICTED: ras-related protein RABA4c-like         200   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010534274.1|  PREDICTED: ras-related protein RABA4c              200   6e-60   Tarenaya hassleriana [spider flower]
gb|EMS64557.1|  Ras-related protein RGP1                                199   7e-60   Triticum urartu
gb|EMT23732.1|  Ras-related protein RGP1                                200   7e-60   
ref|XP_009151604.1|  PREDICTED: ras-related protein RABA4c              199   9e-60   Brassica rapa
gb|KHG15141.1|  Ras-related RABA4c -like protein                        200   9e-60   Gossypium arboreum [tree cotton]
emb|CDX86332.1|  BnaA06g30490D                                          199   1e-59   
ref|XP_002264293.1|  PREDICTED: ras-related protein RGP1                199   1e-59   Vitis vinifera
ref|XP_010057727.1|  PREDICTED: ras-related protein RABA4d              199   1e-59   Eucalyptus grandis [rose gum]
emb|CDY54519.1|  BnaC07g49230D                                          199   1e-59   Brassica napus [oilseed rape]
ref|XP_004172276.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    199   1e-59   
ref|XP_007052583.1|  RAB GTPase A4C                                     199   2e-59   
ref|NP_199607.1|  RAB GTPase homolog A4C                                199   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|KDP43443.1|  hypothetical protein JCGZ_16730                         199   2e-59   Jatropha curcas
ref|XP_010439146.1|  PREDICTED: ras-related protein RABA4c              199   2e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006281058.1|  hypothetical protein CARUB_v10027077mg             199   2e-59   Capsella rubella
ref|XP_002863846.1|  small molecular weight G-protein 1                 199   2e-59   Arabidopsis lyrata subsp. lyrata
gb|EYU39898.1|  hypothetical protein MIMGU_mgv1a020125mg                199   2e-59   Erythranthe guttata [common monkey flower]
gb|EEC84249.1|  hypothetical protein OsI_30694                          198   2e-59   Oryza sativa Indica Group [Indian rice]
ref|XP_010672725.1|  PREDICTED: ras-related protein RABA4d              198   3e-59   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA39806.1|  TPA: ras protein RGP1                                  198   3e-59   
ref|NP_001146862.1|  LOC100280470                                       198   3e-59   Zea mays [maize]
ref|XP_009411810.1|  PREDICTED: ras-related protein RGP1-like           197   6e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004494010.1|  PREDICTED: ras-related protein RABA4d-like         197   8e-59   
gb|KDO83348.1|  hypothetical protein CISIN_1g040835mg                   196   1e-58   Citrus sinensis [apfelsine]
emb|CDP10094.1|  unnamed protein product                                197   1e-58   Coffea canephora [robusta coffee]
ref|XP_007028923.1|  RAB GTPase A4D                                     196   2e-58   
ref|XP_004497938.1|  PREDICTED: ras-related protein RABA4d-like         196   2e-58   Cicer arietinum [garbanzo]
ref|XP_006438973.1|  hypothetical protein CICLE_v10032676mg             196   2e-58   Citrus clementina [clementine]
ref|XP_007218358.1|  hypothetical protein PRUPE_ppa011105mg             196   2e-58   Prunus persica
ref|XP_008231353.1|  PREDICTED: ras-related protein RABA4c              196   2e-58   Prunus mume [ume]
ref|XP_004306514.1|  PREDICTED: ras-related protein RABA4c              196   3e-58   Fragaria vesca subsp. vesca
ref|XP_010482045.1|  PREDICTED: ras-related protein RABA4c-like         195   5e-58   Camelina sativa [gold-of-pleasure]
gb|AFK37481.1|  unknown                                                 194   1e-57   Medicago truncatula
ref|XP_002298447.1|  GTP-binding family protein                         194   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011025048.1|  PREDICTED: ras-related protein RABA4d              194   1e-57   Populus euphratica
ref|XP_010520062.1|  PREDICTED: ras-related protein RABA4d              194   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_009591241.1|  PREDICTED: ras-related protein RABA4d-like         194   2e-57   Nicotiana tomentosiformis
gb|EYU20715.1|  hypothetical protein MIMGU_mgv1a013518mg                193   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_008373738.1|  PREDICTED: ras-related protein RABA4d              193   3e-57   
ref|XP_011078858.1|  PREDICTED: ras-related protein RABA4d              192   4e-57   Sesamum indicum [beniseed]
ref|XP_009804804.1|  PREDICTED: ras-related protein RABA4d-like         193   4e-57   Nicotiana sylvestris
ref|XP_008460801.1|  PREDICTED: ras-related protein RABA4d              193   4e-57   Cucumis melo [Oriental melon]
ref|XP_004150166.1|  PREDICTED: ras-related protein RABA4d-like         193   4e-57   Cucumis sativus [cucumbers]
ref|XP_008375145.1|  PREDICTED: ras-related protein RABA4c-like         192   6e-57   Malus domestica [apple tree]
ref|XP_009354700.1|  PREDICTED: ras-related protein RABA4c-like         192   6e-57   Pyrus x bretschneideri [bai li]
gb|KHG02480.1|  Ras-related RABA4d -like protein                        192   6e-57   Gossypium arboreum [tree cotton]
ref|XP_008240816.1|  PREDICTED: ras-related protein RABA4d              192   9e-57   Prunus mume [ume]
ref|XP_007204003.1|  hypothetical protein PRUPE_ppa025526mg             192   1e-56   Prunus persica
ref|NP_187823.1|  RAB GTPase-like protein A4D                           192   1e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42133.1|  BnaC05g40860D                                          192   1e-56   Brassica napus [oilseed rape]
ref|XP_010489789.1|  PREDICTED: ras-related protein RABA4d-like         191   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009120881.1|  PREDICTED: ras-related protein RABA4d              191   1e-56   Brassica rapa
ref|XP_001775770.1|  predicted protein                                  191   1e-56   
ref|XP_004234844.1|  PREDICTED: ras-related protein RABA4d-like         191   1e-56   Solanum lycopersicum
gb|EPS73160.1|  hypothetical protein M569_01593                         191   2e-56   Genlisea aurea
ref|XP_006381042.1|  Ras-related GTP-binding family protein             191   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_009135214.1|  PREDICTED: ras-related protein RABA4d-like         190   4e-56   Brassica rapa
ref|XP_009365017.1|  PREDICTED: ras-related protein RABA4c-like         190   4e-56   Pyrus x bretschneideri [bai li]
gb|KHN27367.1|  Ras-related protein RABA4d                              190   6e-56   Glycine soja [wild soybean]
ref|XP_009146635.1|  PREDICTED: ras-related protein RABA4d-like         191   6e-56   Brassica rapa
emb|CDY00758.1|  BnaC03g37420D                                          189   6e-56   
ref|XP_002323298.1|  Ras-related GTP-binding family protein             189   6e-56   Populus trichocarpa [western balsam poplar]
ref|XP_004249189.1|  PREDICTED: ras-related protein RABA4d-like         189   8e-56   Solanum lycopersicum
ref|XP_006351381.1|  PREDICTED: ras-related protein RABA4d-like         189   8e-56   Solanum tuberosum [potatoes]
ref|XP_009590361.1|  PREDICTED: ras-related protein RABA4d-like         189   1e-55   Nicotiana tomentosiformis
ref|XP_007145654.1|  hypothetical protein PHAVU_007G257200g             189   1e-55   Phaseolus vulgaris [French bean]
ref|XP_011016542.1|  PREDICTED: ras-related protein RABA4d-like         189   1e-55   Populus euphratica
gb|KJB36087.1|  hypothetical protein B456_006G140300                    189   1e-55   Gossypium raimondii
ref|XP_011033268.1|  PREDICTED: ras-related protein RABA4d-like i...    189   2e-55   Populus euphratica
ref|XP_009345104.1|  PREDICTED: ras-related protein RABA4d-like         189   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_011020284.1|  PREDICTED: ras-related protein RABA4d-like         188   2e-55   Populus euphratica
ref|XP_009347482.1|  PREDICTED: ras-related protein RABA4d-like         189   2e-55   Pyrus x bretschneideri [bai li]
gb|KHG20755.1|  Ras-related RABA4d -like protein                        188   3e-55   Gossypium arboreum [tree cotton]
ref|XP_004309478.1|  PREDICTED: ras-related protein RABA4d isofor...    188   3e-55   Fragaria vesca subsp. vesca
gb|KHN09949.1|  Ras-related protein RABA4d                              188   3e-55   Glycine soja [wild soybean]
ref|XP_001760654.1|  Rab11/RabA-family small GTPase                     187   5e-55   
ref|XP_009763158.1|  PREDICTED: ras-related protein RABA4d-like         187   7e-55   Nicotiana sylvestris
ref|XP_008392105.1|  PREDICTED: ras-related protein RABA4d-like         187   1e-54   
gb|KEH16247.1|  RAB GTPase-like protein A1D                             186   2e-54   Medicago truncatula
ref|XP_011075182.1|  PREDICTED: ras-related protein RABA4d-like         186   2e-54   Sesamum indicum [beniseed]
ref|XP_010557931.1|  PREDICTED: ras-related protein RABA4d-like         186   3e-54   Tarenaya hassleriana [spider flower]
ref|XP_010418858.1|  PREDICTED: ras-related protein RABA4d-like         182   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008344635.1|  PREDICTED: ras-related protein RGP1-like           182   1e-53   
ref|XP_007140805.1|  hypothetical protein PHAVU_008G143600g             183   2e-53   Phaseolus vulgaris [French bean]
ref|XP_010111429.1|  Ras-related protein RABA4d                         183   2e-53   
ref|XP_001753670.1|  Rab11/RabA-family small GTPase                     183   2e-53   
gb|AFK40086.1|  unknown                                                 182   3e-53   Lotus japonicus
gb|AAG51053.1|AC069473_15  ras-related GTP-binding protein, putat...    182   8e-53   Arabidopsis thaliana [mouse-ear cress]
gb|ACU18500.1|  unknown                                                 181   9e-53   Glycine max [soybeans]
ref|XP_011033267.1|  PREDICTED: ras-related protein RABA4d-like i...    182   1e-52   Populus euphratica
ref|XP_004230007.1|  PREDICTED: ras-related protein RABA3               182   1e-52   Solanum lycopersicum
ref|XP_006339750.1|  PREDICTED: ras-related protein RABA3-like          182   2e-52   Solanum tuberosum [potatoes]
ref|XP_003539132.1|  PREDICTED: ras-related protein RABA4d-like         181   2e-52   Glycine max [soybeans]
ref|XP_003516822.1|  PREDICTED: ras-related protein RABA4d-like         180   3e-52   Glycine max [soybeans]
ref|XP_002985624.1|  rab family GTPase                                  179   5e-52   Selaginella moellendorffii
ref|XP_002974254.1|  rab family GTPase                                  179   6e-52   Selaginella moellendorffii
ref|XP_008350827.1|  PREDICTED: ras-related protein RABA4d              178   6e-52   
ref|XP_006367552.1|  PREDICTED: ras-related protein RABA4d-like         178   8e-52   Solanum tuberosum [potatoes]
gb|KHN07997.1|  Ras-related protein RABA4d                              180   1e-51   Glycine soja [wild soybean]
ref|XP_011470829.1|  PREDICTED: ras-related protein RABA4d isofor...    178   2e-51   Fragaria vesca subsp. vesca
ref|XP_009375439.1|  PREDICTED: ras-related protein RABA3               178   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_007220411.1|  hypothetical protein PRUPE_ppa010826mg             178   4e-51   
ref|XP_011047877.1|  PREDICTED: ras-related protein RABA2a-like         177   4e-51   Populus euphratica
ref|XP_011011334.1|  PREDICTED: ras-related protein RABA2a              177   4e-51   Populus euphratica
ref|XP_006389492.1|  hypothetical protein POPTR_0022s00350g             177   4e-51   Populus trichocarpa [western balsam poplar]
gb|KFK32821.1|  hypothetical protein AALP_AA6G292000                    176   4e-51   Arabis alpina [alpine rockcress]
ref|XP_006424930.1|  hypothetical protein CICLE_v10029427mg             174   9e-51   
ref|XP_006645011.1|  PREDICTED: ras-related protein Rab11C-like         176   9e-51   Oryza brachyantha
ref|XP_009101412.1|  PREDICTED: ras-related protein RABA5a-like         176   9e-51   Brassica rapa
ref|XP_010262670.1|  PREDICTED: ras-related protein Rab2BV              176   1e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010681762.1|  PREDICTED: ras-related protein RABA2a              176   1e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008233092.1|  PREDICTED: ras-related protein RABA3               176   2e-50   Prunus mume [ume]
emb|CDM84991.1|  unnamed protein product                                175   2e-50   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ96755.1|  predicted protein                                      175   2e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS69801.1|  hypothetical protein M569_04963                         175   2e-50   Genlisea aurea
ref|XP_003564610.1|  PREDICTED: ras-related protein Rab11C-like         175   3e-50   Brachypodium distachyon [annual false brome]
ref|XP_008344636.1|  PREDICTED: ras-related protein RABA4d              174   3e-50   
ref|XP_002262618.3|  PREDICTED: ras-related protein RABA3               176   3e-50   
ref|XP_008452243.1|  PREDICTED: ras-related protein RABA2a              174   4e-50   
ref|XP_004133721.1|  PREDICTED: ras-related protein RABA2a-like         174   4e-50   
ref|XP_009617959.1|  PREDICTED: ras-related protein RABA3               175   5e-50   
ref|XP_006385059.1|  hypothetical protein POPTR_0004s23510g             174   5e-50   
gb|ABK94045.1|  unknown                                                 174   5e-50   
ref|XP_002969056.1|  rab family GTPase                                  174   5e-50   
ref|XP_009797391.1|  PREDICTED: ras-related protein RABA3               175   6e-50   
ref|XP_003528777.1|  PREDICTED: ras-related protein RABA3-like          175   6e-50   
ref|XP_006488403.1|  PREDICTED: ras-related protein Rab11C-like i...    174   6e-50   
gb|EYU28031.1|  hypothetical protein MIMGU_mgv1a013557mg                174   6e-50   
ref|XP_010030204.1|  PREDICTED: ras-related protein RABA2a              174   6e-50   
ref|XP_007051475.1|  RAB GTPase A3                                      177   6e-50   
ref|XP_006367554.1|  PREDICTED: ras-related protein RABA4d-like         172   7e-50   
ref|XP_011087655.1|  PREDICTED: ras-related protein RABA2a-like         174   7e-50   
ref|XP_011028371.1|  PREDICTED: ras-related protein RABA2a-like         174   7e-50   
ref|XP_010100694.1|  Ras-related protein RABA3                          174   7e-50   
sp|Q9SJZ5.1|RAA4E_ARATH  RecName: Full=Putative Ras-related prote...    172   8e-50   
ref|XP_010934494.1|  PREDICTED: ras-related protein RABA3               175   8e-50   
ref|XP_005843019.1|  hypothetical protein CHLNCDRAFT_33302              174   8e-50   
ref|XP_003548240.1|  PREDICTED: ras-related protein RABA3-like is...    174   9e-50   
ref|XP_009769694.1|  PREDICTED: ras-related protein RABA2a              174   9e-50   
gb|KHF99482.1|  Ras-related RABA3 -like protein                         174   1e-49   
ref|NP_001044805.1|  Os01g0848700                                       173   1e-49   
ref|XP_010521896.1|  PREDICTED: ras-related protein RABA2b-like         173   1e-49   
gb|AFW77561.1|  hypothetical protein ZEAMMB73_916842                    171   1e-49   
ref|XP_002533328.1|  protein with unknown function                      174   1e-49   
ref|XP_008376179.1|  PREDICTED: ras-related protein RABA3               174   1e-49   
ref|XP_011094230.1|  PREDICTED: ras-related protein RABA3               174   2e-49   
gb|ACN27780.1|  unknown                                                 173   2e-49   
ref|XP_006654201.1|  PREDICTED: ras-related protein RGP2-like           173   2e-49   
ref|NP_001146923.1|  LOC100280532                                       172   2e-49   
gb|KDP28444.1|  hypothetical protein JCGZ_14215                         173   2e-49   
ref|NP_001055087.1|  Os05g0280200                                       172   3e-49   
ref|XP_011092284.1|  PREDICTED: ras-related protein RABA2a              172   3e-49   
ref|XP_004961210.1|  PREDICTED: ras-related protein RABA1f-like         172   3e-49   
ref|NP_001140635.1|  uncharacterized protein LOC100272710               172   3e-49   
gb|ACU24343.1|  unknown                                                 171   3e-49   
ref|NP_001148694.1|  LOC100282310                                       172   3e-49   
ref|XP_010905873.1|  PREDICTED: ras-related protein Rab2BV-like         172   4e-49   
ref|XP_010557233.1|  PREDICTED: ras-related protein RABA2b              172   4e-49   
gb|EYU19954.1|  hypothetical protein MIMGU_mgv1a013564mg                172   4e-49   
ref|XP_010113190.1|  Ras-related protein RABA2a                         171   4e-49   
ref|XP_008806367.1|  PREDICTED: ras-related protein RABA3               172   4e-49   
ref|XP_010245424.1|  PREDICTED: ras-related protein RABA2a              172   4e-49   
gb|KJB41593.1|  hypothetical protein B456_007G110800                    172   5e-49   
emb|CDO97631.1|  unnamed protein product                                172   5e-49   
ref|XP_010256763.1|  PREDICTED: ras-related protein Rab11C              172   5e-49   
ref|XP_006349310.1|  PREDICTED: ras-related protein RABA2a-like         171   5e-49   
ref|XP_010494988.1|  PREDICTED: ras-related protein RABA5a-like         172   6e-49   
ref|NP_001290016.1|  ras-related protein Rab2BV                         171   6e-49   
ref|XP_011038764.1|  PREDICTED: ras-related protein RABA3-like          172   6e-49   
ref|XP_002441520.1|  hypothetical protein SORBIDRAFT_09g028560          171   6e-49   
gb|ABR18090.1|  unknown                                                 171   6e-49   
ref|XP_010441443.1|  PREDICTED: ras-related protein RABA5a              171   7e-49   
ref|XP_006398449.1|  hypothetical protein EUTSA_v10001017mg             171   7e-49   
ref|XP_004962491.1|  PREDICTED: ras-related protein RGP2-like           171   7e-49   
ref|XP_002863339.1|  hypothetical protein ARALYDRAFT_494220             171   7e-49   
gb|KHN19438.1|  Ras-related protein RGP1                                171   7e-49   
gb|KDP42194.1|  hypothetical protein JCGZ_02924                         171   7e-49   
emb|CAA98178.1|  RAB11B                                                 172   7e-49   
ref|XP_004230439.1|  PREDICTED: ras-related protein RABA2a              171   7e-49   
ref|XP_007225803.1|  hypothetical protein PRUPE_ppa011290mg             171   7e-49   
ref|XP_004155229.1|  PREDICTED: ras-related protein RABA2a-like         171   8e-49   
gb|KJB57385.1|  hypothetical protein B456_009G160700                    171   8e-49   
ref|XP_009353794.1|  PREDICTED: ras-related protein RABA2a              171   8e-49   
gb|EYU35014.1|  hypothetical protein MIMGU_mgv1a013570mg                171   8e-49   
ref|XP_002320214.2|  GTP-binding family protein                         172   8e-49   
gb|KCW85498.1|  hypothetical protein EUGRSUZ_B022981                    169   8e-49   
ref|XP_009120428.1|  PREDICTED: ras-related protein RABA2d-like         171   9e-49   
ref|XP_008365321.1|  PREDICTED: ras-related protein RABA2a              171   9e-49   
emb|CDY33014.1|  BnaA10g12200D                                          171   9e-49   
ref|XP_004307586.1|  PREDICTED: ras-related protein Rab2BV-like i...    171   9e-49   
ref|XP_002307838.2|  hypothetical protein POPTR_0006s00240g             171   9e-49   
ref|XP_009611191.1|  PREDICTED: ras-related protein RABA2a-like         171   1e-48   
emb|CDY06703.1|  BnaA10g04820D                                          171   1e-48   
ref|XP_009118963.1|  PREDICTED: ras-related protein RABA2b-like         171   1e-48   
ref|XP_004981229.1|  PREDICTED: ras-related protein Rab11C-like         171   1e-48   
ref|XP_003540537.1|  PREDICTED: ras-related protein RABA4c-like         171   1e-48   
gb|ACU17691.1|  unknown                                                 171   1e-48   
gb|ADE77295.1|  unknown                                                 171   1e-48   
gb|ADE76069.1|  unknown                                                 171   1e-48   
ref|XP_008385821.1|  PREDICTED: ras-related protein RABA2a              171   1e-48   
ref|XP_004507156.1|  PREDICTED: ras-related protein Rab11C-like         171   1e-48   
ref|XP_011023129.1|  PREDICTED: ras-related protein RABA3-like          171   1e-48   
dbj|BAA02437.1|  GTP binding protein                                    171   1e-48   
ref|XP_010693617.1|  PREDICTED: ras-related protein RABA3               171   1e-48   
ref|XP_008463615.1|  PREDICTED: LOW QUALITY PROTEIN: ras-related ...    171   1e-48   
ref|XP_007135286.1|  hypothetical protein PHAVU_010G116500g             171   1e-48   
ref|XP_010544112.1|  PREDICTED: ras-related protein RABA2a              171   2e-48   
gb|AFK33953.1|  unknown                                                 170   2e-48   
ref|XP_002892514.1|  hypothetical protein ARALYDRAFT_888208             170   2e-48   
ref|XP_003627536.1|  Ras-related protein Rab-11A                        170   2e-48   
ref|NP_001130075.1|  uncharacterized protein LOC100191168               170   2e-48   
ref|XP_010503299.1|  PREDICTED: ras-related protein RABA2c              170   2e-48   
ref|XP_011076781.1|  PREDICTED: ras-related protein Rab2BV-like         170   2e-48   
ref|XP_002984315.1|  rab family GTPase                                  170   2e-48   
sp|Q40193.1|RB11C_LOTJA  RecName: Full=Ras-related protein Rab11C       170   2e-48   
ref|XP_007148577.1|  hypothetical protein PHAVU_006G220200g             170   2e-48   
ref|XP_006304197.1|  hypothetical protein CARUB_v10010276mg             170   2e-48   
ref|XP_010490197.1|  PREDICTED: ras-related protein RABA2a-like         170   2e-48   
gb|ABR25739.1|  ras-related protein rab11b                              168   2e-48   
ref|NP_199563.1|  RAB GTPase homolog A5A                                170   2e-48   
gb|EAY99035.1|  hypothetical protein OsI_20993                          169   2e-48   
gb|KHG19886.1|  Ras-related RABA1c -like protein                        170   2e-48   
ref|XP_010520249.1|  PREDICTED: ras-related protein RABA2d              170   2e-48   
ref|XP_009355339.1|  PREDICTED: ras-related protein RABA2a-like         170   2e-48   
ref|XP_003539528.1|  PREDICTED: ras-related protein Rab11C-like i...    170   2e-48   
ref|XP_010535441.1|  PREDICTED: ras-related protein RABA2d-like         170   2e-48   
gb|KHN25232.1|  Ras-related protein Rab11C                              170   2e-48   
gb|EYU33282.1|  hypothetical protein MIMGU_mgv1a012628mg                171   3e-48   
gb|AFK46874.1|  unknown                                                 170   3e-48   
ref|XP_007132033.1|  hypothetical protein PHAVU_011G061100g             170   3e-48   
ref|NP_001240030.1|  uncharacterized protein LOC100797258               170   3e-48   
ref|XP_006400995.1|  hypothetical protein EUTSA_v10014634mg             170   3e-48   
ref|XP_002315193.2|  hypothetical protein POPTR_0010s20460g             170   3e-48   
ref|NP_190267.1|  Ras-related protein RABA2c                            170   3e-48   
gb|AET02012.2|  Ras-related small GTP-binding family protein            170   3e-48   
gb|KDO40435.1|  hypothetical protein CISIN_1g043745mg                   168   3e-48   
ref|XP_007141835.1|  hypothetical protein PHAVU_008G229600g             169   3e-48   
ref|XP_002972485.1|  rab family GTPase                                  169   3e-48   
ref|XP_001757189.1|  Rab11/RabA-family small GTPase                     169   4e-48   
emb|CDY02867.1|  BnaC02g10220D                                          169   4e-48   
gb|KJB21647.1|  hypothetical protein B456_004G006300                    169   4e-48   
ref|XP_011469867.1|  PREDICTED: ras-related protein Rab2BV-like i...    171   4e-48   
gb|KJB32873.1|  hypothetical protein B456_005G265900                    169   4e-48   
ref|XP_006417807.1|  hypothetical protein EUTSA_v10008748mg             169   4e-48   
ref|XP_002264444.1|  PREDICTED: ras-related protein RABA2a              169   4e-48   
ref|XP_003536164.1|  PREDICTED: ras-related protein RABA5a-like i...    169   4e-48   
emb|CDY50888.1|  BnaCnng19800D                                          169   4e-48   
ref|NP_001235133.1|  uncharacterized protein LOC100499980               169   4e-48   
gb|KHN39681.1|  Ras-related protein RABA2a                              169   4e-48   
gb|KJB55806.1|  hypothetical protein B456_009G095700                    167   4e-48   
ref|XP_009118440.1|  PREDICTED: ras-related protein RABA2b              169   5e-48   
emb|CDX93495.1|  BnaA06g05530D                                          169   5e-48   
ref|XP_010043481.1|  PREDICTED: ras-related protein Rab2BV              169   5e-48   
ref|XP_008339414.1|  PREDICTED: ras-related protein RABA2a-like         169   5e-48   
gb|ACU24291.1|  unknown                                                 169   5e-48   
ref|XP_010475498.1|  PREDICTED: ras-related protein RABA2b              169   5e-48   
ref|NP_001131362.1|  uncharacterized protein LOC100192685               169   5e-48   
ref|XP_003537971.1|  PREDICTED: ras-related protein Rab11C-like         169   5e-48   
ref|XP_008811352.1|  PREDICTED: ras-related protein Rab11C-like         169   6e-48   
gb|KDP42462.1|  hypothetical protein JCGZ_00259                         169   6e-48   
ref|XP_001776669.1|  Rab11/RabA-family small GTPase                     167   6e-48   
ref|XP_009114272.1|  PREDICTED: ras-related protein RABA5a              169   6e-48   
gb|KDD75000.1|  Ras family protein                                      167   6e-48   
ref|XP_010252473.1|  PREDICTED: ras-related protein RABA3               169   6e-48   
ref|XP_007149723.1|  hypothetical protein PHAVU_005G093700g             169   6e-48   
ref|XP_003592898.1|  Ras-related protein RABA2a                         169   6e-48   
ref|XP_011040076.1|  PREDICTED: ras-related protein Rab11C              169   6e-48   
ref|XP_009388403.1|  PREDICTED: ras-related protein RABA1f              169   7e-48   
emb|CDX80299.1|  BnaC09g34430D                                          170   7e-48   
ref|XP_010457916.1|  PREDICTED: ras-related protein RABA2b-like         169   7e-48   
ref|NP_001147252.1|  ras-related protein Rab11C                         169   7e-48   
ref|XP_006417553.1|  hypothetical protein EUTSA_v10008742mg             169   7e-48   
ref|XP_006495091.1|  PREDICTED: ras-related protein RABA1f-like         169   7e-48   
ref|XP_009629737.1|  PREDICTED: ras-related protein Rab2BV-like         169   7e-48   
ref|XP_004139534.1|  PREDICTED: ras-related protein RABA5a-like         169   7e-48   
ref|XP_009148263.1|  PREDICTED: ras-related protein RABA2a              169   7e-48   
ref|XP_006470954.1|  PREDICTED: ras-related protein RABA2a-like         169   8e-48   
ref|XP_010458259.1|  PREDICTED: ras-related protein RABA2a-like         169   8e-48   
ref|XP_006418853.1|  hypothetical protein EUTSA_v10002662mg             169   8e-48   
ref|XP_003544161.1|  PREDICTED: ras-related protein Rab2BV-like         169   8e-48   
ref|XP_007041174.1|  RAB GTPase 11C                                     168   8e-48   
ref|XP_002302656.2|  GTP-binding family protein                         169   9e-48   
ref|NP_001056333.1|  Os05g0564400                                       169   9e-48   
gb|AGV54242.1|  Ras-related protein Rab11C                              168   9e-48   
ref|XP_006859000.1|  hypothetical protein AMTR_s00068p00145200          168   9e-48   
ref|XP_006305601.1|  hypothetical protein CARUB_v10010267mg             168   9e-48   
ref|XP_002439505.1|  hypothetical protein SORBIDRAFT_09g008430          168   9e-48   
ref|NP_172434.1|  RAB GTPase 11C                                        168   1e-47   
ref|XP_010541416.1|  PREDICTED: ras-related protein RABA2c-like         168   1e-47   
ref|XP_011089516.1|  PREDICTED: ras-related protein Rab11C              168   1e-47   
ref|XP_006449885.1|  hypothetical protein CICLE_v10017675mg             168   1e-47   
ref|XP_009797654.1|  PREDICTED: ras-related protein Rab2BV-like         168   1e-47   
ref|XP_009110948.1|  PREDICTED: ras-related protein RABA2b-like         168   1e-47   
ref|XP_010454720.1|  PREDICTED: ras-related protein RABA2d              168   1e-47   
gb|KHG20423.1|  Ras-related RABA1c -like protein                        168   1e-47   
ref|XP_007396337.1|  hypothetical protein PHACADRAFT_257063             168   1e-47   
ref|XP_006373543.1|  hypothetical protein POPTR_0016s00240g             168   1e-47   
ref|XP_009351264.1|  PREDICTED: ras-related protein Rab2BV-like         168   1e-47   
ref|XP_002312127.2|  GTP-binding family protein                         168   1e-47   
ref|XP_004300007.1|  PREDICTED: ras-related protein RABA2a              168   1e-47   
ref|XP_006836501.1|  hypothetical protein AMTR_s00108p00135260          168   1e-47   
ref|NP_001151123.1|  ras-related protein Rab11B                         168   1e-47   
ref|XP_002526431.1|  protein with unknown function                      168   1e-47   
ref|XP_010490210.1|  PREDICTED: ras-related protein RABA2a isofor...    168   1e-47   
gb|ACU22888.1|  unknown                                                 168   2e-47   
emb|CDY17729.1|  BnaA06g35480D                                          168   2e-47   
ref|XP_007218372.1|  hypothetical protein PRUPE_ppa011294mg             168   2e-47   
ref|NP_172221.1|  RAB GTPase homolog A2B                                167   2e-47   
ref|XP_008233507.1|  PREDICTED: ras-related protein Rab2BV-like         168   2e-47   
gb|KHG00809.1|  Ras-related Rab11C                                      168   2e-47   
dbj|BAA02114.1|  GTP-binding protein                                    168   2e-47   
gb|KHG15679.1|  Ras-related Rab11C                                      167   2e-47   
gb|KFK43256.1|  hypothetical protein AALP_AA1G100200                    168   2e-47   
ref|XP_002863031.1|  predicted protein                                  166   2e-47   
ref|XP_004243397.1|  PREDICTED: ras-related protein RABA1f              167   2e-47   
ref|XP_011005795.1|  PREDICTED: ras-related protein Rab11C-like         167   2e-47   
ref|XP_009774455.1|  PREDICTED: ras-related protein RABA2b-like         167   2e-47   
ref|XP_005645863.1|  ras-related protein Rab2BV                         167   2e-47   
ref|XP_007133843.1|  hypothetical protein PHAVU_011G213600g             168   2e-47   
ref|XP_002520494.1|  protein with unknown function                      167   2e-47   
emb|CDP08641.1|  unnamed protein product                                169   2e-47   
dbj|BAA02109.1|  GTP-binding protein                                    167   2e-47   
ref|XP_004306638.1|  PREDICTED: ras-related protein RABA3               168   2e-47   
gb|AFW84585.1|  ras protein Rab11C                                      171   2e-47   
ref|XP_006650816.1|  PREDICTED: ras-related protein Rab11C-like         167   2e-47   
dbj|BAA84640.1|  PRA2                                                   168   2e-47   
gb|AFK45144.1|  unknown                                                 168   2e-47   
dbj|BAK01667.1|  predicted protein                                      167   2e-47   
gb|KIP10274.1|  hypothetical protein PHLGIDRAFT_18342                   167   3e-47   
gb|KHG06502.1|  Ras-related RABA1c -like protein                        167   3e-47   
gb|KHN20893.1|  Ras-related protein Rab2BV                              167   3e-47   
ref|XP_006654793.1|  PREDICTED: ras-related protein RABA1f-like         167   3e-47   
gb|AAT64010.1|  putative GTP-binding protein                            167   3e-47   
ref|XP_001776696.1|  Rab11/RabA-family small GTPase                     167   3e-47   
gb|KDP21032.1|  hypothetical protein JCGZ_21503                         167   3e-47   
ref|XP_010106561.1|  Ras-related protein Rab11C                         168   3e-47   
ref|XP_009588608.1|  PREDICTED: ras-related protein RABA1f              167   3e-47   
gb|KHN13102.1|  Ras-related protein Rab2BV                              167   3e-47   



>ref|XP_009802845.1| PREDICTED: ras-related protein Rab11D [Nicotiana sylvestris]
Length=222

 Score =   257 bits (657),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF TVLTEIFNIVN+K   AA++  
Sbjct  133  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFLTVLTEIFNIVNKK-NLAADDNQ  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +    ASLTGKKILVPGPGQVIP+KK+ CCSS
Sbjct  192  SNGNPASLTGKKILVPGPGQVIPEKKA-CCSS  222



>sp|Q40522.1|RB11D_TOBAC RecName: Full=Ras-related protein Rab11D [Nicotiana tabacum]
 gb|AAA74114.1| putative [Nicotiana tabacum]
Length=222

 Score =   256 bits (654),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA N+E+AF TVLTEIFNIVN+K   AA++  
Sbjct  133  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNLEDAFLTVLTEIFNIVNKK-NLAADDNQ  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +    ASLTGKKILVPGPGQVIP+KK+ CCSS
Sbjct  192  SNGNPASLTGKKILVPGPGQVIPEKKA-CCSS  222



>ref|XP_009591756.1| PREDICTED: ras-related protein Rab11D [Nicotiana tomentosiformis]
 dbj|BAH37015.1| NtRab11D [Nicotiana tabacum]
Length=222

 Score =   256 bits (654),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF TVLTEIFNIVN+K   AA+   
Sbjct  133  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFLTVLTEIFNIVNKK-NLAADENQ  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +    ASLTGKKILVPGPGQVIP KK+ CCSS
Sbjct  192  SNGNPASLTGKKILVPGPGQVIPGKKA-CCSS  222



>ref|XP_006353216.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=224

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF TVLTEIFNIVN+K   AA +  
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFLTVLTEIFNIVNKK-NLAAGDDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASLTGKKILVPGP QVIP+KK+ CCSS
Sbjct  194  ANGNPASLTGKKILVPGPAQVIPEKKA-CCSS  224



>ref|XP_004250110.1| PREDICTED: ras-related protein Rab11D [Solanum lycopersicum]
Length=224

 Score =   254 bits (648),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA N+E+AF TVLTEIFNIVN+K   AA +  
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNIEDAFLTVLTEIFNIVNKK-NLAAGDDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASLTGKKILVPGP QVIP+KK+ CCSS
Sbjct  194  ANGNPASLTGKKILVPGPAQVIPEKKA-CCSS  224



>ref|XP_009620681.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana tomentosiformis]
Length=224

 Score =   252 bits (644),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF TVLTEIFNIVN+K   AA +  
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFFTVLTEIFNIVNKK-NLAAGDDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASLTGKKILVPGP QVIP+KK+ CC S
Sbjct  194  ANGNSASLTGKKILVPGPAQVIPEKKA-CCRS  224



>ref|XP_009798472.1| PREDICTED: ras-related protein Rab11D-like [Nicotiana sylvestris]
Length=224

 Score =   252 bits (643),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/152 (84%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF TVLTEIFNIVN+K   AA +  
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFFTVLTEIFNIVNKK-NLAAGDDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASLTGKKILVPGP QVIP+KK+ CC S
Sbjct  194  ANGNTASLTGKKILVPGPAQVIPEKKA-CCRS  224



>sp|Q40520.1|RB11C_TOBAC RecName: Full=Ras-related protein Rab11C [Nicotiana tabacum]
 gb|AAA74112.1| putative [Nicotiana tabacum]
Length=222

 Score =   251 bits (641),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVIML GNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIMLTGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSAMEA  +E+AF TVLTEIFNIVN+K   AA+   
Sbjct  133  EDQRAVPTEDAKEFAQKEGLFFLETSAMEATKLEDAFLTVLTEIFNIVNKK-NLAADENQ  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + +  ASLTGKKILVPGPGQVIP KK+ CCSS
Sbjct  192  SNSNPASLTGKKILVPGPGQVIPGKKA-CCSS  222



>ref|XP_008381984.1| PREDICTED: ras-related protein Rab11D [Malus domestica]
Length=222

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+EA NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  132  ENQRAVPTEDAKEFAQKEGLFFLETSALEATNVENAFSTVLTEIFNIVNKK-SLAANENQ  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SLTGKKILVPGP QVIP K  +CC+S
Sbjct  191  ANGNPPSLTGKKILVPGPAQVIPAKSKVCCTS  222



>ref|XP_011100043.1| PREDICTED: ras-related protein Rab11D [Sesamum indicum]
Length=225

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWL+ELRAHADKNIVI+LIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLDELRAHADKNIVIILIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+EA NVEEAF TVLTEIFNIVN+K    A +  
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALEATNVEEAFVTVLTEIFNIVNKK-NLVAGDDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+GKKI++PGP QVIP+K  MCC S
Sbjct  194  ANGNPASLSGKKIVIPGPAQVIPEKNRMCCRS  225



>ref|XP_011097540.1| PREDICTED: ras-related protein Rab11D-like [Sesamum indicum]
Length=225

 Score =   249 bits (636),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR TFDHIPRWL+ELRAHADKNIVI+LIGNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRTTFDHIPRWLDELRAHADKNIVIILIGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R VPTEDAKEFAQKEGLFFLETSA+EA NVEEAF TVLTEIFNIVNRK   AA    
Sbjct  134  GDQRAVPTEDAKEFAQKEGLFFLETSALEATNVEEAFLTVLTEIFNIVNRK-NLAAGEDQ  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL GKKILVPGP QVIP+K  MCC S
Sbjct  193  ANGNPASLAGKKILVPGPAQVIPEKNRMCCRS  224



>gb|EPS65006.1| hypothetical protein M569_09770 [Genlisea aurea]
Length=228

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaa---e  380
            ED+R VPTEDAKEFAQ+EGLFFLETSA++A NVEEAF TVLTEIFNIVN+K L A    E
Sbjct  135  EDQRAVPTEDAKEFAQQEGLFFLETSALQATNVEEAFLTVLTEIFNIVNKKTLVAGGEDE  194

Query  379  nqgngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                G   ASLTGKKI+VPGPGQVIP+K+ +CCSS
Sbjct  195  QANGGGNTASLTGKKIVVPGPGQVIPEKR-VCCSS  228



>emb|CDP01498.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   248 bits (632),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIV++LIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVVILIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE AF TVLTEIFNIV+RK   AA    
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVETAFLTVLTEIFNIVSRK-TLAAGEDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL GKKILVPGP QVIP+K  MCC+S
Sbjct  194  GNGNPASLAGKKILVPGPAQVIPEKNRMCCAS  225



>ref|XP_006346741.1| PREDICTED: ras-related protein Rab11D-like [Solanum tuberosum]
Length=222

 Score =   246 bits (629),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVI+LIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIILIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            +D+R VPTEDAKEFAQKEGLFFLETSAMEA NVE+AF+TVLTEIFNIVN+K   AA++  
Sbjct  133  KDQRAVPTEDAKEFAQKEGLFFLETSAMEATNVEDAFSTVLTEIFNIVNKK-NLAADDNP  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+GKKILVPGP QVIP+K++ CC S
Sbjct  192  PNGNPASLSGKKILVPGPAQVIPEKRA-CCRS  222



>ref|XP_006404948.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
 gb|ESQ46401.1| hypothetical protein EUTSA_v10000315mg [Eutrema salsugineum]
Length=225

 Score =   246 bits (627),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEIFN VN+KNL++ E+QG
Sbjct  133  EDQRAIPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIFNTVNKKNLSSVESQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKIL+PGPGQ IP K S CCSS
Sbjct  193  QSNNPGSLAGKKILIPGPGQEIPAKASTCCSS  224



>ref|XP_010319241.1| PREDICTED: ras-related protein Rab11D-like [Solanum lycopersicum]
Length=222

 Score =   245 bits (625),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHAD+NIVI+LIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADRNIVIILIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            +D+R VPTEDAKEFAQKEGLFFLETSA+EA NVE+AF+TVLTEIFNIVN+K   AA++  
Sbjct  133  KDQRAVPTEDAKEFAQKEGLFFLETSALEATNVEDAFSTVLTEIFNIVNKK-NLAADDYP  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+GKKILVPGP QVIP+K++ CC S
Sbjct  192  PNGNPASLSGKKILVPGPAQVIPEKRA-CCRS  222



>ref|XP_007047879.1| RAB GTPase A4A [Theobroma cacao]
 gb|EOX92036.1| RAB GTPase A4A [Theobroma cacao]
Length=225

 Score =   244 bits (624),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVNRK    A    
Sbjct  135  ENQRAVPTEDAKEFAQKEGLFFLETSALEATNVETAFLTVLTEIFNIVNRK-NLVAGENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SL GKKIL+PGP Q IP K +MCC S
Sbjct  194  GNGNPTSLAGKKILIPGPAQEIPAKSNMCCRS  225



>ref|XP_004288173.1| PREDICTED: ras-related protein Rab11D [Fragaria vesca subsp. 
vesca]
Length=222

 Score =   244 bits (622),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+E+ NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  132  ENQRAVPTEDAKEFAQKEGLFFLETSALESTNVETAFSTVLTEIFNIVNKK-HLAASENQ  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +    ASL GKKILVPGP QVIP  KS CC+S
Sbjct  191  SNGNPASLAGKKILVPGPAQVIP-AKSKCCTS  221



>ref|XP_010106271.1| Ras-related protein Rab11D [Morus notabilis]
 gb|EXC09688.1| Ras-related protein Rab11D [Morus notabilis]
Length=227

 Score =   243 bits (621),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNKTDL
Sbjct  77   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKTDL  136

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKE LFFLETSA+++ NVE AF TVLTEIFNIVN+K   AA+   
Sbjct  137  EDQRAVPTEDAKEFAQKEELFFLETSALQSTNVENAFLTVLTEIFNIVNKK-NLAADENQ  195

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+GKKILVPGP QVIP+KK MCC S
Sbjct  196  GNGNPASLSGKKILVPGPAQVIPEKK-MCCKS  226



>emb|CDX81274.1| BnaC09g06850D [Brassica napus]
Length=227

 Score =   243 bits (619),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 5/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  79   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  138

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVL EIFNIVN+K    +    
Sbjct  139  EDQRAIPTEDAKEFAEKEGLFFLETSAFNASNVESAFSTVLNEIFNIVNKK----SLAVS  194

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  195  EEEQHGSLAGKKIDIVPGPGQVIPAKSNMCCNS  227



>ref|XP_009112174.1| PREDICTED: ras-related protein RABA4a [Brassica rapa]
 emb|CDY18682.1| BnaA09g07130D [Brassica napus]
Length=225

 Score =   242 bits (618),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 129/153 (84%), Gaps = 5/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  77   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  136

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVL EIFNIVN+K    +    
Sbjct  137  EDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLNEIFNIVNKK----SLAVS  192

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  193  EEEQHGSLAGKKIDIVPGPGQVIPAKSNMCCNS  225



>gb|KJB44099.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=225

 Score =   242 bits (618),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILLGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R+VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A+   
Sbjct  135  ENQREVPTEDAKEFAQKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLVADENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL GKKI++PGP Q IP K +MCC S
Sbjct  194  GNGNPASLAGKKIVIPGPAQEIPAKSNMCCRS  225



>ref|XP_006394054.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
 gb|ESQ31340.1| hypothetical protein EUTSA_v10004873mg [Eutrema salsugineum]
Length=226

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 131/153 (86%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAM+VYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMMVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   A   + 
Sbjct  135  EDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLAVSEEQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  194  ENGNPGSLAGKKIDIVPGPGQVIPTKSNMCCNS  226



>gb|KHN29041.1| Ras-related protein Rab11A [Glycine soja]
Length=227

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  136  ESQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKK-NLTADENQ  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI+VPGP Q IP K++MCC S
Sbjct  195  GNGNSASLSGQKIIVPGPAQEIPAKRNMCCQS  226



>gb|KHG10894.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=225

 Score =   242 bits (617),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILLGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R+VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A+   
Sbjct  135  ENQREVPTEDAKEFAQKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLVADENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SL GKKI++PGP Q IP K +MCC S
Sbjct  194  GNGNPTSLAGKKIVIPGPAQEIPAKSNMCCRS  225



>ref|XP_006426348.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|ESR39588.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|KDO60714.1| hypothetical protein CISIN_1g027292mg [Citrus sinensis]
Length=225

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  EEQRAVPTEDAKEFAQKEGLFFLETSALEATNVENAFMTVLTEIFNIVNKK-NLTAGEGQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                 ASL+GKKILVPGP Q IP K SMCC
Sbjct  194  GNGNPASLSGKKILVPGPAQEIPAKSSMCC  223



>ref|XP_002273530.1| PREDICTED: ras-related protein Rab11D [Vitis vinifera]
 emb|CAN70163.1| hypothetical protein VITISV_039255 [Vitis vinifera]
Length=226

 Score =   241 bits (616),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHADKNIVIILIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  EEQRAVPTEDAKEFAEKEGLFFLETSALEATNVENAFLTVLTEIFNIVNKK-NLVAGEDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASLTGK+I +PGP Q IP K +MCC S
Sbjct  194  ANGNPASLTGKRITIPGPAQEIPAKSNMCCKS  225



>gb|KHG10895.1| Ras-related protein Rab11A [Gossypium arboreum]
Length=238

 Score =   242 bits (617),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILLGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R+VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A+   
Sbjct  135  ENQREVPTEDAKEFAQKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLVADENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SL GKKI++PGP Q IP K +MCC S
Sbjct  194  GNGNPTSLAGKKIVIPGPAQEIPAKSNMCCRS  225



>sp|Q40191.1|RB11A_LOTJA RecName: Full=Ras-related protein Rab11A; Flags: Precursor [Lotus 
japonicus]
 emb|CAA98177.1| RAB11A [Lotus japonicus]
Length=226

 Score =   241 bits (616),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             ++RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AFTTVLTEI+NIVN+K   AA+   
Sbjct  135  VNQRDVPTEDAKEFAEKEGLFFLETSALEATNVESAFTTVLTEIYNIVNKK-SLAADESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI++PGP Q IP K++MCC +
Sbjct  194  GNGNSASLSGQKIIIPGPAQEIPAKRNMCCQA  225



>ref|XP_008440577.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440578.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
 ref|XP_008440579.1| PREDICTED: ras-related protein Rab11A [Cucumis melo]
Length=227

 Score =   241 bits (615),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+E+ NVE AF TVLTEIF+I+NRKNLAA ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALESTNVENAFMTVLTEIFSIMNRKNLAAGENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN+A+   GKKI++PGP Q IP K  MCCSS
Sbjct  195  NGNSASLAGGKKIIIPGPAQEIPAKSKMCCSS  226



>dbj|BAA02110.1| GTP-binding protein [Pisum sativum]
 prf||2001457C GTP-binding protein
Length=225

 Score =   241 bits (615),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA++A NVE +F TVLTEI+NI+N+K   AA+   
Sbjct  135  ENQRDVPTEDAKEFAEKEGLFFLETSALQATNVEASFMTVLTEIYNILNKK-NLAADESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL G+KI++PGPGQ +P K SMCC S
Sbjct  194  GNGNSASLLGQKIVIPGPGQEVPAKSSMCCQS  225



>ref|XP_007159716.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
 gb|ESW31710.1| hypothetical protein PHAVU_002G261400g [Phaseolus vulgaris]
Length=229

 Score =   241 bits (615),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK DL
Sbjct  78   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDL  137

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  138  ENQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFVTVLTEIYNIVNKK-NLTADENQ  196

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI+VPGP Q +P K++MCC +
Sbjct  197  GNGNSASLSGQKIIVPGPAQELPAKRNMCCQA  228



>gb|KFK28209.1| hypothetical protein AALP_AA8G486600 [Arabis alpina]
Length=226

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   A   + 
Sbjct  135  VDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLALSEEQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  194  ENGHTGSLAGKKIDIVPGPGQVIPTKSTMCCNS  226



>ref|XP_003525046.1| PREDICTED: ras-related protein Rab11A [Glycine max]
 gb|KHN06562.1| Ras-related protein Rab11A [Glycine soja]
Length=229

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GNK DL
Sbjct  78   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGNKCDL  137

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  138  ENQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKK-NLTADENQ  196

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI+VPGP Q IP K++MCC S
Sbjct  197  GNGNSASLSGQKIIVPGPAQEIPAKRNMCCQS  228



>gb|AAB97114.1| small GTP-binding protein, partial [Glycine max]
Length=222

 Score =   241 bits (614),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GNK DL
Sbjct  71   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGNKCDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  131  ENQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKK-NLTADENQ  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI+VPGP Q IP K++MCC S
Sbjct  190  GNGNSASLSGQKIIVPGPAQEIPAKRNMCCQS  221



>ref|XP_007205846.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
 gb|EMJ07045.1| hypothetical protein PRUPE_ppa011070mg [Prunus persica]
Length=225

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R +PTEDAKEFAQKEGLFFLETSA+E+ NVE AF TVLTEIFNIVN+K   AA    
Sbjct  135  ENQRVIPTEDAKEFAQKEGLFFLETSALESTNVESAFLTVLTEIFNIVNKK-SLAASENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+GKKI++PGP Q IP K  +CC+S
Sbjct  194  ANGNPASLSGKKIVIPGPAQEIPAKSKVCCTS  225



>ref|NP_201330.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
 sp|Q9FJN8.1|RAA4A_ARATH RecName: Full=Ras-related protein RABA4a; Short=AtRABA4a [Arabidopsis 
thaliana]
 dbj|BAB11663.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAK76621.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAL85040.1| putative GTP-binding protein [Arabidopsis thaliana]
 gb|AAM64565.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AED98031.1| RAB GTPase homolog A4A [Arabidopsis thaliana]
Length=226

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  135  VDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLAASEDQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  194  ENGNPGSLAGKKIDIVPGPGQVIPNKSNMCCNS  226



>ref|XP_009344449.1| PREDICTED: ras-related protein Rab11D [Pyrus x bretschneideri]
Length=222

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 129/152 (85%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF+TVLTE+FNIVN+K   AA    
Sbjct  132  ENQRAVPTEDAKEFAEKEGLFFLETSALEATNVENAFSTVLTEVFNIVNKK-SLAANENQ  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 A L GKKIL+PGP Q IP K   CC+S
Sbjct  191  GNGNPAPLAGKKILIPGPAQEIPAKSKACCTS  222



>ref|XP_004502410.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=223

 Score =   240 bits (613),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AFTTVLTEIFNIVN+K   AA+   
Sbjct  135  ENQRAVPTEDAKEFAEKEGLFFLETSALEATNVETAFTTVLTEIFNIVNKK-NLAADENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                + SL GKKI+VPGP Q IP KKSMCC
Sbjct  194  ENGNSTSLAGKKIIVPGPAQEIP-KKSMCC  222



>ref|XP_004143457.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 ref|XP_004160129.1| PREDICTED: ras-related protein Rab11A-like [Cucumis sativus]
 gb|KGN48734.1| hypothetical protein Csa_6G499780 [Cucumis sativus]
Length=226

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGALGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+E+ NVE AF TVLTEIF+I+NRKNLAA ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALESTNVENAFMTVLTEIFSIMNRKNLAAGENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN+A+   GKKI++PGP Q IP K  MCCS+
Sbjct  195  NGNSASLAGGKKIIIPGPAQEIPAKSKMCCST  226



>ref|XP_006281052.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
 ref|XP_010444544.1| PREDICTED: ras-related protein RABA4a [Camelina sativa]
 gb|EOA13950.1| hypothetical protein CARUB_v10027070mg [Capsella rubella]
Length=226

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  135  VDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLAASEDQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  194  ENGNPGSLAGKKIDIVPGPGQVIPTKSNMCCNS  226



>ref|XP_008235004.1| PREDICTED: ras-related protein Rab11A [Prunus mume]
Length=225

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R +PTEDAKEFAQKEGLFFLETSA+E+ NVE AF TVLTEIFNIVN+K   AA    
Sbjct  135  ENQRAIPTEDAKEFAQKEGLFFLETSALESTNVESAFLTVLTEIFNIVNKK-SLAASENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 A+L+GKKI++PGP Q IP K  +CC+S
Sbjct  194  ANGNPATLSGKKIVIPGPAQEIPAKSKVCCTS  225



>ref|XP_010267206.1| PREDICTED: ras-related protein Rab11A [Nelumbo nucifera]
Length=225

 Score =   240 bits (612),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A    
Sbjct  134  ESQRAVPTEDAKEFAEKEGLFFLETSALEATNVETAFLTVLTEIFNIVNKK-NLVAGEDQ  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +     SL GKKI++PGP Q IP K  MCC S
Sbjct  193  SNGNLGSLAGKKIIIPGPAQEIPTKSKMCCKS  224



>gb|KJB44100.1| hypothetical protein B456_007G234300 [Gossypium raimondii]
Length=233

 Score =   240 bits (612),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRGHADKNIVIILLGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R+VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A+   
Sbjct  135  ENQREVPTEDAKEFAQKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLVADENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                 ASL GKKI++PGP Q IP K +MCC
Sbjct  194  GNGNPASLAGKKIVIPGPAQEIPAKSNMCC  223



>gb|ACJ84079.1| unknown [Medicago truncatula]
Length=225

 Score =   239 bits (611),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA++A NVE +F TVLTEI+NIVN+K   AA+   
Sbjct  135  ENQRDVPTEDAKEFAEKEGLFFLETSALQATNVEASFMTVLTEIYNIVNKK-NLAADESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL G+KI++PGP Q IP K +MCC S
Sbjct  194  GNGNSASLLGQKIIIPGPAQEIPAKSNMCCQS  225



>gb|KEH20797.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=225

 Score =   239 bits (610),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA++A NVE +F TVLTEI+NIVN+K   AA+   
Sbjct  135  ENQRDVPTEDAKEFAEKEGLFFLETSALQATNVEASFMTVLTEIYNIVNKK-NLAADESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL G+KI++PGP Q IP K +MCC S
Sbjct  194  GNGNSASLLGQKIIIPGPAQEIPAKSNMCCQS  225



>ref|XP_010680988.1| PREDICTED: ras-related protein Rab11D [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTF+HIPRWLEELR HADKNI+IMLIGNK+DL
Sbjct  72   GQERYRAVTSAYYRGAVGALLVYDITKRQTFEHIPRWLEELRGHADKNIIIMLIGNKSDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIF IVN+K LAA E+Q 
Sbjct  132  EDQRAVATEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIFTIVNKKTLAANEDQS  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN+A    GKKILVPGPGQ IP KK +CCSS
Sbjct  192  NGNSAPQ-AGKKILVPGPGQEIPAKKGLCCSS  222



>ref|XP_003552040.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
 gb|KHN31388.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNI+N+K   AA +  
Sbjct  135  ENQRQVPTEDAKEFAEKEGLFFLETSALEATNVETAFMTVLTEIFNIINKK-NLAASDNQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
              + +ASL+GKKI+VPGP Q IP K+SMCC
Sbjct  194  GNDNSASLSGKKIIVPGPAQEIP-KRSMCC  222



>ref|XP_010027921.1| PREDICTED: ras-related protein Rab11A [Eucalyptus grandis]
 gb|KCW54570.1| hypothetical protein EUGRSUZ_I00531 [Eucalyptus grandis]
Length=225

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 128/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQ+FDHIPRWLEELR+HADKNIVI+L+GNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQSFDHIPRWLEELRSHADKNIVIILVGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+++ NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  ENQRAVPTEDAKEFAQKEGLFFLETSALDSTNVESAFLTVLTEIFNIVNKK-SLVAGESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL GKKI++PGP Q IP K  MCC +
Sbjct  194  TNGNPASLAGKKIIIPGPAQEIPAKNKMCCGT  225



>ref|XP_011022819.1| PREDICTED: ras-related protein Rab11D [Populus euphratica]
Length=223

 Score =   239 bits (609),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 2/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSA++A NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSALQATNVENAFMTVLTEIFNIVNKK-NLVAGEDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
            +    ASL+GKKI+VPGP Q IP  KS CCS
Sbjct  194  SNGNPASLSGKKIIVPGPAQEIP-AKSKCCS  223



>ref|XP_006466254.1| PREDICTED: ras-related protein Rab11A-like [Citrus sinensis]
Length=225

 Score =   238 bits (608),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDI++RQ+FDHI RWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDISRRQSFDHITRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  EEQRAVPTEDAKEFAQKEGLFFLETSALEATNVENAFMTVLTEIFNIVNKK-NLTAGEGQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                 ASL+GKKILVPGP Q IP K SMCC
Sbjct  194  GNGNPASLSGKKILVPGPAQEIPAKSSMCC  223



>ref|XP_004504100.1| PREDICTED: ras-related protein Rab11A-like [Cicer arietinum]
Length=227

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILAGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA+EA NVEEAF TVLTEI+NIVN+K   AA+   
Sbjct  136  ENQRDVPTEDAKEFAEKEGLFFLETSALEATNVEEAFMTVLTEIYNIVNKK-TLAADENH  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL  +K+++PGP Q IP K +MCC +
Sbjct  195  GNGNSASLASQKLIIPGPAQEIPAKSNMCCQA  226



>ref|XP_002864949.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41208.1| hypothetical protein ARALYDRAFT_919858 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDA+EFA+KEGLFFLETSA  A NVE AF+TVL+EIFNIVN+K   AA    
Sbjct  135  VDQRAIPTEDAREFAEKEGLFFLETSAFNATNVESAFSTVLSEIFNIVNKK-SLAASEDQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K +MCC+S
Sbjct  194  ENGNPGSLAGKKIDIVPGPGQVIPNKSNMCCNS  226



>ref|XP_010484385.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=226

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 130/153 (85%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  135  VDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLAASEDQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K ++CC+S
Sbjct  194  ENGNPGSLAGKKIDIVPGPGQVIPTKSNICCNS  226



>gb|ACU16457.1| unknown [Glycine max]
Length=229

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L GNK DL
Sbjct  78   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILTGNKCDL  137

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPT DAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  138  ENQRDVPTGDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKK-NLTADENQ  196

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL+G+KI+VPGP Q IP K++MCC S
Sbjct  197  GNGNSASLSGQKIIVPGPAQEIPAKRNMCCQS  228



>ref|XP_002310552.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|EEE91002.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 128/151 (85%), Gaps = 2/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFAQKEGLFFLETSA++A NVE AF TVLTEIFNIVN+K    A    
Sbjct  135  EDQRAVPTEDAKEFAQKEGLFFLETSALQATNVENAFMTVLTEIFNIVNKK-NLVAGEDQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
                 ASL+GKKI++PGP Q IP  KS CCS
Sbjct  194  INGNPASLSGKKIIIPGPAQEIP-AKSKCCS  223



>gb|AFK49375.1| unknown [Medicago truncatula]
Length=225

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++RDVPTEDAKEFA+KEGLFFLETSA++A NVE +F TVLTEI+N VN+K   AA+   
Sbjct  135  ENQRDVPTEDAKEFAEKEGLFFLETSALQATNVEASFMTVLTEIYNTVNKK-NLAADESQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL G+KI++PGP Q IP K +MCC S
Sbjct  194  GNGNSASLLGQKIIIPGPAQEIPAKSNMCCQS  225



>ref|XP_009129562.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
 ref|XP_009129608.1| PREDICTED: ras-related protein RABA4b [Brassica rapa]
Length=223

 Score =   237 bits (605),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 128/152 (84%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA+ A NVE +F T++ EIFN VN+K    + +  
Sbjct  135  EDQRAIPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMMEIFNTVNKK----SLSSA  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++PGPGQ +P K S CCSS
Sbjct  191  ESNNPGSLAGKKIVIPGPGQEVPAKTSTCCSS  222



>ref|XP_002531672.1| protein with unknown function [Ricinus communis]
 gb|EEF30716.1| protein with unknown function [Ricinus communis]
Length=225

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HADKNIVI+L+GNK DL
Sbjct  75   GQERYRAVTSAYYRGAVGAILVYDITKRQTFDHIPRWLEELRSHADKNIVIILVGNKCDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R VPTEDAKEFAQKEGLFFLETSA+E+ NVE AF TVLTEIFNIVN+K   A  +  
Sbjct  135  ESQRVVPTEDAKEFAQKEGLFFLETSALESTNVETAFLTVLTEIFNIVNKK-TLAGADNQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL GKKI+VPGP QVIP+ KS CCSS
Sbjct  194  TNGNPASLGGKKIVVPGPAQVIPE-KSKCCSS  224



>ref|XP_010450968.1| PREDICTED: ras-related protein RABA4b-like, partial [Camelina 
sativa]
Length=181

 Score =   235 bits (600),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  29   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  88

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  89   EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  148

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++PG GQ IP K S CC+S
Sbjct  149  ESNNPGSLAGKKIVIPGSGQDIPAKTSTCCTS  180



>ref|XP_002866902.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43161.1| hypothetical protein ARALYDRAFT_490786 [Arabidopsis lyrata subsp. 
lyrata]
Length=227

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKI++PG GQ IP K S CCSS
Sbjct  195  DSNNPGSLAGKKIVIPGSGQDIPAKTSTCCSS  226



>ref|XP_006426349.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
 gb|ESR39589.1| hypothetical protein CICLE_v10026427mg [Citrus clementina]
Length=183

 Score =   235 bits (600),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRGAVGAMLVYDI++RQ+FDHIPRWLEELR+HADKNIVI+LIGNK+DLE++
Sbjct  36   RYRAVTSAYYRGAVGAMLVYDISRRQSFDHIPRWLEELRSHADKNIVIILIGNKSDLEEQ  95

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R VPTEDAKEFAQKEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K    A       
Sbjct  96   RAVPTEDAKEFAQKEGLFFLETSALEATNVENAFMTVLTEIFNIVNKK-NLTAGEGQGNG  154

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCC  281
              ASL+GKKILVPGP Q IP K SMCC
Sbjct  155  NPASLSGKKILVPGPAQEIPAKSSMCC  181



>ref|XP_010463230.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   236 bits (603),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 130/154 (84%), Gaps = 3/154 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D+R +PTEDAKEFA+KEGLFFLETSA  A NVE AF+TVLTEIFNIVN+K   AA    
Sbjct  136  VDQRAIPTEDAKEFAEKEGLFFLETSAFNATNVESAFSTVLTEIFNIVNKK-SLAASEDQ  194

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKS-MCCSS  275
                  SL GKKI +VPGPGQVIP  KS MCC+S
Sbjct  195  ENGNPGSLAGKKIDIVPGPGQVIPTTKSNMCCNS  228



>ref|XP_006284416.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
 gb|EOA17314.1| hypothetical protein CARUB_v10005586mg, partial [Capsella rubella]
Length=250

 Score =   237 bits (605),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  98   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  157

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  158  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  217

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++PG GQ IP K S CCSS
Sbjct  218  ESNNPGSLAGKKIVIPGSGQEIPAKTSTCCSS  249



>ref|XP_010523299.1| PREDICTED: ras-related protein RABA4a-like [Tarenaya hassleriana]
Length=227

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTF+HIPRWLEELRAHAD+NIVI+LIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFEHIPRWLEELRAHADENIVIILIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+RDVPTEDAKEFA+KEGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K LA AE + 
Sbjct  134  EDQRDVPTEDAKEFAEKEGLFFLETSALNATNVESAFSTVLTEIFNIVNKKRLAGAEEEQ  193

Query  370  ngnaaASL-TGKKI-LVPGPGQVIPQKKSMCCSS  275
                 +SL  GK+I +VPGP Q IP   SMCC S
Sbjct  194  GNGNLSSLAAGKEINVVPGPAQEIPTNSSMCCKS  227



>gb|KDP29718.1| hypothetical protein JCGZ_18653 [Jatropha curcas]
Length=225

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 125/152 (82%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKCDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R VPTEDAKEFAQKEGLFFLETSA+E+ NVE +F TVLTEIFNIVN+K L A ENQ 
Sbjct  135  ESQRVVPTEDAKEFAQKEGLFFLETSALESTNVENSFLTVLTEIFNIVNKKTLTAGENQT  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN A  L+GKKI++PGPGQ IP  KS CCSS
Sbjct  195  NGNPAL-LSGKKIVIPGPGQEIP-AKSKCCSS  224



>ref|XP_010431983.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++PG GQ IP K S CC+S
Sbjct  195  ESNNPGSLAGKKIVIPGSGQDIPAKTSTCCTS  226



>ref|XP_010446581.1| PREDICTED: ras-related protein RABA4b-like [Camelina sativa]
Length=227

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++PG GQ IP K S CC+S
Sbjct  195  ESNNPGSLAGKKIVIPGSGQDIPAKTSTCCTS  226



>ref|XP_010519373.1| PREDICTED: ras-related protein RABA4a [Tarenaya hassleriana]
Length=225

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDIT+RQTFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITRRQTFDHIPRWLEELRAHADKNIVIILIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDAKEFA+KEGLFFLETSA+ A NVE AF TVLTEIFNIVN+K   AA    
Sbjct  134  EDQRAVSTEDAKEFAEKEGLFFLETSALNATNVESAFLTVLTEIFNIVNKK-SLAAAEDE  192

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
              +   SL G+KI +VPGP Q IP K SMCC S
Sbjct  193  GNSNPGSLAGRKINIVPGPAQEIPPKSSMCCKS  225



>ref|XP_010437126.1| PREDICTED: ras-related protein RABA4b [Camelina sativa]
Length=227

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEI+N VN+KNLA+ ENQG
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIYNTVNKKNLASVENQG  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKI++PG GQ IP K S CC+S
Sbjct  195  DSNNPGSLAGKKIVIPGSGQDIPAKTSTCCTS  226



>gb|KJB40355.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=225

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFAQKEGLFFLETSA+EA NVE AF TVL EIFNIVN+K    A    
Sbjct  135  ENQRAVSTEDAKEFAQKEGLFFLETSALEATNVEVAFLTVLNEIFNIVNKK-NLVAAENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +  A+L GKKI+VPGP Q IP K +MCC S
Sbjct  194  GNDNPATLAGKKIVVPGPAQDIPAKNNMCCRS  225



>ref|XP_003601931.1| GTP-binding protein [Medicago truncatula]
 gb|AES72182.1| RAB GTPase-like protein A1D [Medicago truncatula]
 gb|AFK47317.1| unknown [Medicago truncatula]
Length=222

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR +FDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHIPRWLEELRNHADKNIVIILIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA++A NVE AF TVLTEIFNIVN+K   AA+   
Sbjct  134  EEQRAVPTEDAKEFAEKEGLFFLETSALQATNVETAFMTVLTEIFNIVNKK-NLAADENQ  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +ASL+GKKI+VPGP Q IP KKSMCC
Sbjct  193  GNGNSASLSGKKIIVPGPAQEIP-KKSMCC  221



>ref|XP_007163663.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
 gb|ESW35657.1| hypothetical protein PHAVU_001G253300g [Phaseolus vulgaris]
Length=223

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+F+HIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFNHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K   AA +  
Sbjct  135  ENQRQVPTEDAKEFAEKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLAAGDSQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +ASL+GKKI+VPGP Q IP K +MCC
Sbjct  194  GNGNSASLSGKKIIVPGPAQEIP-KGNMCC  222



>gb|KFK30576.1| hypothetical protein AALP_AA7G279800 [Arabis alpina]
Length=223

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +P EDAKEFA+KEGLFFLETSA+ A NVE +F T++TEIFN VN+K         
Sbjct  135  EDQRAIPIEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIFNTVNKK----NLAST  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   SL GKKI++P PGQ IP K S CCSS
Sbjct  191  ESNNPGSLAGKKIVIPSPGQEIPVKTSSCCSS  222



>ref|NP_001237375.1| uncharacterized protein LOC100527786 [Glycine max]
 gb|ACU16959.1| unknown [Glycine max]
Length=223

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K   AA +  
Sbjct  135  ENQRQVPTEDAKEFAEKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLAAGDNQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                AASL+GK+I+VPG  Q IP K+SMCC
Sbjct  194  GNGNAASLSGKQIIVPGTAQEIP-KRSMCC  222



>gb|KHN44351.1| Ras-related protein Rab11A [Glycine soja]
Length=223

 Score =   234 bits (597),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRNHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K   AA +  
Sbjct  135  ENQRQVPTEDAKEFAEKEGLFFLETSALEATNVETAFMTVLTEIFNIVNKK-NLAAGDNQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                AASL+GK+I+VPG  Q IP K+SMCC
Sbjct  194  GNGNAASLSGKQIIVPGTAQEIP-KRSMCC  222



>ref|XP_006827843.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
 gb|ERM95259.1| hypothetical protein AMTR_s00008p00026380 [Amborella trichopoda]
Length=221

 Score =   233 bits (595),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 134/152 (88%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+PRWLEELR HADKNIVI+LIGNK+DL
Sbjct  70   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVPRWLEELRGHADKNIVIILIGNKSDL  129

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VP EDA+EFAQKEGLFFLETSA+E+ NVE AF TVLTEIFNIVN+K+L A ++Q 
Sbjct  130  EDQRVVPAEDAREFAQKEGLFFLETSALESTNVETAFLTVLTEIFNIVNKKHLVADQDQS  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGNA    +GKKI++PGP Q IP K +MCC S
Sbjct  190  NGNAPLP-SGKKIVIPGPAQEIPVKSNMCCRS  220



>ref|XP_002307071.1| GTP-BINDING protein 3 [Populus trichocarpa]
 gb|ABK93073.1| unknown [Populus trichocarpa]
 gb|EEE94067.1| GTP-BINDING protein 3 [Populus trichocarpa]
Length=223

 Score =   233 bits (594),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR+HADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRSHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTED  EFAQKEGLFFLETSA++A NVE AF T+LTEIFNIVN+K    A    
Sbjct  135  EDQRAVPTEDVNEFAQKEGLFFLETSALQATNVESAFMTLLTEIFNIVNKK-NLIAGENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +    ASL+GKKI++PGP Q IP  KS CC
Sbjct  194  SNGNPASLSGKKIIIPGPAQEIPS-KSKCC  222



>ref|XP_010555372.1| PREDICTED: ras-related protein RABA4b [Tarenaya hassleriana]
Length=224

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR+TF+HIPRWLEELRAHADKNIVI+L+GNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRETFEHIPRWLEELRAHADKNIVIILVGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDA+EFA+KE LFFLETSA+ A NVE+AF T+LTEIFN VN+K      ++G
Sbjct  135  EDQRSVPTEDAREFAEKERLFFLETSALNATNVEKAFNTLLTEIFNTVNKK---NLASEG  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKI++PGP Q IP K S+CC S
Sbjct  192  DSNIPGSLAGKKIVIPGPAQEIPTKNSVCCKS  223



>emb|CDY69836.1| BnaAnng31680D [Brassica napus]
Length=224

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 128/153 (84%), Gaps = 5/153 (3%)
 Frame = -3

Query  730  GQE-RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTD  554
            GQE RYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+D
Sbjct  75   GQESRYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSD  134

Query  553  LEDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenq  374
            LED+R +PTEDAKEFA+KEGLFFLETSA+ A NVE +F T++ EIFN VN+K    + + 
Sbjct  135  LEDQRAIPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMMEIFNTVNKK----SLSS  190

Query  373  gngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               N   SL GKKI++PGPGQ +P K S CCSS
Sbjct  191  AESNNPGSLAGKKIVIPGPGQEVPAKTSTCCSS  223



>gb|KJB18227.1| hypothetical protein B456_003G040900 [Gossypium raimondii]
Length=223

 Score =   233 bits (593),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 134/153 (88%), Gaps = 1/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK+DL
Sbjct  71   GQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNKSDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R+V TEDA EFAQKEGLFFLETSA+ AKNVE AF TVLTEIFNIVN+KNL A ENQG
Sbjct  131  EKQREVSTEDATEFAQKEGLFFLETSALAAKNVETAFLTVLTEIFNIVNKKNLVAGENQG  190

Query  370  ngnaa-ASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN+   SL GKKI++PGP Q IP K++MCC S
Sbjct  191  NGNSNPTSLAGKKIIIPGPAQEIPAKRNMCCRS  223



>ref|XP_010926325.1| PREDICTED: ras-related protein Rab11D-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926326.1| PREDICTED: ras-related protein Rab11D-like isoform X2 [Elaeis 
guineensis]
Length=218

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQTFDHIPRWLEELR+HADKNIVIML+GNKTDL
Sbjct  69   GQERYRAVTSAYYRGAVGALLVYDITKRQTFDHIPRWLEELRSHADKNIVIMLVGNKTDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDA EFAQKE LFFLETSA+EA NVE AF TVLTEIF IVNRK         
Sbjct  129  EDQRAVTTEDASEFAQKENLFFLETSALEATNVETAFETVLTEIFTIVNRK--NLVSEPQ  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  +L+GKK+L+PGP Q IP+ K MCC +
Sbjct  187  GNGNGPALSGKKLLIPGPAQAIPKNK-MCCQT  217



>ref|XP_006404694.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
 gb|ESQ46147.1| hypothetical protein EUTSA_v10000314mg [Eutrema salsugineum]
Length=227

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR++FDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRESFDHIPRWLEELRAHADKNIVIILIGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VP EDAKEFA+KE LFFLETSA+ + NVE +F T+LTEIFN VN+KNL+++ENQG
Sbjct  136  EDQRSVPMEDAKEFAEKEELFFLETSALNSTNVENSFNTLLTEIFNTVNKKNLSSSENQG  195

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              N   S+ GKKI++PG  Q IP K +MCC+S
Sbjct  196  GSNNHGSMAGKKIVIPGHAQEIPTKSTMCCNS  227



>emb|CDX69843.1| BnaA10g21920D [Brassica napus]
Length=223

 Score =   231 bits (590),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADKNIVIILVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R + TEDAKEFA+ EGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K         
Sbjct  134  EDQRAISTEDAKEFAETEGLFFLETSALNAVNVETAFSTVLTEIFNIVNKK---NLVAGE  190

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGP QVIP K  MCC+S
Sbjct  191  GNGDPGSLAGKKIDIVPGPAQVIPTKSGMCCNS  223



>ref|NP_195709.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
 sp|Q9SMQ6.1|RAA4B_ARATH RecName: Full=Ras-related protein RABA4b; Short=AtRABA4b; AltName: 
Full=Ras-related protein GB3; Short=AtGB3; AltName: Full=Ras-related 
protein Rab11G; Short=AtRab11G [Arabidopsis thaliana]
 emb|CAB38912.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 emb|CAB80662.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAL62440.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AAM91314.1| GTP-binding protein GB3 [Arabidopsis thaliana]
 gb|AEE87150.1| GTP-binding protein ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++T+I+N VN+K      ++G
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKK---NLASEG  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKIL+PG GQ IP K S CC+S
Sbjct  192  DSNNPGSLAGKKILIPGSGQEIPAKTSTCCTS  223



>ref|XP_010273010.1| PREDICTED: ras-related protein Rab11A-like [Nelumbo nucifera]
Length=225

 Score =   231 bits (590),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 124/152 (82%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAML YDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLAYDITKRQSFDHIPRWLEELRGHADKNIVIILIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDA+EFA+KEGLFFLETSA+EA NVE AF T+LTEIFNIVN+K    A    
Sbjct  134  ENQRAVSTEDAREFAEKEGLFFLETSALEATNVETAFLTILTEIFNIVNKK-NLVAGEDQ  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SL+GKKI++PGP Q IP K  MCC S
Sbjct  193  GNGNPGSLSGKKIIIPGPAQEIPPKSKMCCKS  224



>gb|KHG00253.1| Ras-related Rab11A [Gossypium arboreum]
Length=223

 Score =   231 bits (589),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 131/153 (86%), Gaps = 1/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA GAMLVYD+TKRQTF+HI RWLEELR HADKNIVIML+GNK+DL
Sbjct  71   GQERYRAVTSAYYRGAAGAMLVYDVTKRQTFNHIARWLEELRGHADKNIVIMLVGNKSDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R+V TEDA EFAQKEGLFFLETSA+ AKNVE AF TVLTEIFNIVN+KNL A ENQ 
Sbjct  131  EKQREVSTEDATEFAQKEGLFFLETSALAAKNVETAFLTVLTEIFNIVNKKNLVAGENQW  190

Query  370  ngnaa-ASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN    SL GKKI++PGP Q IP K +MCC S
Sbjct  191  NGNGNPTSLAGKKIIIPGPAQEIPAKSNMCCRS  223



>ref|XP_006399529.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
 gb|ESQ40982.1| hypothetical protein EUTSA_v10014596mg [Eutrema salsugineum]
Length=225

 Score =   231 bits (589),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 128/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADKNIVIILIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +  EDAKEFA+KEGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K    A    
Sbjct  134  EDQRAISMEDAKEFAEKEGLFFLETSALNAVNVETAFSTVLTEIFNIVNKK-NLVAGEGQ  192

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                AASL GKKI +VPGP QVIP K  +CC+S
Sbjct  193  GNGDAASLAGKKINIVPGPAQVIPTKNRLCCNS  225



>ref|XP_010917311.1| PREDICTED: ras-related protein Rab11D-like [Elaeis guineensis]
Length=218

 Score =   231 bits (588),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKRQ+FDHIPRWLEELR+HADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGAVGALLVYDITKRQSFDHIPRWLEELRSHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDA EFAQKE LFFLETSA+EA+NVE AF TVLTEIFNI+N+K      +  
Sbjct  129  EDQRAVSTEDASEFAQKENLFFLETSALEARNVETAFQTVLTEIFNIINKK--TVVSDPQ  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                A +L+GKKI++PGP Q IP+ K MCC +
Sbjct  187  GNGNAPTLSGKKIVIPGPAQEIPKNK-MCCQT  217



>gb|AAA87884.1| ATGB3 [Arabidopsis thaliana]
Length=224

 Score =   231 bits (589),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++T+I+N VN+K      ++ 
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKK---NLASEC  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKIL+PG GQ IP K S CC+S
Sbjct  192  DSNNPGSLAGKKILIPGSGQEIPAKTSTCCTS  223



>ref|XP_009122063.1| PREDICTED: ras-related protein RABA4a-like [Brassica rapa]
 gb|AAZ67615.1| 80A08_30 [Brassica rapa subsp. pekinensis]
 emb|CDX96994.1| BnaC09g46310D [Brassica napus]
Length=223

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADKNIVIILVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R + TEDAKEFA+ EGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K         
Sbjct  134  EDQRAISTEDAKEFAETEGLFFLETSALNAVNVETAFSTVLTEIFNIVNKK---NLVAGE  190

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGP QV+P K  MCC+S
Sbjct  191  GNGDPGSLAGKKIDIVPGPAQVVPTKSGMCCNS  223



>gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis thaliana]
Length=224

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKR+TF+HIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDMTKRETFEHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R VPTEDAKEFA+KEGLFFLETSA+ A NVE +F T++T+I+N VN+K      ++G
Sbjct  135  EDQRAVPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTQIYNTVNKK---NLASEG  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N   SL GKKIL+P  GQ IP K S CC+S
Sbjct  192  DSNNPGSLAGKKILIPASGQEIPAKTSTCCTS  223



>gb|EYU30990.1| hypothetical protein MIMGU_mgv1a0261472mg, partial [Erythranthe 
guttata]
Length=140

 Score =   225 bits (574),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = -3

Query  700  AYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRRDVPTED  521
            AYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVI+LIGNK DLED+R VPTED
Sbjct  1    AYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIILIGNKNDLEDQRAVPTED  60

Query  520  AKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngnaaASLTG  341
            AKEFAQ EGLFFLETSA+EA NVEEAF+TVLTEIFNIVN+K     + +  G A++SL+G
Sbjct  61   AKEFAQTEGLFFLETSALEATNVEEAFSTVLTEIFNIVNKK-NLVEDGENAGPASSSLSG  119

Query  340  KKILVPGPGQVIPQKKSMCCSS  275
            KKILVPGP Q+IP+KK +CC S
Sbjct  120  KKILVPGPAQIIPEKK-VCCRS  140



>ref|XP_010453062.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=229

 Score =   228 bits (581),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 3/155 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R + TEDA+EFA+KEGLFFLETSA+ A NVE AF+TVLTEIFN VN+K+L       
Sbjct  135  EDQRAISTEDAQEFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNFVNKKSLVDFGEGQ  194

Query  370  ngnaa--ASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
              N    ASL GKKI +VPGPGQVIP K  +CC++
Sbjct  195  GTNNGDPASLAGKKIDIVPGPGQVIPTKSRLCCNT  229



>ref|XP_010491702.1| PREDICTED: ras-related protein RABA4a-like [Camelina sativa]
Length=228

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 134/154 (87%), Gaps = 2/154 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +  EDAKEFA+KEGLFFLETSA+ A NVE AF+TVLTEIFN VN+K+L A E QG
Sbjct  135  EDQRAISMEDAKEFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNFVNKKSLVAGEGQG  194

Query  370  ngnaa-ASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
            + N   ASL GKKI +VPGPGQVIP K  +CC++
Sbjct  195  DNNGDPASLAGKKIDIVPGPGQVIPTKSRLCCNT  228



>ref|XP_010422850.1| PREDICTED: ras-related protein RABA4a-like isoform X1 [Camelina 
sativa]
Length=228

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 133/154 (86%), Gaps = 2/154 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R + TEDAK FA+KEGLFFLETSA+ A NVE AF+TVLTEIFN VN+K+L A E QG
Sbjct  135  EDQRAISTEDAKGFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNFVNKKSLVAGEGQG  194

Query  370  ngnaa-ASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
              +   ASL GKKI +VPGPGQVIP K  +CC++
Sbjct  195  TNDGDPASLAGKKIDIVPGPGQVIPTKSRLCCNT  228



>ref|XP_009390909.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   227 bits (579),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDHIPRWLEELR+HAD+NIVIML+GNKTDL
Sbjct  70   GQERYRAVTSAYYRGAVGALLVYDVTKRQSFDHIPRWLEELRSHADRNIVIMLVGNKTDL  129

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDA+EFAQKE LFFLETSA+EA NVE AF TVLTEIFNIVN+KNL +     
Sbjct  130  EDQRAVTTEDAREFAQKENLFFLETSALEATNVENAFQTVLTEIFNIVNKKNLTSDPQSN  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            N        GKKI+VPGP Q IP  K+ C +S
Sbjct  190  NAAPTQP--GKKIIVPGPAQEIPTNKTCCNTS  219



>ref|XP_008804800.1| PREDICTED: ras-related protein Rab11A-like [Phoenix dactylifera]
Length=191

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 125/149 (84%), Gaps = 3/149 (2%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRGAVGA+LVYDITKRQ+FDHIPRWLEELR+HADKNIVIML+GNKTDLED+
Sbjct  45   RYRAVTSAYYRGAVGALLVYDITKRQSFDHIPRWLEELRSHADKNIVIMLVGNKTDLEDQ  104

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R V TEDA EFAQKE LFFLETSA+EA+NVE AF TVLTEIFNIVN+K      +     
Sbjct  105  RAVSTEDASEFAQKENLFFLETSALEARNVETAFQTVLTEIFNIVNKK--TVVSDPQGNG  162

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             A +L+GKKI++PGP Q IP+ K MCC +
Sbjct  163  NAPTLSGKKIVIPGPAQEIPKNK-MCCQA  190



>ref|XP_002871417.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47676.1| hypothetical protein ARALYDRAFT_325580 [Arabidopsis lyrata subsp. 
lyrata]
Length=226

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR +ADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRNNADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +  EDAK+FA+KEGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K    A    
Sbjct  135  EDQRAISMEDAKDFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNIVNKK-SLVAGEGE  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                  SL GKKI +VPGPGQVIP K  +CC++
Sbjct  194  GNGDPGSLAGKKIDIVPGPGQVIPTKNKLCCNT  226



>gb|KFK25337.1| hypothetical protein AALP_AA8G099600 [Arabis alpina]
Length=222

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVTRRQTFDHIPRWLEELRGHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +  EDAKEFA+KEGLFFLETSA+ A NVE AF+TVLTEIFNIVN+K         
Sbjct  135  EDQRAISIEDAKEFAEKEGLFFLETSALNAVNVETAFSTVLTEIFNIVNKK---NLVAGE  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                  SL GKKI + GP QV+P K S+CC+S
Sbjct  192  EQGDTGSLAGKKIEM-GPAQVVPSKNSLCCNS  222



>ref|XP_006290108.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
 gb|EOA23006.1| hypothetical protein CARUB_v10003752mg [Capsella rubella]
Length=226

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 2/153 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T++QTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDVTRQQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +  +DAKEFA+KEGLFFLETSA+ A NVE AF+TVLTEIFN+VN+K   AA+   
Sbjct  135  EDQRAISMDDAKEFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNVVNKK-SLAADEGQ  193

Query  370  ngnaaASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
                 ASL GKKI +VPGPGQVIP K   CC++
Sbjct  194  GDGDPASLAGKKIDIVPGPGQVIPTKNRWCCNT  226



>gb|KHG08307.1| Ras-related Rab11A [Gossypium arboreum]
Length=224

 Score =   225 bits (574),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HADKNIV++LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHADKNIVVILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAK+FAQKE LFFLETSA+EA NVE AF TVL EIFNIVN+K    A    
Sbjct  135  ENQRAVSTEDAKDFAQKEELFFLETSALEATNVEAAFLTVLNEIFNIVNKK-NLVATENQ  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +  A+L GKKI+VPGP Q IP  K+MCC S
Sbjct  194  GNDNPATLAGKKIVVPGPAQEIP-AKNMCCRS  224



>gb|KJB40356.1| hypothetical protein B456_007G060000 [Gossypium raimondii]
Length=223

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQER  AVTSAYYRGAVGAMLVYDI+KRQTFDHIPRWLEELR HADKNIVI+LIGNK+DL
Sbjct  75   GQER--AVTSAYYRGAVGAMLVYDISKRQTFDHIPRWLEELRGHADKNIVIILIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFAQKEGLFFLETSA+EA NVE AF TVL EIFNIVN+K    A    
Sbjct  133  ENQRAVSTEDAKEFAQKEGLFFLETSALEATNVEVAFLTVLNEIFNIVNKK-NLVAAENQ  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +  A+L GKKI+VPGP Q IP K +MCC S
Sbjct  192  GNDNPATLAGKKIVVPGPAQDIPAKNNMCCRS  223



>ref|XP_009413627.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=218

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA++VYDIT+RQ+FDHI RWLEELR+HAD+NIVIML+GNKTDL
Sbjct  69   GQERYRAVTSAYYRGAVGALMVYDITRRQSFDHISRWLEELRSHADRNIVIMLVGNKTDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDA+EFAQKE LFFLETSA+EA NVE AF  VLTEIFNIVN+K      +  
Sbjct  129  EDQRAVTTEDAREFAQKENLFFLETSALEATNVENAFQMVLTEIFNIVNKK--NLTSDPQ  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N+A +L GKK+++PGP Q IP+ K+ C +S
Sbjct  187  SNNSAPALPGKKVIIPGPAQEIPKSKTCCKTS  218



>ref|NP_001149604.1| LOC100283230 [Zea mays]
 ref|XP_008643733.1| PREDICTED: LOC100283230 isoform X1 [Zea mays]
 gb|ACG36036.1| ras-related protein Rab11D [Zea mays]
 gb|ACN35232.1| unknown [Zea mays]
 gb|AFW68869.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED R V TEDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K    A +  
Sbjct  129  EDERAVSTEDAKEFAEKENLFFLETSALQATNVENAFQTVLTEIFKIHSKK--NMAADPR  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               AA SL GKK++VPGP Q IP  KS CCSS
Sbjct  187  ANGAAPSLAGKKVIVPGPAQEIP--KSKCCSS  216



>ref|XP_009393549.1| PREDICTED: ras-related protein Rab11D-like [Musa acuminata subsp. 
malaccensis]
Length=219

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA++VYDIT+RQ FDHIPRWLEELR+HADKNIVIML+GNKTDL
Sbjct  70   GQERYRAVTSAYYRGAVGALIVYDITRRQCFDHIPRWLEELRSHADKNIVIMLVGNKTDL  129

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +R VP EDA+EFAQKE LFFLETSA++A NVE AF TVLTEIFNIVN+K  +   +  
Sbjct  130  EGQRAVPMEDAREFAQKENLFFLETSALDATNVENAFQTVLTEIFNIVNKK--SLTSDPQ  187

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            + N+A +L  KKI++PGP Q IP+ K +CC +
Sbjct  188  SNNSAPTLPAKKIIIPGPAQEIPKSK-VCCKA  218



>ref|XP_004983071.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E+ R V TEDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K    A +  
Sbjct  129  EEERAVSTEDAKEFAEKENLFFLETSALQATNVENAFQTVLTEIFKIHSKK--NMAADPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               AA SL GKK+LVPGP Q IP  KS CCSS
Sbjct  187  ANGAAPSLAGKKVLVPGPAQEIP--KSKCCSS  216



>gb|ABK22282.1| unknown [Picea sitchensis]
Length=219

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+PRWLEELR HAD NIVIML+GNK DL
Sbjct  68   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVPRWLEELRNHADNNIVIMLVGNKCDL  127

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ++ R VPTEDAKEFAQKEGLFFLETSAMEA NVE AF TVLTEIF IV++K    A    
Sbjct  128  DNLRAVPTEDAKEFAQKEGLFFLETSAMEATNVETAFLTVLTEIFKIVSKK-SLIASQDQ  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                 ASL+G  I+VPG  Q    KK  CC+S
Sbjct  187  GNGNHASLSGTSIVVPGQEQDTTTKKKSCCTS  218



>ref|NP_001064476.1| Os10g0377400 [Oryza sativa Japonica Group]
 gb|ABB47387.1| Ras-related protein Rab11D, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26390.1| Os10g0377400 [Oryza sativa Japonica Group]
 dbj|BAG99455.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC66844.1| hypothetical protein OsI_33317 [Oryza sativa Indica Group]
 gb|EEE50861.1| hypothetical protein OsJ_31310 [Oryza sativa Japonica Group]
Length=216

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  68   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  127

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K    A +  
Sbjct  128  EDERAVSTEDAKEFAEKENLFFLETSALQATNVENAFQTVLSEIFKIHSKK--NMAADPK  185

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               AA SL GKK++VPGP Q IP  KS CCSS
Sbjct  186  ANGAAPSLAGKKVVVPGPAQEIP--KSKCCSS  215



>emb|CDX69367.1| BnaC01g00860D [Brassica napus]
Length=184

 Score =   220 bits (560),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 125/149 (84%), Gaps = 4/149 (3%)
 Frame = -3

Query  718  YRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRR  539
            YRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+DLED+R
Sbjct  38   YRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSDLEDQR  97

Query  538  DVPTE-DAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
             + TE DAKEFA+KEGLFFLETSA+ A NVE +F T+++EIFN VN+K   +  + G  N
Sbjct  98   AISTEDDAKEFAEKEGLFFLETSALNATNVENSFNTLMSEIFNTVNKK---SLSSVGESN  154

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               SL GKK+++PGPGQ +P K S CCSS
Sbjct  155  NPGSLAGKKLVIPGPGQEVPAKTSTCCSS  183



>ref|XP_003573862.1| PREDICTED: ras-related protein Rab11D-like [Brachypodium distachyon]
Length=216

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  68   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  127

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED R V TEDAKEFA+KE +FFLETSA++A NVE AF TVL+EIF I ++K    A    
Sbjct  128  EDERAVSTEDAKEFAEKENVFFLETSALQATNVENAFQTVLSEIFKIHSKK--NIAAEPK  185

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               +A SL GKK+LVPGP Q IP  KS CCSS
Sbjct  186  ANGSAPSLAGKKVLVPGPAQEIP--KSKCCSS  215



>ref|XP_006662306.1| PREDICTED: ras-related protein Rab11D-like [Oryza brachyantha]
Length=214

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  66   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  125

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K    A +  
Sbjct  126  EDERAVSTEDAKEFAEKENLFFLETSALQATNVENAFQTVLSEIFKIHSKK--NMAADPK  183

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               A  SL GKK++VPGP Q IP  KS CCSS
Sbjct  184  ANGAVPSLAGKKVVVPGPAQEIP--KSKCCSS  213



>ref|XP_008782165.1| PREDICTED: ras-related protein Rab11D-like [Phoenix dactylifera]
Length=218

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 124/150 (83%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYDITKR +FDHIPRWLEELR+HADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGAVGALLVYDITKRPSFDHIPRWLEELRSHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R V TEDA EFA+KE LFFLETSA+EA NVE AF TVLTEIFNIV++K      +  
Sbjct  129  EDQRAVSTEDATEFAEKENLFFLETSALEATNVETAFQTVLTEIFNIVSKK--NLVSDPQ  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
               +  +L+GKKI+VPGP Q IP K  +CC
Sbjct  187  GNGSGPALSGKKIVVPGPAQEIP-KNRLCC  215



>ref|XP_002489255.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
 gb|EES20260.1| hypothetical protein SORBIDRAFT_0012s021070 [Sorghum bicolor]
Length=217

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E+ R V +EDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K    A +  
Sbjct  129  EEERAVSSEDAKEFAEKENLFFLETSALQATNVENAFQTVLTEIFKIHSKK--NMAADPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               AA SL GKK++VPGP Q IP  KS CCSS
Sbjct  187  ANGAAPSLAGKKVIVPGPAQEIP--KSKCCSS  216



>ref|XP_004985399.1| PREDICTED: ras-related protein Rab11D-like [Setaria italica]
Length=217

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 126/152 (83%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K         
Sbjct  129  EEQRAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLTEIFKIHSKK--NMVSEPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  AA ++ GKK+LVPGP Q IP  KS CCSS
Sbjct  187  SNGAAPAMPGKKVLVPGPAQEIP--KSKCCSS  216



>ref|XP_010422851.1| PREDICTED: ras-related protein RABA4a-like isoform X2 [Camelina 
sativa]
Length=226

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQER  AVTSAYYRGAVGAMLVYD+++RQTFDHIPRWLEELR HADKNIVI+L+GNK+DL
Sbjct  75   GQER--AVTSAYYRGAVGAMLVYDVSRRQTFDHIPRWLEELRNHADKNIVIILVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R + TEDAK FA+KEGLFFLETSA+ A NVE AF+TVLTEIFN VN+K+L A E QG
Sbjct  133  EDQRAISTEDAKGFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNFVNKKSLVAGEGQG  192

Query  370  ngnaa-ASLTGKKI-LVPGPGQVIPQKKSMCCSS  275
              +   ASL GKKI +VPGPGQVIP K  +CC++
Sbjct  193  TNDGDPASLAGKKIDIVPGPGQVIPTKSRLCCNT  226



>dbj|BAJ93377.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=216

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNI+IML+GNK+DL
Sbjct  68   GQERYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIIIMLVGNKSDL  127

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K      +  
Sbjct  128  EDERAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLSEIFKIHSKK--NIVTDPK  185

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               AA  L GKK+LVPGP Q IP  KS CC S
Sbjct  186  ANGAAPPLAGKKVLVPGPAQEIP--KSKCCGS  215



>ref|XP_002465727.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
 gb|EER92725.1| hypothetical protein SORBIDRAFT_01g044550 [Sorghum bicolor]
Length=217

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K         
Sbjct  129  EEQRAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLTEIFKIHSKK--NMVSEPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   A ++ G K+LVPGP Q IP  KS CCSS
Sbjct  187  SNGVAPAMAGTKVLVPGPAQEIP--KSKCCSS  216



>ref|NP_001151068.1| ras-related protein Rab11D [Zea mays]
 ref|NP_001152898.1| uncharacterized protein LOC100272235 [Zea mays]
 gb|ACF82205.1| unknown [Zea mays]
 gb|ACG41502.1| ras-related protein Rab11D [Zea mays]
 gb|AFW89417.1| Ras protein Rab11D [Zea mays]
Length=217

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFA+KE LFFLETSA++A NVE AF TVLTEIF I ++K         
Sbjct  129  EEQRAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLTEIFKIHSKK--NMVSEPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  AA ++ G K+LVPGP Q IP  KS CCSS
Sbjct  187  SNGAAPAMPGTKVLVPGPAQEIP--KSKCCSS  216



>ref|NP_001151560.1| ras-related protein Rab11D [Zea mays]
 gb|ACF88435.1| unknown [Zea mays]
 gb|ACG43327.1| ras-related protein Rab11D [Zea mays]
 tpg|DAA43812.1| TPA: Ras protein Rab11D [Zea mays]
Length=217

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GA+LVYDIT+RQ+FDHIPRWL+ELRAHADKNIVIML+GNK+DL
Sbjct  69   GQERYRAVTSAYYRGALGALLVYDITRRQSFDHIPRWLDELRAHADKNIVIMLVGNKSDL  128

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E++R V TEDAKEFA+KE LFFLETSA++A NVE +F TVLTEIF I ++K         
Sbjct  129  EEQRAVSTEDAKEFAEKENLFFLETSALQATNVESSFQTVLTEIFKIHSKK--NMVSEPK  186

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  AA ++ G K+LVPGP Q IP  KS CCSS
Sbjct  187  SNGAAPAMPGTKVLVPGPAQEIP--KSKCCSS  216



>gb|EMT25488.1| Ras-related protein Rab11D [Aegilops tauschii]
Length=167

 Score =   213 bits (543),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DLED 
Sbjct  22   RYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLEDE  81

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K      +     
Sbjct  82   RAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLSEIFKIHSKK--NIVTDPKANG  139

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            AA  L GKK+LVPGP Q IP  KS CCSS
Sbjct  140  AAPPLAGKKVLVPGPAQEIP--KSKCCSS  166



>emb|CDX69369.1| BnaC01g00840D [Brassica napus]
Length=408

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 122/140 (87%), Gaps = 3/140 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR+TFDHIPRWLEELRAHADKNIVI+LIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRETFDHIPRWLEELRAHADKNIVIILIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            ED+R +PTEDAKEFA+KEGLFFLETSA+ A NVE +F T++TEIFN VN+K   +  + G
Sbjct  135  EDQRAIPTEDAKEFAEKEGLFFLETSALNATNVENSFNTLMTEIFNTVNKK---SLSSVG  191

Query  370  ngnaaASLTGKKILVPGPGQ  311
              N   SL G+KI++PGPGQ
Sbjct  192  ESNNPGSLAGQKIVIPGPGQ  211



>gb|AAM08543.1|AC079935_15 Putative Ras-related protein Rab [Oryza sativa Japonica Group]
Length=202

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 122/149 (82%), Gaps = 4/149 (3%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            +YRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DLED 
Sbjct  57   KYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLEDE  116

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K    A +     
Sbjct  117  RAVSTEDAKEFAEKENLFFLETSALQATNVENAFQTVLSEIFKIHSKK--NMAADPKANG  174

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            AA SL GKK++VPGP Q IP  KS CCSS
Sbjct  175  AAPSLAGKKVVVPGPAQEIP--KSKCCSS  201



>gb|EMS58443.1| Ras-related protein Rab11D [Triticum urartu]
Length=216

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 120/149 (81%), Gaps = 4/149 (3%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRGA+GA+LVYDITKRQ+FDHIPRWLEELR HADKNIVIML+GNK+DLED 
Sbjct  71   RYRAVTSAYYRGALGALLVYDITKRQSFDHIPRWLEELRGHADKNIVIMLVGNKSDLEDE  130

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R V TEDAKEFA+KE LFFLETSA++A NVE AF TVL+EIF I ++K      +     
Sbjct  131  RAVSTEDAKEFAEKENLFFLETSALQATNVESAFQTVLSEIFKIHSKK--NIVTDPKANG  188

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            AA  L GKK+LVPGP Q IP  KS CCSS
Sbjct  189  AAPPLAGKKVLVPGPAQEIP--KSKCCSS  215



>emb|CBI33135.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 99/111 (89%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHIPRWLEELR HADKNIVI+LIGNKTDL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIPRWLEELRGHADKNIVIILIGNKTDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRK  398
            E++R VPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEIFNIVN+K
Sbjct  135  EEQRAVPTEDAKEFAEKEGLFFLETSALEATNVENAFLTVLTEIFNIVNKK  185



>ref|XP_003532818.1| PREDICTED: ras-related protein Rab11A-like [Glycine max]
Length=209

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELR HADKNIVI+LIGNK DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRNHADKNIVIILIGNKCDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E +RDVPTEDAKEFA+KEGLFFLETSA+EA NVE AF TVLTEI+NIVN+K    A+   
Sbjct  136  ESQRDVPTEDAKEFAEKEGLFFLETSALEATNVETAFITVLTEIYNIVNKK-NLTADENQ  194

Query  370  ngnaaASLTGKKIL  329
                +ASL+G+KI+
Sbjct  195  GNGNSASLSGQKII  208



>ref|XP_006660497.1| PREDICTED: ras-related protein RGP1-like [Oryza brachyantha]
Length=226

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVTRWLEELRGHADKNIVIMLIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+E+ NVE+AF TVLTEI+ IV++KNL A E   
Sbjct  135  GTLRVVPTEDAKEFAERESLFFMETSALESTNVEDAFMTVLTEIYRIVSKKNLVANEETD  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   ++ LTG KI+VPG     P K S C SS
Sbjct  195  SSGNSSLLTGTKIVVPGQEPPAPAKASCCMSS  226



>emb|CDP07731.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  78   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  137

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E  RDV T+DAKEFAQKE L+F+ETSA+EA NVE AF TVLTEI+ IV++K+L A E   
Sbjct  138  ESLRDVSTDDAKEFAQKENLYFMETSALEATNVEPAFITVLTEIYRIVSKKSLVANEEAE  197

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   +A LTG KI+VP    V    K  CC S
Sbjct  198  SEGKSALLTGTKIVVPSQEPVPGGTKYSCCGS  229



>ref|XP_006366509.1| PREDICTED: ras-related protein RGP1-like [Solanum tuberosum]
Length=226

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVIML+GNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVIMLVGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA+KE LFF+ETSA+EA NV+ AF  VLTEI+ +V++K+L A E + 
Sbjct  134  GSLRAVPTEDAKEFAEKENLFFIETSALEATNVDTAFVNVLTEIYRVVSKKSLVANEAES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               ++A L GK+I+VPG G V       CC S
Sbjct  194  TAGSSALLRGKEIVVPGQGLVPSGSSYSCCRS  225



>ref|XP_004229604.1| PREDICTED: ras-related protein RGP1 [Solanum lycopersicum]
Length=225

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVIML+GNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVIMLVGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA+KE LFF+ETSA+E+ NV+ AF  VLTEI+ +V++K+L A E + 
Sbjct  134  GSLRAVPTEDAKEFAEKENLFFIETSALESTNVDTAFVNVLTEIYRVVSKKSLVANEAES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
               ++A L GK+I+VPG G V       CC S
Sbjct  194  AAGSSALLRGKEIVVPGQGPVPSGSSYSCCRS  225



>ref|XP_010265793.1| PREDICTED: ras-related protein RGP1-like [Nelumbo nucifera]
Length=223

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVTRWLDELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ E LFF+ETSA+EA NVE AF T+LTEI+ I+++K L A E + 
Sbjct  133  STLRTVPTEDAKEFAQSENLFFMETSALEATNVENAFLTILTEIYRIISKKTLVANEAET  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G++   L G KI+VPG  +   +KKS CC S
Sbjct  193  AGHSTL-LKGTKIIVPGQEKRANEKKSACCMS  223



>gb|ABK25126.1| unknown [Picea sitchensis]
Length=224

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HAD NIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADNNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             + R VP EDA+EFAQ+EGLFFLETSA+EA NVE AF TVLT+I+ I+++K L A ++QG
Sbjct  133  GNLRAVPIEDAREFAQREGLFFLETSALEAINVESAFLTVLTDIYRIISKKALIANDDQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            NGN+A  LTG K++VPG  Q +      CCSS
Sbjct  193  NGNSAL-LTGTKLVVPGEEQDVSTNNKYCCSS  223



>ref|XP_010695403.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=229

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVI+LIGNKTDL
Sbjct  77   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVSRWLEELRGHADKNIVIILIGNKTDL  136

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R V  EDAKEFA++EGLFFLETSA+EA NVE AF TVLTEI+ ++++K L A +   
Sbjct  137  GSLRAVSLEDAKEFAEREGLFFLETSALEALNVETAFLTVLTEIYRVISKKTLVANDEAD  196

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +  L+GK I++ G GQ     K  CC
Sbjct  197  AAGTSNLLSGKHIVLTGQGQTSVGGKYSCC  226



>sp|P25766.2|RLGP1_ORYSJ RecName: Full=Ras-related protein RGP1; AltName: Full=GTP-binding 
regulatory protein RGP1 [Oryza sativa Japonica Group]
 dbj|BAD29646.1| putative ras-related GTP-binding protein [Oryza sativa Japonica 
Group]
 gb|EEE69346.1| hypothetical protein OsJ_28668 [Oryza sativa Japonica Group]
Length=226

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+E+ NVE AF TVLTEI+ IV++KNL A E   
Sbjct  136  GTLRVVPTEDAKEFAERENLFFMETSALESTNVENAFMTVLTEIYRIVSKKNLVANEEVD  195

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
            +   ++ L G KI+VPG     P K S C S
Sbjct  196  SSGNSSLLKGTKIVVPGQEPAPPTKASCCMS  226



>ref|XP_004956465.1| PREDICTED: ras-related protein RGP1-like [Setaria italica]
Length=222

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  71   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVVRWLEELRGHADKNIVIMLIGNKSDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+EA NVE AF TVLTEI+ IV++KNL A E   
Sbjct  131  GTLRAVPTEDAKEFAERENLFFMETSALEATNVESAFMTVLTEIYRIVSKKNLVANEESD  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  +++ L G KI++PG  +  P  K+ CC S
Sbjct  191  SSGSSSLLKGTKIVIPGQ-EPPPASKATCCMS  221



>ref|XP_009399667.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=228

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 122/153 (80%), Gaps = 3/153 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HAD+NIVIMLIGNK+DL
Sbjct  77   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADRNIVIMLIGNKSDL  136

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+E+ NVE AF TVLTEI  IV++K+LAA +   
Sbjct  137  GSLRAVPTEDAKEFAQRESLFFMETSALESTNVESAFQTVLTEIHRIVSKKSLAANDEAQ  196

Query  370  ngnaaASLTGKKILVPGPGQVIPQ-KKSMCCSS  275
            +   ++ L G  I+V  PGQ  P   K+ CCSS
Sbjct  197  SAGNSSLLKGTSIVV--PGQDPPSANKATCCSS  227



>emb|CAA41966.1| GTP-binding protein [Oryza sativa]
 prf||1718315A GTP-binding protein
Length=226

 Score =   205 bits (522),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+E+ N+E AF TVLTEI+ IV++KNL A E   
Sbjct  136  GTLRVVPTEDAKEFAERENLFFMETSALESTNLENAFMTVLTEIYRIVSKKNLVANEEVD  195

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
            +   ++ L G KI+VPG     P K S C S
Sbjct  196  SSGNSSLLKGTKIVVPGQEPAPPTKASCCMS  226



>ref|XP_010102630.1| Ras-related protein RGP1 [Morus notabilis]
 gb|EXB93780.1| Ras-related protein RGP1 [Morus notabilis]
Length=224

 Score =   205 bits (522),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 121/150 (81%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+E+ NVE AF TVLTEI+ ++++K L A E Q 
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALESTNVESAFLTVLTEIYRVISKKALIANEEQE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
               +++ L G KI+VPG  +  P + S CC
Sbjct  193  ALGSSSLLKGTKIVVPGQ-EPEPVRSSSCC  221



>ref|XP_010067891.1| PREDICTED: ras-related protein RABA4c-like [Eucalyptus grandis]
 gb|KCW66128.1| hypothetical protein EUGRSUZ_G03398 [Eucalyptus grandis]
Length=224

 Score =   205 bits (521),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/153 (70%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELRGHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K L A +   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALEATNVETAFLTVLTEIYRIISKKALVANDEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSM-CCSS  275
            +G ++  L G KI+VPG  +  PQ K+  CCSS
Sbjct  193  SGGSSL-LQGTKIVVPGQ-EPEPQGKTFSCCSS  223



>ref|XP_006421492.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 ref|XP_006490035.1| PREDICTED: ras-related protein RABA4d-like [Citrus sinensis]
 gb|ESR34732.1| hypothetical protein CICLE_v10005824mg [Citrus clementina]
 gb|KDO57267.1| hypothetical protein CISIN_1g027382mg [Citrus sinensis]
Length=224

 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLDELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K+L A +   
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTVLTEIYRIISKKSLTANDEHD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +  L G +I+VPG  Q    K+  C SS
Sbjct  193  VAGNSNLLKGTRIIVPGQDQNSASKRGCCLSS  224



>ref|XP_002459958.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
 gb|EER96479.1| hypothetical protein SORBIDRAFT_02g018890 [Sorghum bicolor]
Length=226

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R V TEDAKEFA++E LFF+ETSA+EA NVE AF TVLTEI+ +V++KNL A E   
Sbjct  135  GTLRSVATEDAKEFAERENLFFMETSALEAVNVENAFMTVLTEIYRVVSKKNLVANEESD  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   ++ L G KI+VPG  +  P  K+ CC S
Sbjct  195  SSGNSSLLKGTKIVVPGQ-EPPPTSKATCCMS  225



>ref|XP_009391884.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=225

 Score =   204 bits (519),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 120/150 (80%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWL+ELR HAD+NIVIMLIGNK+DL
Sbjct  76   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLDELRGHADRNIVIMLIGNKSDL  135

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I ++K+L A +   
Sbjct  136  GSLRAVPIEDAKEFAQRENLFFMETSALEATNVEGAFVTVLTEIYRITSKKSLVANDQSD  195

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +   ++ L G +I+VPG  +   + KSMCC
Sbjct  196  STGNSSLLKGTQIVVPGQ-EPPSESKSMCC  224



>ref|XP_010257365.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257366.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
 ref|XP_010257367.1| PREDICTED: ras-related protein RABA4d [Nelumbo nucifera]
Length=223

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WL+ELR+HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVAKWLDELRSHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAK+FAQ E LFF+ETSA+EA NVE AF T+LTEI+ +V++K L A ++  
Sbjct  133  STLRTVPIEDAKDFAQSESLFFMETSALEATNVESAFLTILTEIYRVVSKKTLTANDDMD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
            +G  +A L G KI+VPG       KK+ CCS
Sbjct  193  SGGKSALLKGTKIVVPGKEGSSEGKKATCCS  223



>ref|XP_011087327.1| PREDICTED: ras-related protein RGP1 [Sesamum indicum]
Length=224

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E  R V TEDAK+FAQ+E LFF+ETSA+EA NVE AF TVLTEI+ +V++K+L A E + 
Sbjct  134  ESHRSVTTEDAKDFAQRENLFFMETSALEATNVEPAFITVLTEIYRVVSKKSLVANEAES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             GN A  L G KI+VPG   V    K  CC S
Sbjct  194  GGNEAL-LKGTKIVVPGQEPVPAGSKFSCCGS  224



>ref|XP_008787280.1| PREDICTED: ras-related protein RGP1 [Phoenix dactylifera]
Length=224

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R +PTEDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K L A E   
Sbjct  133  GTLRAIPTEDAKEFAQRENLFFMETSALEATNVETAFLTVLTEIYRIISKKALVANEEPE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+VPG  Q    K + C SS
Sbjct  193  SGGNSSLLKGTKIVVPGQEQPSGTKSACCMSS  224



>ref|XP_008461787.1| PREDICTED: ras-related protein RABA4c [Cucumis melo]
Length=222

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 121/153 (79%), Gaps = 4/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ E LFF+ETSA+EA NVE AF T+LTEI+ ++++K L A +   
Sbjct  133  GSLRVVPTEDAKEFAQMENLFFMETSALEATNVEAAFNTILTEIYRVISKKALVANDETD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSM-CCSS  275
            +G +++ L G KI+VPG     PQ  S  CC S
Sbjct  193  SGGSSSLLKGTKIVVPGQE---PQAASSGCCRS  222



>ref|XP_002532404.1| protein with unknown function [Ricinus communis]
 gb|EEF29989.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+E+ NVE AF TVLTEI+ ++++K L A E   
Sbjct  132  GSLRAVPIEDAQEFAQRENLFFMETSALESTNVETAFLTVLTEIYRVISKKTLTANEELD  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +  L G +I+VPG  Q  P KK  CC S
Sbjct  192  TNGTSGLLKGTRIIVPGHDQA-PAKKGGCCMS  222



>ref|XP_002282798.1| PREDICTED: ras-related protein RABA4d [Vitis vinifera]
 emb|CAN62934.1| hypothetical protein VITISV_008844 [Vitis vinifera]
 emb|CBI29902.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E LFF+ETSA+EA NVE AF TVLT+I+ I+++K L A  +  
Sbjct  133  GSLRAVPTEDAQEFAERENLFFMETSALEATNVETAFLTVLTDIYKIISKKTLTANTDTD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  ++  L G KI+VPG      QK   CC S
Sbjct  193  STGSSTLLKGTKIIVPGGPDSAAQKGG-CCGS  223



>ref|XP_006850119.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
 gb|ERN11700.1| hypothetical protein AMTR_s00022p00227570 [Amborella trichopoda]
Length=223

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPT+DAKEFA++E LFF+ETSA+EA NVE AF TVLTEI+ IV++K L A ++QG
Sbjct  133  GTLRAVPTDDAKEFAERENLFFMETSALEATNVESAFLTVLTEIYRIVSKKALVANDDQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +A   L G KI++PGP      KK +CC S
Sbjct  193  GNSAL--LKGTKIVLPGPDAEPSNKKQICCYS  222



>ref|XP_009612391.1| PREDICTED: ras-related protein RGP1-like [Nicotiana tomentosiformis]
Length=225

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA+KE LFF+ETSA+EA NVE AF  VLTEI+ +V++K+L A E   
Sbjct  134  VSLRAVPTEDAKEFAEKENLFFIETSALEATNVETAFVNVLTEIYRVVSKKSLVANEADS  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G++A  L GK+I+VPG   V       CC S
Sbjct  194  AGSSAL-LRGKEIVVPGQEPVPSGSSYSCCRS  224



>ref|XP_006395225.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
 gb|ESQ32511.1| hypothetical protein EUTSA_v10004881mg [Eutrema salsugineum]
Length=223

 Score =   203 bits (516),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDH+ RWLEELR HADKNIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHVARWLEELRGHADKNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSSNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V  PG+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--PGEDTESKGKGCCGT  222



>ref|XP_010928849.1| PREDICTED: ras-related protein RGP1 [Elaeis guineensis]
Length=225

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGALLVYDMTKRQSFDHVTRWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K L A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALEATNVETAFLTVLTEIYRIISKKALVANEEPE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQ-KKSMCCSS  275
             G  ++ L G KI+V  PGQ  P   KS CC S
Sbjct  193  AGGNSSLLKGTKIVV--PGQEPPSGTKSSCCMS  223



>ref|XP_003577923.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
 ref|XP_010238009.1| PREDICTED: ras-related protein RGP1 [Brachypodium distachyon]
Length=226

 Score =   203 bits (516),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELRAHADKN+VIMLIGNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMARWLEELRAHADKNLVIMLIGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA +E LFF+ETSA+EA NVE AF T LTEI+  V++KNL A E   
Sbjct  135  GTLRVVPTEDAKEFAARESLFFMETSALEATNVENAFRTALTEIYRNVSKKNLVANEETD  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   ++ L G KI+VPG     P K + C SS
Sbjct  195  SSGNSSLLKGTKIIVPGQEPAPPAKAACCMSS  226



>gb|ABK23331.1| unknown [Picea sitchensis]
Length=222

 Score =   202 bits (515),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 116/151 (77%), Gaps = 2/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGA+GAMLVYDITKRQ+FDH+ RWLEELR HAD NIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGALGAMLVYDITKRQSFDHVARWLEELRGHADNNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             D R VP EDAKEFAQ+EGLFF ETSA+EA NVE AF T LTEI+ IV+RK    A  + 
Sbjct  133  RDMRAVPEEDAKEFAQREGLFFFETSALEAINVETAFITALTEIYRIVSRK-ALTANEEE  191

Query  370  ngnaaASLTGKKILVPGPGQ-VIPQKKSMCC  281
                AA+LTG KI +  P Q V+  KK  CC
Sbjct  192  RNGNAAALTGTKIALSSPEQPVMTVKKRSCC  222



>ref|XP_010913931.1| PREDICTED: ras-related protein RGP1-like [Elaeis guineensis]
Length=224

 Score =   202 bits (514),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWL+ELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHVARWLDELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E L F+ETSA+EA NVE AF TVLTEI+ I+++K L A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLCFMETSALEATNVETAFLTVLTEIYRIISKKALVANEETE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+VPG  Q    K + C SS
Sbjct  193  SGGNSSLLKGTKIVVPGQEQPSGTKSACCMSS  224



>gb|EYU27083.1| hypothetical protein MIMGU_mgv1a013266mg [Erythranthe guttata]
Length=225

 Score =   202 bits (514),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR+HADKNIVIML+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRSHADKNIVIMLVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R V TEDAK+FAQ+E LFF+ETSA+EA NVE AF T+LTEI+ +V++K L A E + 
Sbjct  134  GTLRAVSTEDAKDFAQRENLFFMETSALEATNVEPAFLTILTEIYRVVSKKALVANEAES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             GN +  L G  I+VPG   V    KS CC S
Sbjct  194  GGNESL-LKGTNIVVPGQESVPSGSKSTCCGS  224



>ref|XP_002513185.1| protein with unknown function [Ricinus communis]
 gb|EEF49176.1| protein with unknown function [Ricinus communis]
Length=223

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 119/151 (79%), Gaps = 2/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELREHADNNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E  R VP EDAKEFAQKE LFF+ETSA+EA NVE AF +VLTEI+ +V++K+L A +  G
Sbjct  133  ESLRAVPIEDAKEFAQKENLFFMETSALEATNVESAFISVLTEIYRVVSKKSLVANDEYG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
              N+   L G KI++PG    +    S CCS
Sbjct  193  GNNSL--LKGNKIVIPGQEPEMQATNSSCCS  221



>ref|XP_004149604.1| PREDICTED: ras-related protein RABA4c-like [Cucumis sativus]
 gb|KGN58606.1| hypothetical protein Csa_3G698470 [Cucumis sativus]
Length=222

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 4/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ E L F+ETSA+EA NVE AF T+LTEI+ ++++K L A +   
Sbjct  133  GSLRVVPTEDAKEFAQMENLSFMETSALEATNVEAAFNTILTEIYRVISKKALIANDETD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSM-CCSS  275
            +G +++ L G KI+VPG     PQ  S  CC S
Sbjct  193  SGGSSSLLKGTKIVVPGQE---PQAASSGCCRS  222



>ref|XP_008783089.1| PREDICTED: ras-related protein RGP1-like [Phoenix dactylifera]
Length=152

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRGAVGA+LVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL   
Sbjct  4    RYRAVTSAYYRGAVGALLVYDMTKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLGTL  63

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R VPTEDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K L A E    G 
Sbjct  64   RAVPTEDAKEFAQRENLFFMETSALEATNVETAFLTVLTEIYRIISKKALVANEELEAGG  123

Query  361  aaASLTGKKILVPGPGQVIPQ-KKSMCCSS  275
             ++ L G KI+V  PG+V P   KS CC S
Sbjct  124  NSSLLKGTKIVV--PGEVPPSGTKSACCMS  151



>ref|XP_010422852.1| PREDICTED: ras-related protein RABA4a-like isoform X3 [Camelina 
sativa]
Length=218

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 2/146 (1%)
 Frame = -3

Query  706  TSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRRDVPT  527
            T+   RGAVGAMLVYD+++RQTFDHIPRWLEELR HADKNIVI+L+GNK+DLED+R + T
Sbjct  73   TAGQERGAVGAMLVYDVSRRQTFDHIPRWLEELRNHADKNIVIILVGNKSDLEDQRAIST  132

Query  526  EDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngnaa-AS  350
            EDAK FA+KEGLFFLETSA+ A NVE AF+TVLTEIFN VN+K+L A E QG  +   AS
Sbjct  133  EDAKGFAEKEGLFFLETSALNAVNVESAFSTVLTEIFNFVNKKSLVAGEGQGTNDGDPAS  192

Query  349  LTGKKI-LVPGPGQVIPQKKSMCCSS  275
            L GKKI +VPGPGQVIP K  +CC++
Sbjct  193  LAGKKIDIVPGPGQVIPTKSRLCCNT  218



>ref|XP_009799541.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
 ref|XP_009799542.1| PREDICTED: ras-related protein RGP1-like [Nicotiana sylvestris]
Length=225

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA+KE LFF+ETSA+EA NVE  F  VLTEI+ +V++K+L A E + 
Sbjct  134  GSLRAVPTEDAKEFAEKENLFFIETSALEATNVETVFVNVLTEIYRVVSKKSLVANEAES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G++A  L GK+I+VPG   V       CC S
Sbjct  194  AGSSAL-LRGKEIVVPGQEPVPNGGSYSCCRS  224



>ref|XP_010442212.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   200 bits (509),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GSLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KILV G   V   K   CC +
Sbjct  193  SGGDSSLLQGTKILVAGEETVTKGKG--CCGT  222



>ref|XP_010534274.1| PREDICTED: ras-related protein RABA4c [Tarenaya hassleriana]
Length=223

 Score =   200 bits (509),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKE+AQ+E LFF+ETSA++A NVE AF TVLTEI+ IV++K+L A +   
Sbjct  133  GTLRAVPTEDAKEYAQRESLFFMETSALDASNVEPAFLTVLTEIYRIVSKKSLVANDEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G  ++ L G  I+V  PG+    K + CC +
Sbjct  193  TGGNSSLLKGTNIVV--PGEETRSKGTGCCGT  222



>gb|EMS64557.1| Ras-related protein RGP1 [Triticum urartu]
Length=210

 Score =   199 bits (507),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVIMLIGNK+DL
Sbjct  59   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVIMLIGNKSDL  118

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+EA NVE+AF T L EI+  V++KNL A +   
Sbjct  119  GTLRAVPTEDAKEFAERESLFFMETSALEATNVEKAFMTGLEEIYRTVSKKNLVANDEAN  178

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G K+++PG     P K + C SS
Sbjct  179  SGGNSSLLKGTKVIIPGQEPAPPAKAACCMSS  210



>gb|EMT23732.1| Ras-related protein RGP1 [Aegilops tauschii]
Length=217

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVIMLIGNK+DL
Sbjct  66   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVIMLIGNKSDL  125

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFA++E LFF+ETSA+EA NVE+AF T L EI+  V++KNL A +   
Sbjct  126  GTLRAVPTEDAKEFAERESLFFMETSALEATNVEKAFMTGLEEIYRTVSKKNLVANDEAN  185

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G K+++PG     P K + C SS
Sbjct  186  SGGNSSLLKGTKVIIPGQEPAPPAKAACCMSS  217



>ref|XP_009151604.1| PREDICTED: ras-related protein RABA4c [Brassica rapa]
Length=223

 Score =   199 bits (507),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSINVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V  PG+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--PGEEAEAKGKRCCGT  222



>gb|KHG15141.1| Ras-related RABA4c -like protein [Gossypium arboreum]
 gb|KJB25042.1| hypothetical protein B456_004G174200 [Gossypium raimondii]
Length=229

 Score =   200 bits (508),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 121/158 (77%), Gaps = 9/158 (6%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRGHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF TV+TEI+ ++++KNL A + Q 
Sbjct  133  ASLRAVPIEDAKEFAQRESLFFMETSALEATNVESAFLTVVTEIYRVISKKNLVANDEQE  192

Query  370  ngnaaAS-LTGKKILVPGPGQVIPQKKS-----MCCSS  275
                 AS L G  I+VPGP    PQ  S      CC+S
Sbjct  193  ESGGNASLLKGTTIVVPGPQ---PQSGSGGKSFSCCAS  227



>emb|CDX86332.1| BnaA06g30490D [Brassica napus]
Length=223

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSINVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V  PG+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--PGEEAEAKGKGCCGT  222



>ref|XP_002264293.1| PREDICTED: ras-related protein RGP1 [Vitis vinifera]
 emb|CBI24856.3| unnamed protein product [Vitis vinifera]
Length=226

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWL+ELR HADKNIVIML+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLQELRGHADKNIVIMLVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               + VPTEDAKEFA++E LFF+ETSA+EA NVE AF +VLTEI+ I+++K L A E   
Sbjct  134  GTLQAVPTEDAKEFAERENLFFMETSALEATNVETAFLSVLTEIYRIISKKTLVANEEVE  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+VPG        K  CC S
Sbjct  194  SGGNSSLLKGTKIIVPGKEPKSEGSKYNCCLS  225



>ref|XP_010057727.1| PREDICTED: ras-related protein RABA4d [Eucalyptus grandis]
 gb|KCW90273.1| hypothetical protein EUGRSUZ_A02418 [Eucalyptus grandis]
Length=221

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 4/152 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K L A++   
Sbjct  133  GSLRAVPTEDAQEFAQRESLFFMETSALEATNVEPAFLTVLTEIYRIISKKTLNASDESD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G     L G KI+VPG      + K  CC S
Sbjct  193  PGL----LKGTKIVVPGQDADAGRGKGGCCMS  220



>emb|CDY54519.1| BnaC07g49230D [Brassica napus]
Length=223

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLVGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSINVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V  PG+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--PGEEAEAKGKGCCGT  222



>ref|XP_004172276.1| PREDICTED: LOW QUALITY PROTEIN: ras-related protein RABA4c-like 
[Cucumis sativus]
Length=222

 Score =   199 bits (506),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/153 (67%), Positives = 119/153 (78%), Gaps = 4/153 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQTFDHI RWLEELR HADKNIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQTFDHIARWLEELRGHADKNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ E L F+ETSA+EA NVE AF T+LTEI+ ++++K L A +   
Sbjct  133  GSLRVVPTEDAKEFAQMENLSFMETSALEATNVEAAFNTILTEIYRVISKKALIANDETD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSM-CCSS  275
            +G +++ L G K +VPG     PQ  S  CC S
Sbjct  193  SGGSSSLLKGTKXVVPGQE---PQAASSGCCRS  222



>ref|XP_007052583.1| RAB GTPase A4C [Theobroma cacao]
 gb|EOX96740.1| RAB GTPase A4C [Theobroma cacao]
Length=225

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKR +FDH+ +WLEELR HADKNIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRPSFDHVAKWLEELRGHADKNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFA +E LFF+ETSA+EA NVE AF TVLTEI+ I+++KNL A + Q 
Sbjct  133  GSLRAVPVEDAKEFALRESLFFMETSALEAINVESAFLTVLTEIYRIISKKNLVANDEQE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   A+ L G KI+VPG       K S CC S
Sbjct  193  SEGNASLLKGTKIIVPGQEPETGGKSSSCCVS  224



>ref|NP_199607.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
 sp|Q9FE79.1|RAA4C_ARATH RecName: Full=Ras-related protein RABA4c; Short=AtRABA4c; AltName: 
Full=Ras-related protein SMG1 [Arabidopsis thaliana]
 gb|AAG44121.1|AF218121_1 small molecular weight g-protein [Arabidopsis thaliana]
 dbj|BAB09048.1| RAS superfamily GTP-binding protein-like [Arabidopsis thaliana]
 gb|ABD60725.1| At5g47960 [Arabidopsis thaliana]
 gb|AED95599.1| RAB GTPase homolog A4C [Arabidopsis thaliana]
Length=223

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V   G+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--AGEETESKGKGCCGT  222



>gb|KDP43443.1| hypothetical protein JCGZ_16730 [Jatropha curcas]
Length=226

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 121/152 (80%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDHI RWLEELR HAD NIVIML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHIARWLEELREHADSNIVIMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQKE LFF+ETSA+EA NVE AF ++LTEI+ I++++ L A E++ 
Sbjct  133  GTLRAVPTEDAKEFAQKESLFFMETSALEATNVESAFLSILTEIYRIISKRTLIANEHES  192

Query  370  ngnaaASLTGKKILVPG--PGQVIPQKKSMCC  281
             GNA+  L G  I+VPG  P   +  + S CC
Sbjct  193  GGNASL-LKGTNIVVPGREPEMAVGGRNSGCC  223



>ref|XP_010439146.1| PREDICTED: ras-related protein RABA4c [Camelina sativa]
Length=223

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI IMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIAIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GSLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V G   V   K   CC +
Sbjct  193  SGGDSSLLQGTKIVVAGEETVTKGKG--CCGT  222



>ref|XP_006281058.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
 gb|EOA13956.1| hypothetical protein CARUB_v10027077mg [Capsella rubella]
Length=224

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEEL+ HADKNIVIMLIGNKTDL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELKGHADKNIVIMLIGNKTDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  134  GTLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V G    I  K   CC +
Sbjct  194  SGGDSSLLQGTKIIVDGDE--IESKGKGCCGT  223



>ref|XP_002863846.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40105.1| small molecular weight G-protein 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=223

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GTLRAVPTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V   G+    K   CC +
Sbjct  193  SGGDSSLLQGTKIVV--AGEETESKGKGCCGT  222



>gb|EYU39898.1| hypothetical protein MIMGU_mgv1a020125mg [Erythranthe guttata]
Length=225

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E L+F+ETSA++A NVE AF T+LTEI+ IV++K    A +  
Sbjct  134  GTLRAVPTEDAQEFAERENLYFMETSALQATNVESAFMTILTEIYRIVSKK-TLVAGDGS  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            + + + SL G +I+VPG       KK  CC
Sbjct  193  DYSKSTSLKGTRIIVPGQDSDPNAKKGGCC  222



>gb|EEC84249.1| hypothetical protein OsI_30694 [Oryza sativa Indica Group]
Length=214

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = -3

Query  718  YRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRR  539
            YRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIMLIGNK+DL   R
Sbjct  68   YRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLIGNKSDLGTLR  127

Query  538  DVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngna  359
             VPTEDAKEFA++E LFF+ETSA+E+ NVE AF TVLTEI+ IV++KNL A E   +   
Sbjct  128  VVPTEDAKEFAERENLFFMETSALESTNVENAFMTVLTEIYRIVSKKNLVANEEVDSSGN  187

Query  358  aASLTGKKILVPGPGQVIPQKKSMCCS  278
            ++ L G KI+VPG     P K S C S
Sbjct  188  SSLLKGTKIVVPGQEPAPPTKASCCMS  214



>ref|XP_010672725.1| PREDICTED: ras-related protein RABA4d [Beta vulgaris subsp. vulgaris]
Length=222

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDHI RWL+ELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHIARWLDELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFA++E LFF+ETSA+E+ NVE AF TVLTEI+  V++K L+   +  
Sbjct  133  ASLRAVPIEDAKEFAERENLFFMETSALESTNVETAFLTVLTEIYRTVSKKTLSVNGDYD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
              + AA L G +I+VPG      Q+K  CC+
Sbjct  193  VSSNAALLKGTQIIVPGQ-DTSSQEKGGCCT  222



>tpg|DAA39806.1| TPA: ras protein RGP1 [Zea mays]
Length=226

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLMGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFA++E LFF+ETSA+EA NVE AF TVLTEI+  V++KNL A E   
Sbjct  135  GTLRAVPIEDAKEFAERENLFFMETSALEAINVENAFMTVLTEIYRTVSKKNLVANEEPD  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQK-KSMCCSS  275
            +   ++ L G KI+V  PGQ  P   K+ CC S
Sbjct  195  SSGNSSLLKGTKIVV--PGQEPPSTLKATCCMS  225



>ref|NP_001146862.1| LOC100280470 [Zea mays]
 gb|ACG24025.1| ras-related protein RGP1 [Zea mays]
Length=226

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNIVIML+GNK+DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIVIMLMGNKSDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFA++E LFF+ETSA+EA NVE AF TVLTEI+  V++KNL A E   
Sbjct  135  GTLRAVPIEDAKEFAERENLFFMETSALEAINVENAFMTVLTEIYRTVSKKNLVANEEPD  194

Query  370  ngnaaASLTGKKILVPGPGQVIPQK-KSMCCSS  275
            +   ++ L G KI+V  PGQ  P   K+ CC S
Sbjct  195  SSGNSSLLKGTKIVV--PGQEPPSTLKATCCMS  225



>ref|XP_009411810.1| PREDICTED: ras-related protein RGP1-like [Musa acuminata subsp. 
malaccensis]
Length=231

 Score =   197 bits (502),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR H D+NIVIMLIGNK+DL
Sbjct  80   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHMTRWLEELRGHTDRNIVIMLIGNKSDL  139

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP +DAKEFAQ+E LFF+ETSA+EA NVE AF TVLT+I+ I ++K+L A +   
Sbjct  140  GTLRAVPIDDAKEFAQRENLFFMETSALEATNVESAFLTVLTDIYRITSKKSLVANDGSD  199

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   ++ L G +I+VPG  +     KS CC S
Sbjct  200  STGNSSLLKGTEIVVPGQ-EPSSGTKSTCCGS  230



>ref|XP_004494010.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=225

 Score =   197 bits (501),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 114/150 (76%), Gaps = 0/150 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE  F T+LTEI+ I  +K L +  +  
Sbjct  133  ASLRAVPTEDAEEFAQRENLFFMETSALESTNVETCFLTILTEIYRINAKKTLTSNGDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            + + +  L G +I+VPG       KK  CC
Sbjct  193  HSDTSGLLKGSRIIVPGNQMDATGKKGGCC  222



>gb|KDO83348.1| hypothetical protein CISIN_1g040835mg, partial [Citrus sinensis]
Length=206

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FD++ RWLEELR HADKNI+IML+GNK+DL
Sbjct  54   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDNVARWLEELRGHADKNIIIMLVGNKSDL  113

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E  R VPTEDAKEFA+KEGL F+ETSA+E+ NVE AF TVLTEI+ IV++K L A +   
Sbjct  114  ETLRAVPTEDAKEFAEKEGLCFMETSALESTNVELAFLTVLTEIYRIVSKKALTANDESE  173

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G +++ L    I+VPG      ++   CC+S
Sbjct  174  SGGSSSLLKATNIVVPGQEPESGRRSYNCCTS  205



>emb|CDP10094.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 117/152 (77%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E L F+ETSA+E+ NVE AF TVLT+I+ I+++K    A +  
Sbjct  133  GSLRAVPTEDAQEFAERENLCFMETSALESTNVESAFMTVLTQIYRIISKK-TLNAADGS  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                +ASL G KI+VPG       +K+ CC S
Sbjct  192  EYEKSASLKGTKIIVPGQDSDPGGRKAGCCRS  223



>ref|XP_007028923.1| RAB GTPase A4D [Theobroma cacao]
 gb|EOY09425.1| RAB GTPase A4D [Theobroma cacao]
Length=222

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF TVLTEI+ I+++K LAA +   
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFLTVLTEIYRIISKKTLAANDELD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +  L G +I+VP   ++  ++K  CC
Sbjct  193  PNGNSGLLKGTRIIVPNQ-ELQTERKGGCC  221



>ref|XP_004497938.1| PREDICTED: ras-related protein RABA4d-like [Cicer arietinum]
Length=223

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/150 (64%), Positives = 116/150 (77%), Gaps = 0/150 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADANIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ ++++K L A ++  
Sbjct  133  GTLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFLTILTEIYRLISKKTLTANDDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
               ++  L G KI+VP       +KK  CC
Sbjct  193  PAGSSGLLKGTKIIVPNQDVNALEKKGGCC  222



>ref|XP_006438973.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
 ref|XP_006482913.1| PREDICTED: ras-related protein RABA4c-like [Citrus sinensis]
 gb|ESR52213.1| hypothetical protein CICLE_v10032676mg [Citrus clementina]
Length=226

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FD++ RWLEELR HADKNI+IML+GNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDNVARWLEELRGHADKNIIIMLVGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
            E  R VPTEDAKEFA+KEGL F+ETSA+E+ NVE AF TVLTEI+ IV++K L A +   
Sbjct  134  ETLRAVPTEDAKEFAEKEGLCFMETSALESTNVELAFLTVLTEIYRIVSKKALTANDESE  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G +++ L    I+VPG      ++   CC+S
Sbjct  194  SGGSSSLLKATNIVVPGQEPESGRRSYNCCTS  225



>ref|XP_007218358.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
 gb|EMJ19557.1| hypothetical protein PRUPE_ppa011105mg [Prunus persica]
Length=223

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADSNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ I+ +K+L A +   
Sbjct  133  GTLRAVPSEDAKEFAQRENLFFMEASALEATNVESAFITVLTEIYRILGKKSLIANDEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  +A+ L G KI+VPG  +  PQ  S C SS
Sbjct  193  SEGSASLLKGTKIVVPGR-EPEPQGNSCCWSS  223



>ref|XP_008231353.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231354.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
 ref|XP_008231355.1| PREDICTED: ras-related protein RABA4c [Prunus mume]
Length=223

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGSVGAMLVYDITKHQSFDHVTKWLEELRGHADNNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ I+ +K+L A +   
Sbjct  133  GTLRAVPSEDAKEFAQRENLFFMEASALEATNVESAFITVLTEIYRILGKKSLIANDEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +  +A+ L G KI+VPG  +  PQ  S C SS
Sbjct  193  SEGSASLLKGTKIVVPGR-EPEPQGNSCCWSS  223



>ref|XP_004306514.1| PREDICTED: ras-related protein RABA4c [Fragaria vesca subsp. 
vesca]
Length=252

 Score =   196 bits (499),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ RWLEELR HAD NIV+ML+GNK+DL
Sbjct  101  GQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTRWLEELRGHADSNIVVMLVGNKSDL  160

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAK+FAQ+E LFF+E SA+E+ NVE AF TVLTEI+ IV +K L A +   
Sbjct  161  GTLRAVPAEDAKDFAQRENLFFMEASALESTNVESAFITVLTEIYRIVGKKALIANDETE  220

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G +I+VPG    +P+ KS CC S
Sbjct  221  SGGNSSLLKGTQIIVPGQDP-LPEAKSGCCFS  251



>ref|XP_010482045.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
 ref|XP_010482047.1| PREDICTED: ras-related protein RABA4c-like [Camelina sativa]
Length=223

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ RWLEELR HADKNI +MLIGNKTDL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVARWLEELRGHADKNIALMLIGNKTDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R V TEDAKEFAQ+E LFF+ETSA+++ NVE +F TVLTEI+ IV++KNL A E   
Sbjct  133  GSLRAVTTEDAKEFAQRENLFFMETSALDSNNVEPSFLTVLTEIYRIVSKKNLVANEEGE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G  ++ L G KI+V G   V   K   CC +
Sbjct  193  SGGDSSLLQGTKIVVAGEETVTKGKG--CCGT  222



>gb|AFK37481.1| unknown [Medicago truncatula]
 gb|KEH41577.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=223

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD NIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADTNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               + VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ ++++K L A +   
Sbjct  133  GTLKAVPTEDAQEFAQRENLFFMETSALESTNVETAFLTILTEIYRLISKKTLTANDEAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
             G  +  L G +I+VP       +KK  CC 
Sbjct  193  PGGGSGLLKGTRIIVPNQDASAYEKKGGCCG  223



>ref|XP_002298447.1| GTP-binding family protein [Populus trichocarpa]
 gb|EEE83252.1| GTP-binding family protein [Populus trichocarpa]
Length=225

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQKE LFF+ETSA+EA NVE AF +VLTEI+ ++++K L A E + 
Sbjct  134  GTLRAVPTEDAKEFAQKENLFFMETSALEATNVESAFLSVLTEIYRVISKKALIANEQES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G+++  L G  I+VP    V   +   CC +
Sbjct  194  GGSSSL-LKGTNIVVPEQEPVSGGRSFSCCGT  224



>ref|XP_011025048.1| PREDICTED: ras-related protein RABA4d [Populus euphratica]
Length=225

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITKRQ+FDH+ +WLEELR HAD NIVIMLIGNK+DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDITKRQSFDHVAKWLEELRDHADNNIVIMLIGNKSDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDAKEFAQKE LFF+ETSA+EA NVE AF +VLTEI+ ++++K L A E + 
Sbjct  134  GTLRAVPTEDAKEFAQKENLFFMETSALEATNVESAFLSVLTEIYRVISKKALIANEQES  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             G+++  L G  I+VP    V   +   CC +
Sbjct  194  GGSSSL-LKGTNIVVPEQEPVSGGRTFSCCGT  224



>ref|XP_010520062.1| PREDICTED: ras-related protein RABA4d [Tarenaya hassleriana]
Length=223

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 122/152 (80%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K L A +++ 
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKPLTAGDDEA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
             GN++  L G +I+V  PG+   +K+  CC  
Sbjct  193  GGNSSL-LKGTRIIV--PGEKATEKRGGCCGG  221



>ref|XP_009591241.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMVRWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+++ NVE+AF T+LTEI+ I++ KN   A    
Sbjct  133  GSLRAVPVEDAQEFAERENLFFMETSALQSTNVEDAFMTILTEIYRIIS-KNTLTANPGA  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   + SL G +I+VPG       K   CC S
Sbjct  192  DYGKSQSLKGTRIIVPGQESDSGGKSGSCCMS  223



>gb|EYU20715.1| hypothetical protein MIMGU_mgv1a013518mg [Erythranthe guttata]
Length=218

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 116/151 (77%), Gaps = 8/151 (5%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIML+GNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLVGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
                 VP+EDA+EFA++E L+F+ETSA+E+KNVE AF T+LTEI+ IV++K         
Sbjct  134  GTICAVPSEDAREFAERENLYFMETSALESKNVESAFMTILTEIYRIVSKK-----TLVA  188

Query  370  ngnaaASLTGKKILVPG-PGQVIPQKKSMCC  281
            N  ++ SLT  KI+VPG  G      KS CC
Sbjct  189  NDASSTSLTSTKIIVPGRDGD--GNGKSGCC  217



>ref|XP_008373738.1| PREDICTED: ras-related protein RABA4d [Malus domestica]
Length=223

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF  +L EI+ I+++K LAA++  G
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLMILREIYRIMSKKTLAASDLDG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VPGP     +K   C SS
Sbjct  193  GDSGL--LKGTAIIVPGPDGDGSRKGGCCFSS  222



>ref|XP_011078858.1| PREDICTED: ras-related protein RABA4d [Sesamum indicum]
Length=220

 Score =   192 bits (489),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDHI RWLEELR HADKNIVIMLIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHIARWLEELRGHADKNIVIMLIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E L+F+ETSA+EA NVE AF T+LTEI+ IV++K        G
Sbjct  134  GTLRAVPTEDAQEFAERENLYFMETSALEATNVESAFMTILTEIYRIVSKK---TLAADG  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +    ASL G  I++P   +     KS CC
Sbjct  191  SDFKTASLKGTAIILPSR-EADTSSKSGCC  219



>ref|XP_009804804.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 114/152 (75%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIM+IGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMIIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+++ NVE AF T+LTEI+ I++ KN   A    
Sbjct  133  GSLRAVPVEDAQEFAERENLFFMETSALQSTNVESAFMTILTEIYRIIS-KNTLTANPGA  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   + SL G +I+VPG       K   CC S
Sbjct  192  DYGKSQSLKGTRIIVPGQESDTGGKSGGCCMS  223



>ref|XP_008460801.1| PREDICTED: ras-related protein RABA4d [Cucumis melo]
Length=223

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E LFF+ETSA+E+ NVE AF T+LTEI+ I+++K+LAA E   
Sbjct  133  GSLRAVPTEDAQEFAERENLFFMETSALESTNVETAFFTILTEIYRIISKKSLAAGEEID  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
             G+  A   G  I+VPG  Q    K   CC
Sbjct  193  IGSNPALFKGTNIVVPGQDQDSGTKG--CC  220



>ref|XP_004150166.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 ref|XP_004154754.1| PREDICTED: ras-related protein RABA4d-like [Cucumis sativus]
 gb|KGN53823.1| hypothetical protein Csa_4G152280 [Cucumis sativus]
Length=223

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 118/150 (79%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E LFF+ETSA+E+ NVE AF T+LTEI+ I+++K+LAA E   
Sbjct  133  GSLRAVPTEDAQEFAERENLFFMETSALESTNVETAFFTILTEIYRIISKKSLAAGEEID  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
             G+  A   G  I+VPG  Q   +K   CC
Sbjct  193  IGSNPALFKGTSIVVPGQDQDSGRKG--CC  220



>ref|XP_008375145.1| PREDICTED: ras-related protein RABA4c-like [Malus domestica]
Length=222

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ I+ +K+L   E   
Sbjct  133  GTLRAVPSEDAKEFAQRENLFFMEASALEATNVESAFVTVLTEIYRILGKKSLIPNEEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G+++  L G K++VPG  +  PQ  S C SS
Sbjct  193  SGSSSL-LKGTKLVVPGQ-EPEPQASSCCWSS  222



>ref|XP_009354700.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 120/152 (79%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELRAHAD NIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRAHADNNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ I+ +K+L   E   
Sbjct  133  GTLRAVPSEDAKEFAQRENLFFMEASALEATNVESAFVTVLTEIYRILGKKSLIPNEEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G+++  L G K++VPG  +  PQ  S C SS
Sbjct  193  SGSSSL-LKGTKLVVPGQ-EPEPQASSCCWSS  222



>gb|KHG02480.1| Ras-related RABA4d -like protein [Gossypium arboreum]
 gb|KJB15040.1| hypothetical protein B456_002G157000 [Gossypium raimondii]
Length=225

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HADKNIV+MLIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADKNIVVMLIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ I+++K L+A +   
Sbjct  134  GSLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFLTILTEIYRIISKKTLSANDELD  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +  L G +I+VP     I Q +  CC
Sbjct  194  ANGNSGLLKGTRIIVPNQEPQI-QNQGGCC  222



>ref|XP_008240816.1| PREDICTED: ras-related protein RABA4d [Prunus mume]
Length=222

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF  +L EI+ I+++K LA+    G
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLMILMEIYRIMSKKTLASNAQDG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VP P     +K   C SS
Sbjct  193  GDSGF--LKGTAIIVPSPESDASRKGGCCFSS  222



>ref|XP_007204003.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
 gb|EMJ05202.1| hypothetical protein PRUPE_ppa025526mg [Prunus persica]
Length=222

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF  +L EI+ I+++K LA+ +  G
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLMILMEIYRIMSKKTLASNDQDG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VP P     +K   C SS
Sbjct  193  GDSGL--LKGTAIIVPSPESDASRKGGCCFSS  222



>ref|NP_187823.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 ref|XP_002884891.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006298501.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 ref|XP_006407359.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 ref|XP_010498677.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 ref|XP_010464965.1| PREDICTED: ras-related protein RABA4d [Camelina sativa]
 sp|Q9LH50.1|RAA4D_ARATH RecName: Full=Ras-related protein RABA4d; Short=AtRABA4d [Arabidopsis 
thaliana]
 gb|AAG51065.1|AC069472_5 ras-related GTP-binding protein; 5118-4176 [Arabidopsis thaliana]
 dbj|BAB01966.1| GTP-binding protein-like [Arabidopsis thaliana]
 gb|AAY78738.1| Ras-related GTP-binding family protein [Arabidopsis thaliana]
 gb|EFH61150.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AEE75160.1| RAB GTPase-like protein A4D [Arabidopsis thaliana]
 gb|EOA31399.1| hypothetical protein CARUB_v10014578mg [Capsella rubella]
 gb|ESQ48812.1| hypothetical protein EUTSA_v10022384mg [Eutrema salsugineum]
 gb|KFK38580.1| hypothetical protein AALP_AA3G132100 [Arabis alpina]
Length=222

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  193  DGNSSL-LKGTRIIIPSEQE--SGKRGGCC  219



>emb|CDY42133.1| BnaC05g40860D [Brassica napus]
 emb|CDY08447.1| BnaA05g26830D [Brassica napus]
Length=222

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K L A ++  
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKTLTADDDDA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  193  DGNSSL-LKGTRIIIPSEQE--TGKRGGCC  219



>ref|XP_010489789.1| PREDICTED: ras-related protein RABA4d-like [Camelina sativa]
Length=222

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  193  DGNSSL-LKGTRIIIPSEQE--SGKRGGCC  219



>ref|XP_009120881.1| PREDICTED: ras-related protein RABA4d [Brassica rapa]
 emb|CDY52622.1| BnaCnng23010D [Brassica napus]
 emb|CDY50568.1| BnaA01g30820D [Brassica napus]
Length=222

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  193  DGNSSL-LKGTRIIIPSEEE--SGKRGGCC  219



>ref|XP_001775770.1| predicted protein [Physcomitrella patens]
 gb|EDQ59453.1| predicted protein [Physcomitrella patens]
Length=221

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             + R V T+ A+EFA+KE L FLETSAME+ NVE AF TVL+EI+ +V++K L A ENQG
Sbjct  133  SNLRQVETDTAREFAEKESLSFLETSAMESTNVETAFFTVLSEIYKVVSKKALLADENQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            N      L G KI +     VI  KK+ CCSS
Sbjct  193  NSPL---LPGTKIKLADKDDVIGAKKAGCCSS  221



>ref|XP_004234844.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=224

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 113/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R +P EDA+EFA++E LFF+ETSA+E+ NVE AF ++L EI+ IV +K    A+   
Sbjct  133  GSLRAIPIEDAQEFAERENLFFMETSALESTNVETAFMSILKEIYQIVGKK-TLIADEGA  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                + SL G +I+VPG       + + CC S
Sbjct  192  EYAKSQSLKGTRIIVPGHHSDSAAQGAGCCIS  223



>gb|EPS73160.1| hypothetical protein M569_01593, partial [Genlisea aurea]
Length=220

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYR+VTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  70   GQERYRSVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  129

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E L+F+ETSA+EA NVE AF ++LTEI+ I+++K+LAAA +  
Sbjct  130  GTLRAVPVEDAQEFAERENLYFMETSALEATNVEGAFMSILTEIYQIMSKKSLAAAGDAS  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKK-SMCC  281
            +   +ASL G  ILV  P +   + +   CC
Sbjct  190  DYAKSASLKGTAILVTAPHEGDGKSRGGGCC  220



>ref|XP_006381042.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|ERP58839.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGNK DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K LA  +   
Sbjct  132  GSLRAVPTEDAEEFAQRENLFFMETSALEATNVETAFWTVLTEIYRIISKKTLAGNDKSD  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                     G +ILVP   Q    +K  CC
Sbjct  192  GNPGV--FKGTRILVPSQAQ--NSEKKGCC  217



>ref|XP_009135214.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 ref|XP_009135215.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
 emb|CDX73833.1| BnaA03g32140D [Brassica napus]
Length=221

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  133  GSLRAVPTEDAQEFAERENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
              +    L G +I++P   +    K+  CC
Sbjct  193  GNSNL--LKGTRIIIPSEQE--SDKRGGCC  218



>ref|XP_009365017.1| PREDICTED: ras-related protein RABA4c-like [Pyrus x bretschneideri]
Length=222

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 119/152 (78%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRG+VGAMLVYDITK Q+F+H+ +WLEELR HAD NIV+ML+GNK+DL
Sbjct  73   GQERYRAVTSAYYRGSVGAMLVYDITKPQSFEHVTKWLEELRGHADNNIVVMLVGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ IV +K+L   E   
Sbjct  133  GTLRAVPSEDAKEFAQRENLFFMEASALEATNVESAFVTVLTEIYRIVGKKSLIPNEEAE  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +G+++  L G K++VPG  +  PQ  S C SS
Sbjct  193  SGSSSL-LKGTKLVVPGQ-EPEPQASSCCWSS  222



>gb|KHN27367.1| Ras-related protein RABA4d [Glycine soja]
Length=223

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 115/150 (77%), Gaps = 0/150 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+T+R +FD++ +WLEELR HADKNIV+MLIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDVTRRPSFDNMAKWLEELRGHADKNIVVMLIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ +V++K L A ++  
Sbjct  134  GTLRAVPTEDAEEFAQRENLFFMETSALESTNVETAFLTILTEIYRLVSKKTLTANDDAD  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +  L G KI+VP       +KK  CC
Sbjct  194  PSGISGLLKGTKIIVPSQDINAGEKKGGCC  223



>ref|XP_009146635.1| PREDICTED: ras-related protein RABA4d-like [Brassica rapa]
Length=263

 Score =   191 bits (485),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 120/150 (80%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  114  GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  173

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K L A ++  
Sbjct  174  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKTLTADDDDA  233

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  234  DGNSSL-LKGTRIIIPSEQE--TGKRGGCC  260



>emb|CDY00758.1| BnaC03g37420D [Brassica napus]
Length=221

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  133  GSLRAVPTEDAQEFAERENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
              +    L G +I++P   +    K+  CC
Sbjct  193  GNSNL--LKGTRIIIPSEQE--SGKRGGCC  218



>ref|XP_002323298.1| Ras-related GTP-binding family protein [Populus trichocarpa]
 gb|EEF05059.1| Ras-related GTP-binding family protein [Populus trichocarpa]
Length=218

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 114/150 (76%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGNK DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKSIIIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I++++    A N  
Sbjct  132  GSLRAVPAEDAKEFAQRENLFFMETSALEATNVETAFLTMLTEIYRIISKR--TLAGNDE  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +   + +  G +ILVP   Q    +K  CC
Sbjct  190  SNENSGAFKGTRILVPSQEQ--NSEKKGCC  217



>ref|XP_004249189.1| PREDICTED: ras-related protein RABA4d-like [Solanum lycopersicum]
Length=226

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLI NK DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMLIANKCDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+++ NVE AF T+LTEI+ I++ KN   A    
Sbjct  135  GSLRAVPVEDAQEFAERENLFFMETSALQSTNVEGAFMTILTEIYKIIS-KNTLTAAPGA  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   + SL G +I+VPG           CC S
Sbjct  194  DYGKSQSLKGTRIIVPGQDSDSGGNSGGCCMS  225



>ref|XP_006351381.1| PREDICTED: ras-related protein RABA4d-like [Solanum tuberosum]
Length=226

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLI NK DL
Sbjct  75   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMLIANKCDL  134

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+++ NVE AF TVLTEI+ I++ KN   A    
Sbjct  135  GSLRAVPVEDAQEFAERENLFFMETSALQSTNVEGAFMTVLTEIYKIIS-KNTLIAAPGA  193

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   + SL G +I+VPG           CC S
Sbjct  194  DYGKSQSLKGTRIVVPGQDSDSGGNSGGCCMS  225



>ref|XP_009590361.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana tomentosiformis]
Length=224

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLI NK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMLIANKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+E+ NVE AF T+L EI+ IV +K    AE   
Sbjct  133  GSLRAVPIEDAQEFAERENLFFMETSALESTNVETAFMTILKEIYQIVGKK-TLTAEEGA  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                + SL G +I+VPG       +   C SS
Sbjct  192  EYAKSQSLKGTRIIVPGQDSDSGGRGGCCMSS  223



>ref|XP_007145654.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
 gb|ESW17648.1| hypothetical protein PHAVU_007G257200g [Phaseolus vulgaris]
Length=222

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+MLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVVMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               + VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+L+EI+ ++++K L A ++  
Sbjct  133  GTLKAVPTEDAEEFAQRENLFFMETSALESTNVETAFLTILSEIYRLISKKTLTANDDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
               ++  L G KI+VP    +  +KK  CC
Sbjct  193  PNGSSGLLKGTKIIVPNQ-DMNAEKKGGCC  221



>ref|XP_011016542.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGNK DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKRIIIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I++++    + N  
Sbjct  132  GSLRAVPAEDAKEFAQRENLFFMETSALEATNVETAFLTMLTEIYRIISKR--TLSGNDE  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +   + +  G +ILVP   Q    +K  CC
Sbjct  190  SDENSGAFKGTRILVPSQEQ--NSEKKGCC  217



>gb|KJB36087.1| hypothetical protein B456_006G140300 [Gossypium raimondii]
Length=222

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VIML+GNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVIMLVGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF TVLTEI+ I+++K L A E   
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFFTVLTEIYRIISKKTLTANEELD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCS  278
                AA L G +I+VP   ++    +  CC+
Sbjct  193  PNGNAALLKGTRIIVPNQ-EMQKDSRGGCCA  222



>ref|XP_011033268.1| PREDICTED: ras-related protein RABA4d-like isoform X2 [Populus 
euphratica]
Length=218

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 113/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK I+IMLIGNK DL
Sbjct  72   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMTRWLEELRGHADKRIIIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I++++    A N  
Sbjct  132  GSLRAVPAEDAKEFAQRENLFFMETSALEATNVETAFLTMLTEIYRIISKR--TLAGNDE  189

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +   + +  G +ILVP   Q    +K  CC
Sbjct  190  SDENSGAFKGTRILVPSQEQ--NSEKKGCC  217



>ref|XP_009345104.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  109  GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  168

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+EA NVE AF  +L EI+ I+++K LAA +   
Sbjct  169  GSLRAVPIEDAQEFAQRENLFFMETSALEATNVETAFLMILMEIYRIMSKKPLAAGDLNS  228

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VPGP     +K   C SS
Sbjct  229  GDSGL--LKGTTIIVPGPDGDGARKGGCCFSS  258



>ref|XP_011020284.1| PREDICTED: ras-related protein RABA4d-like [Populus euphratica]
Length=218

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQE YRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADK+I+IMLIGNK DL
Sbjct  72   GQESYRAVTSAYYRGAVGAMLVYDMTKRQSFDHLARWLEELRGHADKSIIIMLIGNKCDL  131

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDAKEFAQ+E LFF+ETSA+EA NVE AF TVLTEI+ I+++K LA  +  G
Sbjct  132  GSLRAVPAEDAKEFAQRENLFFMETSALEATNVETAFWTVLTEIYRIISKKTLAGNDESG  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                     G +ILVP   Q    +K  CC
Sbjct  192  GNPGV--FKGTRILVPSQAQ--NSEKKGCC  217



>ref|XP_009347482.1| PREDICTED: ras-related protein RABA4d-like [Pyrus x bretschneideri]
Length=259

 Score =   189 bits (481),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  109  GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  168

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+EA NVE AF  +L EI+ I+++K LAA +   
Sbjct  169  GSLRAVPIEDAQEFAQRENLFFMETSALEATNVETAFLMILMEIYRIMSKKPLAAGDLNS  228

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VPGP     +K   C SS
Sbjct  229  GDSGL--LKGTTIIVPGPDGDGARKGGCCFSS  258



>gb|KHG20755.1| Ras-related RABA4d -like protein [Gossypium arboreum]
Length=222

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ RWLEELR HAD+N+VIML+GNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMARWLEELRGHADQNLVIMLVGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF TVLTEI+ I+++K L A +   
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFFTVLTEIYRIISKKTLTANDELD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                AA L G +I+VP   ++    +  CC
Sbjct  193  PNGNAALLKGTRIIVPNQ-EMQKDSRGGCC  221



>ref|XP_004309478.1| PREDICTED: ras-related protein RABA4d isoform X1 [Fragaria vesca 
subsp. vesca]
Length=223

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR +ADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGYADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF  +L EI+ ++ +K LA+ E   
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALESTNVETAFLMILMEIYQLMRKKTLASNEGDA  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              ++   L G  I++P P     QK S C SS
Sbjct  193  GDSSF--LKGTTIILPTPEPPSAQKGSCCFSS  222



>gb|KHN09949.1| Ras-related protein RABA4d [Glycine soja]
Length=224

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FD++ +WLEELR HADKNIV+MLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDNMAKWLEELRGHADKNIVVMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ ++++K L A ++  
Sbjct  133  GTLRAVPTEDAEEFAQRENLFFMETSALESTNVETAFLTILTEIYRLISKKTLTANDDAD  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSM--CC  281
                +  L G KI+VP       +KK    CC
Sbjct  193  PSGISGLLKGTKIIVPSQEINAGEKKGKGGCC  224



>ref|XP_001760654.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ74393.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAM+VYDITK Q+FDH+ RWLEELRAHAD NIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMVVYDITKEQSFDHVLRWLEELRAHADANIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             + R V T+ A+E+A+K+GL FLETSAME+ NVE AF TVL+EI+  V++K L A ENQG
Sbjct  133  SNLRQVETDTAREYAEKQGLSFLETSAMESTNVETAFFTVLSEIYKTVSKKALIADENQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                   L G KI +     VI  KK+ CCSS
Sbjct  193  GAPL---LPGTKITLTDKDDVIGTKKAGCCSS  221



>ref|XP_009763158.1| PREDICTED: ras-related protein RABA4d-like [Nicotiana sylvestris]
Length=224

 Score =   187 bits (475),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLI NK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMARWLEELRGHADKNIVIMLIANKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFA++E LFF+ETSA+E+ NVE AF ++L EI+ IV +K    AE   
Sbjct  133  GSLRAVPIEDAQEFAERENLFFMETSALESTNVETAFMSILKEIYQIVGKK-TLTAEEGA  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                + SL G +I+VPG       +   C SS
Sbjct  192  EYPKSQSLKGTRIIVPGQDSDSGGRGGCCMSS  223



>ref|XP_008392105.1| PREDICTED: ras-related protein RABA4d-like [Malus domestica]
Length=259

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 113/152 (74%), Gaps = 2/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  109  GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  168

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+EA NV  AF  +L EI+ I+++K LAA +   
Sbjct  169  GSLRAVPIEDAQEFAQRENLFFMETSALEATNVXTAFLMILMEIYRIMSKKPLAAGDLNS  228

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
              +    L G  I+VPGP     +K   C SS
Sbjct  229  GDSGL--LKGTTIIVPGPDGDGARKGGCCFSS  258



>gb|KEH16247.1| RAB GTPase-like protein A1D [Medicago truncatula]
Length=222

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 111/150 (74%), Gaps = 3/150 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR+HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRSHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+EA NVE  F T+LTEI+ I N K   ++    
Sbjct  133  SYLRAVPMEDAEEFAQRENLFFMETSALEATNVETCFLTILTEIYRI-NAKKPLSSNGDD  191

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
                +  L G +I+V  P ++    K  CC
Sbjct  192  QNGTSTLLKGSRIIV--PNEIDGGGKKGCC  219



>ref|XP_011075182.1| PREDICTED: ras-related protein RABA4d-like [Sesamum indicum]
Length=224

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 112/152 (74%), Gaps = 1/152 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD++KRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  74   GQERYRAVTSAYYRGAVGAMLVYDMSKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  133

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFA++E L+F+ETSA+EA NVE AF TVLTEI+ I+++K   A     
Sbjct  134  GTLRAVPTEDAQEFAERENLYFMETSALEATNVESAFLTVLTEIYRILSKK-SLANNGGS  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            +   + SL G  I+V         K   C +S
Sbjct  193  DYGKSGSLKGTAIIVSNHEDPRASKGGCCRTS  224



>ref|XP_010557931.1| PREDICTED: ras-related protein RABA4d-like [Tarenaya hassleriana]
Length=224

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 98/111 (88%), Gaps = 0/111 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRK  398
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE  F T+LTEI+ I+++K
Sbjct  133  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETTFLTILTEIYRIISKK  183



>ref|XP_010418858.1| PREDICTED: ras-related protein RABA4d-like [Camelina sativa]
Length=173

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = -3

Query  718  YRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDRR  539
            YRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL   R
Sbjct  28   YRAVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDLGSLR  87

Query  538  DVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngna  359
             VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  +GN+
Sbjct  88   AVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDADGNS  147

Query  358  aASLTGKKILVPGPGQVIPQKKSMCC  281
            +  L G +I++P   +    K+  CC
Sbjct  148  SL-LKGTRIIIPSEQE--SGKRGGCC  170



>ref|XP_008344635.1| PREDICTED: ras-related protein RGP1-like [Malus domestica]
Length=156

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 115/149 (77%), Gaps = 2/149 (1%)
 Frame = -3

Query  721  RYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDLEDR  542
            RYRAVTSAYYRG+VGAMLVYDITK Q+FDH+ +WLEELR HAD NIV+ML+GNK+DL   
Sbjct  10   RYRAVTSAYYRGSVGAMLVYDITKPQSFDHVTKWLEELRGHADNNIVVMLVGNKSDLGTL  69

Query  541  RDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqgngn  362
            R VP+EDAKEFAQ+E LFF+E SA+EA NVE AF TVLTEI+ IV +K+L   E   +G+
Sbjct  70   RAVPSEDAKEFAQRENLFFMEASALEATNVESAFVTVLTEIYRIVGKKSLIPNEEAESGS  129

Query  361  aaASLTGKKILVPGPGQVIPQKKSMCCSS  275
            ++  L G K++VP   +  PQ  S C SS
Sbjct  130  SSL-LKGTKLVVPRQ-EPEPQASSCCWSS  156



>ref|XP_007140805.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
 gb|ESW12799.1| hypothetical protein PHAVU_008G143600g [Phaseolus vulgaris]
Length=223

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 113/150 (75%), Gaps = 2/150 (1%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HAD+NIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDMTKRQSFDHMVRWLEELRGHADQNIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VP EDA+EFAQ+E LFF+ETSA+E+ NVE  F T+LTEI+ I  +K+L A ++  
Sbjct  133  ASLRAVPMEDAEEFAQRENLFFMETSALESTNVETCFLTILTEIYRIHAKKSLTANDDDN  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
             G+    L G +I+VP        K   CC
Sbjct  193  GGSGL--LKGSRIIVPNQEIGNGGKTGGCC  220



>ref|XP_010111429.1| Ras-related protein RABA4d [Morus notabilis]
 gb|EXC30907.1| Ras-related protein RABA4d [Morus notabilis]
Length=224

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 118/151 (78%), Gaps = 3/151 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQER  AVTSAYYRGAVGAMLVYD+TKRQ+FDH+ RWLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMARWLEELRGHADKNIVIMLIGNKCDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E +FF+ETSA+E+ NVE AF T+LTEI+ I+++KNL A++++ 
Sbjct  131  GSLRAVPTEDAQEFAQRENIFFMETSALESTNVETAFFTILTEIYRIISKKNLTASDHEV  190

Query  370  ngnaaAS-LTGKKILVPGPGQVIPQKKSMCC  281
            N +  +  L G KI+VP       +K   CC
Sbjct  191  NSSGGSGLLKGTKIVVPTQEDSGTRKGGRCC  221



>ref|XP_001753670.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
 gb|EDQ81422.1| Rab11/RabA-family small GTPase [Physcomitrella patens]
Length=221

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/152 (64%), Positives = 116/152 (76%), Gaps = 3/152 (2%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYDITK+Q+FDH+ RWLEELRAHAD NIVIMLIGNK+DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDITKQQSFDHVQRWLEELRAHADANIVIMLIGNKSDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
             + R V T+ A+ +A+KE L FLETSAME+ NVE AF  VL+EI+ IV++  L A ENQG
Sbjct  133  SNLRQVDTDVARVYAEKEKLSFLETSAMESTNVETAFYAVLSEIYKIVSKNALIADENQG  192

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCCSS  275
                   L+G KI +     VI  K++ CCSS
Sbjct  193  GTPL---LSGTKINLTDKDDVIGSKRAGCCSS  221



>gb|AFK40086.1| unknown [Lotus japonicus]
Length=199

 Score =   182 bits (462),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/111 (74%), Positives = 97/111 (87%), Gaps = 0/111 (0%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQERYRAVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HAD NIVIMLIGNK DL
Sbjct  73   GQERYRAVTSAYYRGAVGAMLVYDLTKRQSFDHMAKWLEELRGHADTNIVIMLIGNKCDL  132

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRK  398
               + VPTEDA+EFAQ+E LFF+ETSA+E+ NVE AF T+LTEI+ ++ +K
Sbjct  133  ATLKAVPTEDAQEFAQRENLFFMETSALESTNVETAFLTILTEIYRLIGKK  183



>gb|AAG51053.1|AC069473_15 ras-related GTP-binding protein, putative; 1694-2636 [Arabidopsis 
thaliana]
Length=220

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 5/150 (3%)
 Frame = -3

Query  730  GQERYRAVTSAYYRGAVGAMLVYDITKRQTFDHIPRWLEELRAHADKNIVIMLIGNKTDL  551
            GQER  AVTSAYYRGAVGAMLVYD+TKRQ+FDH+ +WLEELR HADKNIVIMLIGNK DL
Sbjct  73   GQER--AVTSAYYRGAVGAMLVYDMTKRQSFDHMAKWLEELRGHADKNIVIMLIGNKCDL  130

Query  550  EDRRDVPTEDAKEFAQKEGLFFLETSAMEAKNVEEAFTTVLTEIFNIVNRKnlaaaenqg  371
               R VPTEDA+EFAQ+E LFF+ETSA+EA NVE AF T+LTEI+ I+++K+L A ++  
Sbjct  131  GSLRAVPTEDAQEFAQRENLFFMETSALEATNVETAFLTILTEIYRIISKKSLTADDDDA  190

Query  370  ngnaaASLTGKKILVPGPGQVIPQKKSMCC  281
            +GN++  L G +I++P   +    K+  CC
Sbjct  191  DGNSSL-LKGTRIIIPSEQE--SGKRGGCC  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1327220236485